© 2023 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | Ophun1|4139 |
| Gene name | |
| Location | Contig_38:23275..24154 |
| Strand | - |
| Gene length (bp) | 879 |
| Transcript length (bp) | 420 |
| Coding sequence length (bp) | 420 |
| Protein length (aa) | 140 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00238 | Ribosomal_L14 | Ribosomal protein L14p/L23e | 9.2E-33 | 21 | 136 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P0CX42|RL23B_YEAST | 60S ribosomal protein L23-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL23B PE=1 SV=1 | 7 | 139 | 1.0E-75 |
| sp|P0CX41|RL23A_YEAST | 60S ribosomal protein L23-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL23A PE=1 SV=1 | 7 | 139 | 1.0E-75 |
| sp|P62832|RL23_RAT | 60S ribosomal protein L23 OS=Rattus norvegicus GN=Rpl23 PE=2 SV=1 | 1 | 138 | 2.0E-72 |
| sp|P62831|RL23_PIG | 60S ribosomal protein L23 OS=Sus scrofa GN=RPL23 PE=1 SV=1 | 1 | 138 | 2.0E-72 |
| sp|P62830|RL23_MOUSE | 60S ribosomal protein L23 OS=Mus musculus GN=Rpl23 PE=1 SV=1 | 1 | 138 | 2.0E-72 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P0CX42|RL23B_YEAST | 60S ribosomal protein L23-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL23B PE=1 SV=1 | 7 | 139 | 1.0E-75 |
| sp|P0CX41|RL23A_YEAST | 60S ribosomal protein L23-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL23A PE=1 SV=1 | 7 | 139 | 1.0E-75 |
| sp|P62832|RL23_RAT | 60S ribosomal protein L23 OS=Rattus norvegicus GN=Rpl23 PE=2 SV=1 | 1 | 138 | 2.0E-72 |
| sp|P62831|RL23_PIG | 60S ribosomal protein L23 OS=Sus scrofa GN=RPL23 PE=1 SV=1 | 1 | 138 | 2.0E-72 |
| sp|P62830|RL23_MOUSE | 60S ribosomal protein L23 OS=Mus musculus GN=Rpl23 PE=1 SV=1 | 1 | 138 | 2.0E-72 |
| sp|Q90YU5|RL23_ICTPU | 60S ribosomal protein L23 OS=Ictalurus punctatus GN=rpl23 PE=2 SV=2 | 1 | 138 | 2.0E-72 |
| sp|P62829|RL23_HUMAN | 60S ribosomal protein L23 OS=Homo sapiens GN=RPL23 PE=1 SV=1 | 1 | 138 | 2.0E-72 |
| sp|Q3T057|RL23_BOVIN | 60S ribosomal protein L23 OS=Bos taurus GN=RPL23 PE=2 SV=2 | 1 | 138 | 2.0E-72 |
| sp|Q6PC14|RL23_DANRE | 60S ribosomal protein L23 OS=Danio rerio GN=rpl23 PE=2 SV=1 | 1 | 138 | 5.0E-72 |
| sp|Q5REU2|RL23_PONAB | 60S ribosomal protein L23 OS=Pongo abelii GN=RPL23 PE=2 SV=1 | 1 | 138 | 9.0E-72 |
| sp|P0CT61|RL23B_SCHPO | 60S ribosomal protein L23-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2302 PE=3 SV=1 | 4 | 139 | 7.0E-71 |
| sp|P0CT60|RL23A_SCHPO | 60S ribosomal protein L23-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl2301 PE=3 SV=1 | 4 | 139 | 7.0E-71 |
| sp|Q9XSU3|RL23_CANLF | 60S ribosomal protein L23 OS=Canis lupus familiaris GN=RPL23 PE=2 SV=1 | 1 | 138 | 6.0E-70 |
| sp|Q9GNE2|RL23_AEDAE | 60S ribosomal protein L23 OS=Aedes aegypti GN=RpL23-A PE=2 SV=1 | 1 | 138 | 7.0E-70 |
| sp|P49690|RL23_ARATH | 60S ribosomal protein L23 OS=Arabidopsis thaliana GN=RPL23A PE=2 SV=3 | 1 | 139 | 1.0E-69 |
| sp|P48159|RL23_DROME | 60S ribosomal protein L23 OS=Drosophila melanogaster GN=RpL23 PE=1 SV=2 | 1 | 138 | 3.0E-69 |
| sp|Q07760|RL23_TOBAC | 60S ribosomal protein L23 OS=Nicotiana tabacum GN=RPL23 PE=2 SV=1 | 1 | 139 | 1.0E-68 |
| sp|Q9XEK8|RL23_TORRU | 60S ribosomal protein L23 OS=Tortula ruralis GN=RPL23 PE=2 SV=1 | 1 | 139 | 3.0E-66 |
| sp|Q93140|RL23_BRUMA | 60S ribosomal protein L23 OS=Brugia malayi GN=RPL23 PE=2 SV=1 | 1 | 138 | 3.0E-65 |
| sp|P48158|RL23_CAEEL | 60S ribosomal protein L23 OS=Caenorhabditis elegans GN=rpl-23 PE=3 SV=1 | 1 | 138 | 1.0E-63 |
| sp|Q54G86|RL23_DICDI | 60S ribosomal protein L23 OS=Dictyostelium discoideum GN=rpl23 PE=1 SV=1 | 8 | 139 | 7.0E-61 |
| sp|P0DJ53|RL23_TETTS | 60S ribosomal protein L23 OS=Tetrahymena thermophila (strain SB210) GN=RPL23 PE=1 SV=1 | 7 | 139 | 9.0E-55 |
| sp|Q94776|RL23_TRYCR | 60S ribosomal protein L23 OS=Trypanosoma cruzi GN=RPL23 PE=2 SV=1 | 1 | 135 | 9.0E-48 |
| sp|Q8SRA7|RL23_ENCCU | 60S ribosomal protein L23 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPL23 PE=3 SV=1 | 12 | 138 | 1.0E-44 |
| sp|Q9HIR9|RL14_THEAC | 50S ribosomal protein L14 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl14 PE=3 SV=1 | 14 | 139 | 1.0E-44 |
| sp|Q6L1B7|RL14_PICTO | 50S ribosomal protein L14 OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl14 PE=3 SV=1 | 14 | 139 | 4.0E-43 |
| sp|Q97BW6|RL14_THEVO | 50S ribosomal protein L14 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl14 PE=3 SV=1 | 18 | 139 | 9.0E-43 |
| sp|A6VGZ5|RL14_METM7 | 50S ribosomal protein L14 OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl14 PE=3 SV=1 | 19 | 138 | 8.0E-41 |
| sp|Q8TW20|RL14_METKA | 50S ribosomal protein L14 OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl14 PE=3 SV=1 | 18 | 139 | 9.0E-41 |
| sp|A9A9Q4|RL14_METM6 | 50S ribosomal protein L14 OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl14 PE=3 SV=1 | 19 | 138 | 1.0E-40 |
| sp|A0RVY3|RL14_CENSY | 50S ribosomal protein L14 OS=Cenarchaeum symbiosum (strain A) GN=rpl14 PE=3 SV=1 | 15 | 139 | 1.0E-40 |
| sp|A4FWB1|RL14_METM5 | 50S ribosomal protein L14 OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl14 PE=3 SV=1 | 19 | 138 | 3.0E-40 |
| sp|Q6LXE3|RL14_METMP | 50S ribosomal protein L14 OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl14 PE=3 SV=1 | 19 | 138 | 9.0E-40 |
| sp|O28364|RL14_ARCFU | 50S ribosomal protein L14 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl14 PE=3 SV=1 | 18 | 139 | 1.0E-39 |
| sp|O26121|RL14_METTH | 50S ribosomal protein L14 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl14 PE=3 SV=1 | 14 | 139 | 2.0E-39 |
| sp|A6UQ54|RL14_METVS | 50S ribosomal protein L14 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl14 PE=3 SV=1 | 19 | 129 | 5.0E-39 |
| sp|P14031|RL14_METVA | 50S ribosomal protein L14 OS=Methanococcus vannielii GN=rpl14 PE=3 SV=1 | 19 | 129 | 5.0E-39 |
| sp|A6UWU8|RL14_META3 | 50S ribosomal protein L14 OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl14 PE=3 SV=1 | 14 | 128 | 9.0E-39 |
| sp|A2BMC9|RL14_HYPBU | 50S ribosomal protein L14 OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rpl14 PE=3 SV=1 | 10 | 139 | 9.0E-39 |
| sp|A3DNB7|RL14_STAMF | 50S ribosomal protein L14 OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rpl14 PE=3 SV=1 | 1 | 139 | 1.0E-38 |
| sp|Q9YF82|RL14_AERPE | 50S ribosomal protein L14 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl14 PE=3 SV=1 | 15 | 132 | 1.0E-38 |
| sp|Q2NFW7|RL14_METST | 50S ribosomal protein L14 OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl14 PE=3 SV=1 | 19 | 139 | 3.0E-38 |
| sp|A5UL78|RL14_METS3 | 50S ribosomal protein L14 OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl14 PE=3 SV=1 | 18 | 139 | 2.0E-37 |
| sp|Q8U009|RL14_PYRFU | 50S ribosomal protein L14 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl14 PE=1 SV=1 | 1 | 139 | 4.0E-37 |
| sp|A8ACD2|RL14_IGNH4 | 50S ribosomal protein L14 OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rpl14 PE=3 SV=1 | 12 | 139 | 9.0E-37 |
| sp|P54037|RL14_METJA | 50S ribosomal protein L14 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl14 PE=3 SV=1 | 18 | 139 | 1.0E-36 |
| sp|Q9V1U6|RL14_PYRAB | 50S ribosomal protein L14 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl14 PE=3 SV=1 | 1 | 139 | 2.0E-36 |
| sp|A0B9W0|RL14_METTP | 50S ribosomal protein L14 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rpl14 PE=3 SV=1 | 10 | 139 | 5.0E-36 |
| sp|O59427|RL14_PYRHO | 50S ribosomal protein L14 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl14 PE=3 SV=2 | 1 | 139 | 7.0E-36 |
| sp|Q12ZU1|RL14_METBU | 50S ribosomal protein L14 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rpl14 PE=3 SV=1 | 10 | 139 | 2.0E-35 |
| sp|A9A5I5|RL14_NITMS | 50S ribosomal protein L14 OS=Nitrosopumilus maritimus (strain SCM1) GN=rpl14 PE=3 SV=1 | 15 | 139 | 4.0E-35 |
| sp|O24787|RL14_HALSA | 50S ribosomal protein L14 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl14 PE=3 SV=1 | 12 | 139 | 4.0E-35 |
| sp|B0R666|RL14_HALS3 | 50S ribosomal protein L14 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl14 PE=3 SV=1 | 12 | 139 | 4.0E-35 |
| sp|Q9UX97|RL14_SULSO | 50S ribosomal protein L14 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl14 PE=1 SV=1 | 10 | 139 | 9.0E-35 |
| sp|Q975J0|RL14_SULTO | 50S ribosomal protein L14 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl14 PE=3 SV=2 | 10 | 139 | 2.0E-34 |
| sp|B1L776|RL14_KORCO | 50S ribosomal protein L14 OS=Korarchaeum cryptofilum (strain OPF8) GN=rpl14 PE=3 SV=1 | 1 | 139 | 5.0E-34 |
| sp|A4YCX6|RL14_METS5 | 50S ribosomal protein L14 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpl14 PE=3 SV=1 | 10 | 139 | 3.0E-33 |
| sp|B9LSR7|RL14_HALLT | 50S ribosomal protein L14 OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rpl14 PE=3 SV=1 | 12 | 139 | 4.0E-33 |
| sp|Q18GF9|RL14_HALWD | 50S ribosomal protein L14 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rpl14 PE=3 SV=1 | 12 | 139 | 7.0E-33 |
| sp|A1RXG2|RL14_THEPD | 50S ribosomal protein L14 OS=Thermofilum pendens (strain Hrk 5) GN=rpl14 PE=3 SV=1 | 12 | 139 | 9.0E-33 |
| sp|Q4JB50|RL14_SULAC | 50S ribosomal protein L14 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpl14 PE=3 SV=1 | 10 | 139 | 5.0E-32 |
| sp|Q3IMX8|RL14_NATPD | 50S ribosomal protein L14 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rpl14 PE=3 SV=1 | 15 | 139 | 6.0E-32 |
| sp|Q8TRT7|RL14_METAC | 50S ribosomal protein L14 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpl14 PE=3 SV=1 | 18 | 139 | 2.0E-31 |
| sp|P22450|RL14_HALMA | 50S ribosomal protein L14 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl14 PE=1 SV=1 | 15 | 139 | 2.0E-31 |
| sp|Q8PV40|RL14_METMA | 50S ribosomal protein L14 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpl14 PE=3 SV=2 | 18 | 139 | 4.0E-31 |
| sp|Q46GA5|RL14_METBF | 50S ribosomal protein L14 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rpl14 PE=3 SV=1 | 18 | 139 | 9.0E-31 |
| sp|A1RRV9|RL14_PYRIL | 50S ribosomal protein L14 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl14 PE=3 SV=1 | 12 | 139 | 1.0E-30 |
| sp|Q8ZTR0|RL14_PYRAE | 50S ribosomal protein L14 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl14 PE=3 SV=1 | 12 | 139 | 4.0E-30 |
| sp|A3MX34|RL14_PYRCJ | 50S ribosomal protein L14 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rpl14 PE=3 SV=1 | 12 | 139 | 5.0E-30 |
| sp|A4WLG6|RL14_PYRAR | 50S ribosomal protein L14 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rpl14 PE=3 SV=1 | 12 | 139 | 2.0E-29 |
| sp|Q5JJF8|RL14_THEKO | 50S ribosomal protein L14 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl14 PE=3 SV=1 | 1 | 139 | 8.0E-29 |
| sp|A7I5P9|RL14_METB6 | 50S ribosomal protein L14 OS=Methanoregula boonei (strain 6A8) GN=rpl14 PE=3 SV=1 | 18 | 139 | 9.0E-29 |
| sp|A8M8T7|RL14_CALMQ | 50S ribosomal protein L14 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rpl14 PE=3 SV=1 | 12 | 139 | 2.0E-28 |
| sp|A2SPL2|RL14_METLZ | 50S ribosomal protein L14 OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rpl14 PE=3 SV=1 | 14 | 139 | 2.0E-28 |
| sp|Q74N81|RL14_NANEQ | 50S ribosomal protein L14 OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl14 PE=3 SV=1 | 18 | 139 | 2.0E-28 |
| sp|A3CT07|RL14_METMJ | 50S ribosomal protein L14 OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rpl14 PE=3 SV=1 | 14 | 139 | 3.0E-28 |
| sp|Q0W1X8|RL14_METAR | 50S ribosomal protein L14 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rpl14 PE=3 SV=1 | 12 | 139 | 4.0E-27 |
| sp|Q2FT33|RL14_METHJ | 50S ribosomal protein L14 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rpl14 PE=3 SV=1 | 13 | 139 | 1.0E-26 |
| sp|Q3Z971|RL14_DEHM1 | 50S ribosomal protein L14 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rplN PE=3 SV=1 | 25 | 123 | 8.0E-18 |
| sp|Q3ZZL4|RL14_DEHMC | 50S ribosomal protein L14 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-17 |
| sp|A5FRY5|RL14_DEHMB | 50S ribosomal protein L14 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-17 |
| sp|B0C1E3|RL14_ACAM1 | 50S ribosomal protein L14 OS=Acaryochloris marina (strain MBIC 11017) GN=rplN PE=3 SV=1 | 23 | 123 | 5.0E-17 |
| sp|P73310|RL14_SYNY3 | 50S ribosomal protein L14 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rplN PE=1 SV=1 | 25 | 123 | 5.0E-17 |
| sp|Q32RV2|RK14_STAPU | 50S ribosomal protein L14, chloroplastic OS=Staurastrum punctulatum GN=rpl14 PE=3 SV=1 | 23 | 133 | 6.0E-17 |
| sp|Q32RN4|RK14_ZYGCR | 50S ribosomal protein L14, chloroplastic OS=Zygnema circumcarinatum GN=rpl14 PE=3 SV=1 | 23 | 133 | 6.0E-17 |
| sp|P0C440|RK14_ORYSJ | 50S ribosomal protein L14, chloroplastic OS=Oryza sativa subsp. japonica GN=rpl14 PE=3 SV=1 | 23 | 133 | 8.0E-17 |
| sp|P0C439|RK14_ORYSI | 50S ribosomal protein L14, chloroplastic OS=Oryza sativa subsp. indica GN=rpl14 PE=3 SV=1 | 23 | 133 | 8.0E-17 |
| sp|P0C438|RK14_ORYSA | 50S ribosomal protein L14, chloroplastic OS=Oryza sativa GN=rpl14 PE=3 SV=1 | 23 | 133 | 8.0E-17 |
| sp|Q6END7|RK14_ORYNI | 50S ribosomal protein L14, chloroplastic OS=Oryza nivara GN=rpl14 PE=3 SV=1 | 23 | 133 | 8.0E-17 |
| sp|Q6YXL0|RK14_PHYPA | 50S ribosomal protein L14, chloroplastic OS=Physcomitrella patens subsp. patens GN=rpl14 PE=3 SV=1 | 25 | 126 | 9.0E-17 |
| sp|P06381|RK14_MARPO | 50S ribosomal protein L14, chloroplastic OS=Marchantia polymorpha GN=rpl14 PE=3 SV=1 | 25 | 126 | 9.0E-17 |
| sp|B1XJS9|RL14_SYNP2 | 50S ribosomal protein L14 OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-16 |
| sp|B9KZX7|RL14_THERP | 50S ribosomal protein L14 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rplN PE=3 SV=1 | 28 | 126 | 2.0E-16 |
| sp|Q6ENS7|RK14_SACOF | 50S ribosomal protein L14, chloroplastic OS=Saccharum officinarum GN=rpl14 PE=3 SV=1 | 23 | 133 | 2.0E-16 |
| sp|Q6L3G2|RK14_SACHY | 50S ribosomal protein L14, chloroplastic OS=Saccharum hybrid GN=rpl14 PE=3 SV=1 | 23 | 133 | 2.0E-16 |
| sp|A4FPL5|RL14_SACEN | 50S ribosomal protein L14 OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-16 |
| sp|A8Y9C3|RK14_LOLPR | 50S ribosomal protein L14, chloroplastic OS=Lolium perenne GN=rpl14 PE=3 SV=1 | 23 | 133 | 2.0E-16 |
| sp|A1E9M7|RK14_HORVU | 50S ribosomal protein L14, chloroplastic OS=Hordeum vulgare GN=rpl14 PE=3 SV=1 | 23 | 133 | 2.0E-16 |
| sp|A1EA45|RK14_AGRST | 50S ribosomal protein L14, chloroplastic OS=Agrostis stolonifera GN=rpl14 PE=3 SV=1 | 23 | 133 | 2.0E-16 |
| sp|P08529|RK14_MAIZE | 50S ribosomal protein L14, chloroplastic OS=Zea mays GN=rpl14 PE=1 SV=2 | 23 | 127 | 3.0E-16 |
| sp|B7KHZ7|RL14_CYAP7 | 50S ribosomal protein L14 OS=Cyanothece sp. (strain PCC 7424) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-16 |
| sp|Q9TL22|RK14_NEPOL | 50S ribosomal protein L14, chloroplastic OS=Nephroselmis olivacea GN=rpl14 PE=3 SV=1 | 23 | 123 | 4.0E-16 |
| sp|B7K238|RL14_CYAP8 | 50S ribosomal protein L14 OS=Cyanothece sp. (strain PCC 8801) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-16 |
| sp|B8HMR4|RL14_CYAP4 | 50S ribosomal protein L14 OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=rplN PE=3 SV=1 | 23 | 123 | 5.0E-16 |
| sp|A1E9W1|RK14_SORBI | 50S ribosomal protein L14, chloroplastic OS=Sorghum bicolor GN=rpl14 PE=3 SV=1 | 23 | 133 | 5.0E-16 |
| sp|B2S2E6|RL14_TREPS | 50S ribosomal protein L14 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rplN PE=3 SV=1 | 19 | 133 | 7.0E-16 |
| sp|O83229|RL14_TREPA | 50S ribosomal protein L14 OS=Treponema pallidum (strain Nichols) GN=rplN PE=1 SV=1 | 19 | 133 | 7.0E-16 |
| sp|Q39XZ6|RL14_GEOMG | 50S ribosomal protein L14 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rplN PE=3 SV=1 | 19 | 123 | 7.0E-16 |
| sp|Q33BZ6|RK14_NICTO | 50S ribosomal protein L14, chloroplastic OS=Nicotiana tomentosiformis GN=rpl14 PE=3 SV=1 | 25 | 133 | 8.0E-16 |
| sp|Q8RIG5|RL14_FUSNN | 50S ribosomal protein L14 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rplN PE=3 SV=1 | 23 | 123 | 8.0E-16 |
| sp|B3TN86|RK14_BRADI | 50S ribosomal protein L14, chloroplastic OS=Brachypodium distachyon GN=rpl14 PE=3 SV=1 | 23 | 133 | 8.0E-16 |
| sp|A4GYU7|RK14_POPTR | 50S ribosomal protein L14, chloroplastic OS=Populus trichocarpa GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-15 |
| sp|B1ZND8|RL14_OPITP | 50S ribosomal protein L14 OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=rplN PE=3 SV=1 | 19 | 123 | 1.0E-15 |
| sp|B2XWR0|RK14_FAGEA | 50S ribosomal protein L14, chloroplastic OS=Fagopyrum esculentum subsp. ancestrale GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-15 |
| sp|A1ALV1|RL14_PELPD | 50S ribosomal protein L14 OS=Pelobacter propionicus (strain DSM 2379) GN=rplN PE=3 SV=1 | 19 | 123 | 2.0E-15 |
| sp|Q8WHY6|RK14_PSINU | 50S ribosomal protein L14, chloroplastic OS=Psilotum nudum GN=rpl14 PE=3 SV=1 | 23 | 130 | 2.0E-15 |
| sp|P06382|RK14_TOBAC | 50S ribosomal protein L14, chloroplastic OS=Nicotiana tabacum GN=rpl14 PE=3 SV=2 | 25 | 133 | 2.0E-15 |
| sp|Q2VEE4|RK14_SOLTU | 50S ribosomal protein L14, chloroplastic OS=Solanum tuberosum GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-15 |
| sp|Q2MI64|RK14_SOLLC | 50S ribosomal protein L14, chloroplastic OS=Solanum lycopersicum GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-15 |
| sp|Q2MIF1|RK14_SOLBU | 50S ribosomal protein L14, chloroplastic OS=Solanum bulbocastanum GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-15 |
| sp|Q3C1L9|RK14_NICSY | 50S ribosomal protein L14, chloroplastic OS=Nicotiana sylvestris GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-15 |
| sp|B0JHZ3|RL14_MICAN | 50S ribosomal protein L14 OS=Microcystis aeruginosa (strain NIES-843) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-15 |
| sp|Q14FC1|RK14_POPAL | 50S ribosomal protein L14, chloroplastic OS=Populus alba GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-15 |
| sp|A2T370|RK14_ANGEV | 50S ribosomal protein L14, chloroplastic OS=Angiopteris evecta GN=rpl14 PE=3 SV=1 | 23 | 126 | 2.0E-15 |
| sp|Q1AU39|RL14_RUBXD | 50S ribosomal protein L14 OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=rplN PE=3 SV=1 | 25 | 133 | 2.0E-15 |
| sp|Q4G356|RK14_EMIHU | 50S ribosomal protein L14, chloroplastic OS=Emiliania huxleyi GN=rpl14 PE=3 SV=1 | 23 | 126 | 2.0E-15 |
| sp|Q8S8V7|RK14_ATRBE | 50S ribosomal protein L14, chloroplastic OS=Atropa belladonna GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-15 |
| sp|B1WQS0|RL14_CYAA5 | 50S ribosomal protein L14 OS=Cyanothece sp. (strain ATCC 51142) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-15 |
| sp|Q1KVR1|RK14_ACUOB | 50S ribosomal protein L14, chloroplastic OS=Acutodesmus obliquus GN=rpl14 PE=3 SV=1 | 25 | 123 | 3.0E-15 |
| sp|Q95H51|RK14_WHEAT | 50S ribosomal protein L14, chloroplastic OS=Triticum aestivum GN=rpl14 PE=3 SV=1 | 23 | 123 | 3.0E-15 |
| sp|Q06GM3|RK14_PIPCE | 50S ribosomal protein L14, chloroplastic OS=Piper cenocladum GN=rpl14 PE=3 SV=1 | 25 | 133 | 3.0E-15 |
| sp|O24699|RL14_SYNP6 | 50S ribosomal protein L14 OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-15 |
| sp|Q31L17|RL14_SYNE7 | 50S ribosomal protein L14 OS=Synechococcus elongatus (strain PCC 7942) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-15 |
| sp|Q8DMM2|RL14_THEEB | 50S ribosomal protein L14 OS=Thermosynechococcus elongatus (strain BP-1) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-15 |
| sp|Q8WKP4|RK14_CUCSA | 50S ribosomal protein L14, chloroplastic OS=Cucumis sativus GN=rpl14 PE=2 SV=1 | 23 | 127 | 3.0E-15 |
| sp|Q0G9S5|RK14_DAUCA | 50S ribosomal protein L14, chloroplastic OS=Daucus carota GN=rpl14 PE=3 SV=1 | 23 | 133 | 3.0E-15 |
| sp|A9L9D2|RK14_LEMMI | 50S ribosomal protein L14, chloroplastic OS=Lemna minor GN=rpl14 PE=3 SV=1 | 23 | 133 | 4.0E-15 |
| sp|A6MMY1|RK14_ILLOL | 50S ribosomal protein L14, chloroplastic OS=Illicium oligandrum GN=rpl14 PE=3 SV=1 | 25 | 133 | 5.0E-15 |
| sp|A0A372|RK14_COFAR | 50S ribosomal protein L14, chloroplastic OS=Coffea arabica GN=rpl14 PE=3 SV=1 | 25 | 133 | 5.0E-15 |
| sp|Q68RX0|RK14_PANGI | 50S ribosomal protein L14, chloroplastic OS=Panax ginseng GN=rpl14 PE=3 SV=1 | 23 | 133 | 6.0E-15 |
| sp|P09596|RK14_SPIOL | 50S ribosomal protein L14, chloroplastic OS=Spinacia oleracea GN=rpl14 PE=1 SV=2 | 25 | 133 | 6.0E-15 |
| sp|A1VEA6|RL14_DESVV | 50S ribosomal protein L14 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rplN PE=3 SV=1 | 19 | 123 | 7.0E-15 |
| sp|Q72CH0|RL14_DESVH | 50S ribosomal protein L14 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rplN PE=3 SV=1 | 19 | 123 | 7.0E-15 |
| sp|B1NWI6|RK14_MANES | 50S ribosomal protein L14, chloroplastic OS=Manihot esculenta GN=rpl14 PE=3 SV=1 | 25 | 133 | 7.0E-15 |
| sp|C5CGQ4|RL14_KOSOT | 50S ribosomal protein L14 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rplN PE=3 SV=1 | 19 | 133 | 7.0E-15 |
| sp|Q06GW0|RK14_DRIGR | 50S ribosomal protein L14, chloroplastic OS=Drimys granadensis GN=rpl14 PE=3 SV=1 | 25 | 133 | 8.0E-15 |
| sp|Q3V4Z7|RK14_ACOCL | 50S ribosomal protein L14, chloroplastic OS=Acorus calamus GN=rpl14 PE=3 SV=1 | 23 | 133 | 8.0E-15 |
| sp|Q09G09|RK14_PLAOC | 50S ribosomal protein L14, chloroplastic OS=Platanus occidentalis GN=rpl14 PE=3 SV=1 | 25 | 133 | 8.0E-15 |
| sp|Q110B7|RL14_TRIEI | 50S ribosomal protein L14 OS=Trichodesmium erythraeum (strain IMS101) GN=rplN PE=3 SV=1 | 23 | 123 | 9.0E-15 |
| sp|Q2PMP9|RK14_SOYBN | 50S ribosomal protein L14, chloroplastic OS=Glycine max GN=rpl14 PE=3 SV=1 | 25 | 133 | 9.0E-15 |
| sp|Q0G9I2|RK14_LIRTU | 50S ribosomal protein L14, chloroplastic OS=Liriodendron tulipifera GN=rpl14 PE=3 SV=1 | 25 | 133 | 9.0E-15 |
| sp|A6MMF9|RK14_CHLSC | 50S ribosomal protein L14, chloroplastic OS=Chloranthus spicatus GN=rpl14 PE=3 SV=1 | 25 | 133 | 9.0E-15 |
| sp|Q2RQX0|RL14_RHORT | 50S ribosomal protein L14 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-14 |
| sp|B0Z5G4|RK14_OENPA | 50S ribosomal protein L14, chloroplastic OS=Oenothera parviflora GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-14 |
| sp|B0Z580|RK14_OENGL | 50S ribosomal protein L14, chloroplastic OS=Oenothera glazioviana GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-14 |
| sp|Q9MTI9|RK14_OENEH | 50S ribosomal protein L14, chloroplastic OS=Oenothera elata subsp. hookeri GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-14 |
| sp|B0Z4Z6|RK14_OENBI | 50S ribosomal protein L14, chloroplastic OS=Oenothera biennis GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-14 |
| sp|B0Z4R2|RK14_OENAR | 50S ribosomal protein L14, chloroplastic OS=Oenothera argillicola GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-14 |
| sp|Q6EW15|RK14_NYMAL | 50S ribosomal protein L14, chloroplastic OS=Nymphaea alba GN=rpl14 PE=3 SV=1 | 23 | 133 | 1.0E-14 |
| sp|A4GG86|RK14_PHAVU | 50S ribosomal protein L14, chloroplastic OS=Phaseolus vulgaris GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-14 |
| sp|Q0ZIY2|RK14_VITVI | 50S ribosomal protein L14, chloroplastic OS=Vitis vinifera GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-14 |
| sp|B7IHV6|RL14_THEAB | 50S ribosomal protein L14 OS=Thermosipho africanus (strain TCF52B) GN=rplN PE=3 SV=1 | 23 | 126 | 1.0E-14 |
| sp|C1B022|RL14_RHOOB | 50S ribosomal protein L14 OS=Rhodococcus opacus (strain B4) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-14 |
| sp|Q0S3G6|RL14_RHOJR | 50S ribosomal protein L14 OS=Rhodococcus jostii (strain RHA1) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-14 |
| sp|Q8M9V2|RK14_CHAGL | 50S ribosomal protein L14, chloroplastic OS=Chaetosphaeridium globosum GN=rpl14 PE=3 SV=1 | 23 | 126 | 1.0E-14 |
| sp|Q2L941|RK14_GOSHI | 50S ribosomal protein L14, chloroplastic OS=Gossypium hirsutum GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-14 |
| sp|A0ZZ71|RK14_GOSBA | 50S ribosomal protein L14, chloroplastic OS=Gossypium barbadense GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-14 |
| sp|Q09FS4|RK14_NANDO | 50S ribosomal protein L14, chloroplastic OS=Nandina domestica GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-14 |
| sp|Q2W2K1|RL14_MAGSA | 50S ribosomal protein L14 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-14 |
| sp|A8SEE0|RK14_CERDE | 50S ribosomal protein L14, chloroplastic OS=Ceratophyllum demersum GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-14 |
| sp|Q70XX4|RK14_AMBTC | 50S ribosomal protein L14, chloroplastic OS=Amborella trichopoda GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-14 |
| sp|A9B421|RL14_HERA2 | 50S ribosomal protein L14 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-14 |
| sp|A0LIK0|RL14_SYNFM | 50S ribosomal protein L14 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-14 |
| sp|B2ITP5|RL14_NOSP7 | 50S ribosomal protein L14 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-14 |
| sp|Q5FM80|RL14_LACAC | 50S ribosomal protein L14 OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-14 |
| sp|A8YXL5|RL14_LACH4 | 50S ribosomal protein L14 OS=Lactobacillus helveticus (strain DPC 4571) GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-14 |
| sp|Q20F08|RK14_OLTVI | 50S ribosomal protein L14, chloroplastic OS=Oltmannsiellopsis viridis GN=rpl14 PE=3 SV=1 | 25 | 126 | 2.0E-14 |
| sp|Q49KW2|RK14_EUCGG | 50S ribosomal protein L14, chloroplastic OS=Eucalyptus globulus subsp. globulus GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-14 |
| sp|A6LLM3|RL14_THEM4 | 50S ribosomal protein L14 OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rplN PE=3 SV=1 | 23 | 126 | 2.0E-14 |
| sp|Q3BAK0|RK14_PHAAO | 50S ribosomal protein L14, chloroplastic OS=Phalaenopsis aphrodite subsp. formosana GN=rpl14 PE=3 SV=1 | 23 | 133 | 2.0E-14 |
| sp|Q7YJU2|RK14_CALFG | 50S ribosomal protein L14, chloroplastic OS=Calycanthus floridus var. glaucus GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-14 |
| sp|Q0P3L5|RK14_OSTTA | 50S ribosomal protein L14, chloroplastic OS=Ostreococcus tauri GN=rpl14 PE=3 SV=1 | 25 | 126 | 2.0E-14 |
| sp|B5LMQ9|RK14_CICAR | 50S ribosomal protein L14, chloroplastic OS=Cicer arietinum GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-14 |
| sp|A7Y3I6|RK14_IPOPU | 50S ribosomal protein L14, chloroplastic OS=Ipomoea purpurea GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-14 |
| sp|B0RB49|RL14_CLAMS | 50S ribosomal protein L14 OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rplN PE=3 SV=2 | 25 | 123 | 2.0E-14 |
| sp|A5CUA4|RL14_CLAM3 | 50S ribosomal protein L14 OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-14 |
| sp|Q83FZ6|RL14_TROWT | 50S ribosomal protein L14 OS=Tropheryma whipplei (strain Twist) GN=rplN PE=3 SV=1 | 25 | 133 | 2.0E-14 |
| sp|Q83I68|RL14_TROW8 | 50S ribosomal protein L14 OS=Tropheryma whipplei (strain TW08/27) GN=rplN PE=3 SV=1 | 25 | 133 | 2.0E-14 |
| sp|B6IRR6|RL14_RHOCS | 50S ribosomal protein L14 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-14 |
| sp|Q2S3Q4|RL14_SALRD | 50S ribosomal protein L14 OS=Salinibacter ruber (strain DSM 13855 / M31) GN=rplN PE=3 SV=1 | 25 | 133 | 3.0E-14 |
| sp|P41633|RK14_PINTH | 50S ribosomal protein L14, chloroplastic OS=Pinus thunbergii GN=rpl14 PE=3 SV=1 | 25 | 133 | 3.0E-14 |
| sp|Q7GUC7|RK14_PINKO | 50S ribosomal protein L14, chloroplastic OS=Pinus koraiensis GN=rpl14 PE=3 SV=1 | 25 | 133 | 3.0E-14 |
| sp|Q6B8W3|RK14_GRATL | 50S ribosomal protein L14, chloroplastic OS=Gracilaria tenuistipitata var. liui GN=rpl14 PE=3 SV=1 | 19 | 123 | 3.0E-14 |
| sp|B2LMN0|RK14_GUIAB | 50S ribosomal protein L14, chloroplastic OS=Guizotia abyssinica GN=rpl14 PE=3 SV=1 | 25 | 133 | 3.0E-14 |
| sp|P11094|RK14_CHLRE | 50S ribosomal protein L14, chloroplastic OS=Chlamydomonas reinhardtii GN=rpl14 PE=3 SV=1 | 23 | 123 | 3.0E-14 |
| sp|P23405|RK14_CYAPA | 50S ribosomal protein L14, cyanelle OS=Cyanophora paradoxa GN=rpl14 PE=3 SV=1 | 23 | 123 | 4.0E-14 |
| sp|B8DNA6|RL14_DESVM | 50S ribosomal protein L14 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rplN PE=3 SV=1 | 19 | 123 | 4.0E-14 |
| sp|Q2LQB0|RL14_SYNAS | 50S ribosomal protein L14 OS=Syntrophus aciditrophicus (strain SB) GN=rplN PE=3 SV=2 | 19 | 123 | 4.0E-14 |
| sp|A8F4S1|RL14_PSELT | 50S ribosomal protein L14 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rplN PE=3 SV=1 | 23 | 126 | 4.0E-14 |
| sp|A7M999|RK14_CUSRE | 50S ribosomal protein L14, plastid OS=Cuscuta reflexa GN=rpl14 PE=3 SV=1 | 25 | 133 | 4.0E-14 |
| sp|B1A971|RK14_CARPA | 50S ribosomal protein L14, chloroplastic OS=Carica papaya GN=rpl14 PE=3 SV=1 | 25 | 133 | 5.0E-14 |
| sp|A0M588|RL14_GRAFK | 50S ribosomal protein L14 OS=Gramella forsetii (strain KT0803) GN=rplN PE=3 SV=1 | 25 | 123 | 5.0E-14 |
| sp|C0Q9W3|RL14_DESAH | 50S ribosomal protein L14 OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=rplN PE=3 SV=1 | 25 | 123 | 5.0E-14 |
| sp|B3E7U5|RL14_GEOLS | 50S ribosomal protein L14 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rplN PE=3 SV=1 | 19 | 123 | 6.0E-14 |
| sp|Q332U0|RK14_LACSA | 50S ribosomal protein L14, chloroplastic OS=Lactuca sativa GN=rpl14 PE=3 SV=1 | 25 | 133 | 6.0E-14 |
| sp|Q1KXS2|RK14_HELAN | 50S ribosomal protein L14, chloroplastic OS=Helianthus annuus GN=rpl14 PE=3 SV=1 | 25 | 133 | 6.0E-14 |
| sp|Q1ACG1|RK14_CHAVU | 50S ribosomal protein L14, chloroplastic OS=Chara vulgaris GN=rpl14 PE=3 SV=1 | 19 | 126 | 6.0E-14 |
| sp|A9H3N4|RL14_GLUDA | 50S ribosomal protein L14 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rplN PE=3 SV=1 | 25 | 123 | 6.0E-14 |
| sp|A8W3L8|RK14_CUSOB | 50S ribosomal protein L14, plastid OS=Cuscuta obtusiflora GN=rpl14 PE=3 SV=1 | 25 | 127 | 6.0E-14 |
| sp|Q09ME1|RK14_CITSI | 50S ribosomal protein L14, chloroplastic OS=Citrus sinensis GN=rpl14 PE=3 SV=1 | 25 | 133 | 6.0E-14 |
| sp|B3EUL3|RL14_AMOA5 | 50S ribosomal protein L14 OS=Amoebophilus asiaticus (strain 5a2) GN=rplN PE=3 SV=1 | 25 | 126 | 6.0E-14 |
| sp|Q8YPI9|RL14_NOSS1 | 50S ribosomal protein L14 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rplN PE=3 SV=1 | 25 | 123 | 7.0E-14 |
| sp|Q3MFB1|RL14_ANAVT | 50S ribosomal protein L14 OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=rplN PE=3 SV=1 | 25 | 123 | 7.0E-14 |
| sp|Q73PM2|RL14_TREDE | 50S ribosomal protein L14 OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rplN PE=3 SV=1 | 19 | 123 | 8.0E-14 |
| sp|Q9BBQ0|RK14_LOTJA | 50S ribosomal protein L14, chloroplastic OS=Lotus japonicus GN=rpl14 PE=3 SV=1 | 25 | 133 | 8.0E-14 |
| sp|Q01WA2|RL14_SOLUE | 50S ribosomal protein L14 OS=Solibacter usitatus (strain Ellin6076) GN=rplN PE=3 SV=1 | 23 | 123 | 8.0E-14 |
| sp|A7M932|RK14_CUSGR | 50S ribosomal protein L14, plastid OS=Cuscuta gronovii GN=rpl14 PE=3 SV=1 | 25 | 127 | 8.0E-14 |
| sp|B3WAK7|RL14_LACCB | 50S ribosomal protein L14 OS=Lactobacillus casei (strain BL23) GN=rplN PE=3 SV=1 | 25 | 123 | 8.0E-14 |
| sp|Q034Z3|RL14_LACC3 | 50S ribosomal protein L14 OS=Lactobacillus casei (strain ATCC 334) GN=rplN PE=3 SV=1 | 25 | 123 | 8.0E-14 |
| sp|A5GAX4|RL14_GEOUR | 50S ribosomal protein L14 OS=Geobacter uraniireducens (strain Rf4) GN=rplN PE=3 SV=1 | 19 | 123 | 8.0E-14 |
| sp|B9M6G8|RL14_GEODF | 50S ribosomal protein L14 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rplN PE=3 SV=1 | 19 | 123 | 8.0E-14 |
| sp|A6MM73|RK14_BUXMI | 50S ribosomal protein L14, chloroplastic OS=Buxus microphylla GN=rpl14 PE=3 SV=1 | 25 | 133 | 8.0E-14 |
| sp|A6YGC8|RK14_LEPTE | 50S ribosomal protein L14, chloroplastic OS=Leptosira terrestris GN=rpl14 PE=3 SV=1 | 25 | 126 | 9.0E-14 |
| sp|A5FMZ0|RL14_FLAJ1 | 50S ribosomal protein L14 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rplN PE=3 SV=1 | 25 | 126 | 9.0E-14 |
| sp|A6W5U8|RL14_KINRD | 50S ribosomal protein L14 OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=rplN PE=3 SV=1 | 25 | 126 | 9.0E-14 |
| sp|Q1GBK8|RL14_LACDA | 50S ribosomal protein L14 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-13 |
| sp|A4QJW7|RK14_OLIPU | 50S ribosomal protein L14, chloroplastic OS=Olimarabidopsis pumila GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-13 |
| sp|A4QLW9|RK14_NASOF | 50S ribosomal protein L14, chloroplastic OS=Nasturtium officinale GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-13 |
| sp|A4QLN0|RK14_LOBMA | 50S ribosomal protein L14, chloroplastic OS=Lobularia maritima GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-13 |
| sp|A4QLE2|RK14_LEPVR | 50S ribosomal protein L14, chloroplastic OS=Lepidium virginicum GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-13 |
| sp|A4QKW7|RK14_CRUWA | 50S ribosomal protein L14, chloroplastic OS=Crucihimalaya wallichii GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-13 |
| sp|A4QKE1|RK14_BARVE | 50S ribosomal protein L14, chloroplastic OS=Barbarea verna GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-13 |
| sp|P56792|RK14_ARATH | 50S ribosomal protein L14, chloroplastic OS=Arabidopsis thaliana GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-13 |
| sp|A4QJN5|RK14_AETGR | 50S ribosomal protein L14, chloroplastic OS=Aethionema grandiflorum GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-13 |
| sp|A4QJF1|RK14_AETCO | 50S ribosomal protein L14, chloroplastic OS=Aethionema cordifolium GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-13 |
| sp|C3PL17|RL14_CORA7 | 50S ribosomal protein L14 OS=Corynebacterium aurimucosum (strain ATCC 700975 / DSM 44827 / CN-1) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-13 |
| sp|Q04C05|RL14_LACDB | 50S ribosomal protein L14 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-13 |
| sp|A6GZ89|RL14_FLAPJ | 50S ribosomal protein L14 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-13 |
| sp|Q5FTZ3|RL14_GLUOX | 50S ribosomal protein L14 OS=Gluconobacter oxydans (strain 621H) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-13 |
| sp|Q85CT4|RK14_ANTFO | 50S ribosomal protein L14, chloroplastic OS=Anthoceros formosae GN=rpl14 PE=2 SV=1 | 25 | 124 | 1.0E-13 |
| sp|A4QKM8|RK14_CAPBU | 50S ribosomal protein L14, chloroplastic OS=Capsella bursa-pastoris GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-13 |
| sp|Q8NSZ4|RL14_CORGL | 50S ribosomal protein L14 OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-13 |
| sp|A4QBJ4|RL14_CORGB | 50S ribosomal protein L14 OS=Corynebacterium glutamicum (strain R) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-13 |
| sp|Q09WY1|RK14_MORIN | 50S ribosomal protein L14, chloroplastic OS=Morus indica GN=rpl14 PE=3 SV=1 | 25 | 133 | 1.0E-13 |
| sp|P56363|RK14_CHLVU | 50S ribosomal protein L14, chloroplastic OS=Chlorella vulgaris GN=rpl14 PE=3 SV=1 | 25 | 123 | 1.0E-13 |
| sp|A6Q1I8|RL14_NITSB | 50S ribosomal protein L14 OS=Nitratiruptor sp. (strain SB155-2) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-13 |
| sp|B1VEW4|RL14_CORU7 | 50S ribosomal protein L14 OS=Corynebacterium urealyticum (strain ATCC 43042 / DSM 7109) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-13 |
| sp|B8D0D4|RL14_HALOH | 50S ribosomal protein L14 OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-13 |
| sp|A6MMP4|RK14_DIOEL | 50S ribosomal protein L14, chloroplastic OS=Dioscorea elephantipes GN=rpl14 PE=3 SV=1 | 23 | 133 | 2.0E-13 |
| sp|B3QYD4|RL14_CHLT3 | 50S ribosomal protein L14 OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rplN PE=3 SV=1 | 28 | 123 | 2.0E-13 |
| sp|Q1GPA9|RL14_SPHAL | 50S ribosomal protein L14 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-13 |
| sp|B2X1Y5|RK14_OEDCA | 50S ribosomal protein L14, chloroplastic OS=Oedogonium cardiacum GN=rpl14 PE=3 SV=1 | 23 | 123 | 2.0E-13 |
| sp|B1W3Z7|RL14_STRGG | 50S ribosomal protein L14 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-13 |
| sp|Q2G8X0|RL14_NOVAD | 50S ribosomal protein L14 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-13 |
| sp|Q8FS71|RL14_COREF | 50S ribosomal protein L14 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=rplN PE=3 SV=2 | 25 | 126 | 2.0E-13 |
| sp|A4QL55|RK14_DRANE | 50S ribosomal protein L14, chloroplastic OS=Draba nemorosa GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-13 |
| sp|A4QK54|RK14_ARAHI | 50S ribosomal protein L14, chloroplastic OS=Arabis hirsuta GN=rpl14 PE=3 SV=1 | 25 | 133 | 2.0E-13 |
| sp|Q5WZK2|RL14_LEGPL | 50S ribosomal protein L14 OS=Legionella pneumophila (strain Lens) GN=rplN PE=3 SV=1 | 19 | 139 | 2.0E-13 |
| sp|Q5ZYN3|RL14_LEGPH | 50S ribosomal protein L14 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rplN PE=3 SV=1 | 19 | 139 | 2.0E-13 |
| sp|Q5X849|RL14_LEGPA | 50S ribosomal protein L14 OS=Legionella pneumophila (strain Paris) GN=rplN PE=3 SV=1 | 19 | 139 | 2.0E-13 |
| sp|A1T4R6|RL14_MYCVP | 50S ribosomal protein L14 OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-13 |
| sp|Q1ISB2|RL14_KORVE | 50S ribosomal protein L14 OS=Koribacter versatilis (strain Ellin345) GN=rplN PE=3 SV=1 | 17 | 126 | 2.0E-13 |
| sp|A1B037|RL14_PARDP | 50S ribosomal protein L14 OS=Paracoccus denitrificans (strain Pd 1222) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-13 |
| sp|Q06SH0|RK14_STIHE | 50S ribosomal protein L14, chloroplastic OS=Stigeoclonium helveticum GN=rpl14 PE=3 SV=1 | 25 | 123 | 2.0E-13 |
| sp|C5C0I1|RL14_BEUC1 | 50S ribosomal protein L14 OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-13 |
| sp|Q3A6N7|RL14_PELCD | 50S ribosomal protein L14 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rplN PE=3 SV=1 | 19 | 133 | 2.0E-13 |
| sp|A8W3F7|RK14_CUSEX | 50S ribosomal protein L14, plastid OS=Cuscuta exaltata GN=rpl14 PE=3 SV=1 | 25 | 123 | 2.0E-13 |
| sp|A0LRN0|RL14_ACIC1 | 50S ribosomal protein L14 OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-13 |
| sp|Q0BUP0|RL14_GRABC | 50S ribosomal protein L14 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-13 |
| sp|B8ELF3|RL14_METSB | 50S ribosomal protein L14 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-13 |
| sp|Q6AD05|RL14_LEIXX | 50S ribosomal protein L14 OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-13 |
| sp|A0T0Y3|RK14_THAPS | 50S ribosomal protein L14, chloroplastic OS=Thalassiosira pseudonana GN=rpl14 PE=3 SV=1 | 23 | 123 | 3.0E-13 |
| sp|C6E4P7|RL14_GEOSM | 50S ribosomal protein L14 OS=Geobacter sp. (strain M21) GN=rplN PE=3 SV=1 | 19 | 123 | 3.0E-13 |
| sp|B5EFR0|RL14_GEOBB | 50S ribosomal protein L14 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rplN PE=3 SV=1 | 19 | 123 | 3.0E-13 |
| sp|Q06FM8|RK14_PELHO | 50S ribosomal protein L14, chloroplastic OS=Pelargonium hortorum GN=rpl14 PE=3 SV=1 | 23 | 133 | 3.0E-13 |
| sp|B8IYI2|RL14_DESDA | 50S ribosomal protein L14 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rplN PE=3 SV=1 | 19 | 123 | 3.0E-13 |
| sp|B3QR72|RL14_CHLP8 | 50S ribosomal protein L14 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rplN PE=3 SV=1 | 28 | 123 | 3.0E-13 |
| sp|Q30Z52|RL14_DESAG | 50S ribosomal protein L14 OS=Desulfovibrio alaskensis (strain G20) GN=rplN PE=3 SV=1 | 19 | 123 | 3.0E-13 |
| sp|C0ZW35|RL14_RHOE4 | 50S ribosomal protein L14 OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=rplN PE=3 SV=1 | 25 | 126 | 3.0E-13 |
| sp|Q2YAY7|RL14_NITMU | 50S ribosomal protein L14 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rplN PE=3 SV=1 | 19 | 123 | 3.0E-13 |
| sp|Q2JFG6|RL14_FRASC | 50S ribosomal protein L14 OS=Frankia sp. (strain CcI3) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-13 |
| sp|Q0RRR1|RL14_FRAAA | 50S ribosomal protein L14 OS=Frankia alni (strain ACN14a) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-13 |
| sp|C1A6R5|RL14_GEMAT | 50S ribosomal protein L14 OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=rplN PE=3 SV=1 | 23 | 126 | 3.0E-13 |
| sp|B2IK72|RL14_BEII9 | 50S ribosomal protein L14 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-13 |
| sp|Q74L79|RL14_LACJO | 50S ribosomal protein L14 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rplN PE=3 SV=1 | 25 | 126 | 3.0E-13 |
| sp|Q046B5|RL14_LACGA | 50S ribosomal protein L14 OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rplN PE=3 SV=1 | 25 | 126 | 3.0E-13 |
| sp|B4S5B8|RL14_PROA2 | 50S ribosomal protein L14 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rplN PE=3 SV=1 | 28 | 123 | 4.0E-13 |
| sp|O32993|RL14_MYCLE | 50S ribosomal protein L14 OS=Mycobacterium leprae (strain TN) GN=rplN PE=3 SV=1 | 25 | 126 | 4.0E-13 |
| sp|B9KLA1|RL14_RHOSK | 50S ribosomal protein L14 OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|A4WVJ8|RL14_RHOS5 | 50S ribosomal protein L14 OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|Q3J5R2|RL14_RHOS4 | 50S ribosomal protein L14 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|A3PGM1|RL14_RHOS1 | 50S ribosomal protein L14 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|A0JZ74|RL14_ARTS2 | 50S ribosomal protein L14 OS=Arthrobacter sp. (strain FB24) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|B8HCZ6|RL14_ARTCA | 50S ribosomal protein L14 OS=Arthrobacter chlorophenolicus (strain ATCC 700700 / DSM 12829 / JCM 12360 / NCIMB 13794 / A6) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|A1R8T5|RL14_ARTAT | 50S ribosomal protein L14 OS=Arthrobacter aurescens (strain TC1) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|B2Y1Z6|RK14_WELMI | 50S ribosomal protein L14, chloroplastic OS=Welwitschia mirabilis GN=rpl14 PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|Q3ZJ83|RK14_PSEAK | 50S ribosomal protein L14, chloroplastic OS=Pseudendoclonium akinetum GN=rpl14 PE=3 SV=1 | 23 | 123 | 4.0E-13 |
| sp|Q3A9S6|RL14_CARHZ | 50S ribosomal protein L14 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rplN PE=3 SV=1 | 19 | 126 | 4.0E-13 |
| sp|Q9L0D0|RL14_STRCO | 50S ribosomal protein L14 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rplN PE=3 SV=1 | 25 | 126 | 4.0E-13 |
| sp|Q06R95|RK14_JASNU | 50S ribosomal protein L14, chloroplastic OS=Jasminum nudiflorum GN=rpl14 PE=3 SV=1 | 25 | 127 | 4.0E-13 |
| sp|O67570|RL14_AQUAE | 50S ribosomal protein L14 OS=Aquifex aeolicus (strain VF5) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|A4TEC7|RL14_MYCGI | 50S ribosomal protein L14 OS=Mycobacterium gilvum (strain PYR-GCK) GN=rplN PE=3 SV=1 | 25 | 126 | 4.0E-13 |
| sp|A5FZV5|RL14_ACICJ | 50S ribosomal protein L14 OS=Acidiphilium cryptum (strain JF-5) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|A8Z677|RL14_SULMW | 50S ribosomal protein L14 OS=Sulcia muelleri (strain GWSS) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|B2GDV9|RL14_LACF3 | 50S ribosomal protein L14 OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-13 |
| sp|Q82DN5|RL14_STRAW | 50S ribosomal protein L14 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rplN PE=3 SV=1 | 25 | 126 | 5.0E-13 |
| sp|Q7MTM3|RL14_PORGI | 50S ribosomal protein L14 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rplN PE=3 SV=1 | 28 | 123 | 5.0E-13 |
| sp|B2RLY2|RL14_PORG3 | 50S ribosomal protein L14 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rplN PE=3 SV=1 | 28 | 123 | 5.0E-13 |
| sp|B0YPR2|RK14_ANEMR | 50S ribosomal protein L14, plastid OS=Aneura mirabilis GN=rpl14 PE=3 SV=1 | 26 | 123 | 5.0E-13 |
| sp|C5CC52|RL14_MICLC | 50S ribosomal protein L14 OS=Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230) GN=rplN PE=3 SV=1 | 25 | 123 | 5.0E-13 |
| sp|Q38US2|RL14_LACSS | 50S ribosomal protein L14 OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rplN PE=3 SV=1 | 25 | 123 | 5.0E-13 |
| sp|Q1MPQ4|RL14_LAWIP | 50S ribosomal protein L14 OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rplN PE=3 SV=1 | 19 | 123 | 5.0E-13 |
| sp|Q5SD17|RK14_HUPLU | 50S ribosomal protein L14, chloroplastic OS=Huperzia lucidula GN=rpl14 PE=3 SV=1 | 25 | 133 | 5.0E-13 |
| sp|A9WSU7|RL14_RENSM | 50S ribosomal protein L14 OS=Renibacterium salmoninarum (strain ATCC 33209 / DSM 20767 / JCM 11484 / NBRC 15589 / NCIMB 2235) GN=rplN PE=3 SV=1 | 25 | 123 | 5.0E-13 |
| sp|P49552|RK14_ODOSI | 50S ribosomal protein L14, chloroplastic OS=Odontella sinensis GN=rpl14 PE=3 SV=1 | 23 | 126 | 6.0E-13 |
| sp|A6KYI5|RL14_BACV8 | 50S ribosomal protein L14 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rplN PE=3 SV=1 | 19 | 123 | 6.0E-13 |
| sp|A5GVX0|RL14_SYNR3 | 50S ribosomal protein L14 OS=Synechococcus sp. (strain RCC307) GN=rplN PE=3 SV=1 | 25 | 126 | 6.0E-13 |
| sp|B3EP51|RL14_CHLPB | 50S ribosomal protein L14 OS=Chlorobium phaeobacteroides (strain BS1) GN=rplN PE=3 SV=1 | 28 | 123 | 6.0E-13 |
| sp|B1LBN0|RL14_THESQ | 50S ribosomal protein L14 OS=Thermotoga sp. (strain RQ2) GN=rplN PE=3 SV=1 | 25 | 126 | 6.0E-13 |
| sp|A5IM93|RL14_THEP1 | 50S ribosomal protein L14 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rplN PE=3 SV=1 | 25 | 126 | 6.0E-13 |
| sp|A5D5G5|RL14_PELTS | 50S ribosomal protein L14 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rplN PE=3 SV=1 | 19 | 123 | 7.0E-13 |
| sp|B2G8W8|RL14_LACRJ | 50S ribosomal protein L14 OS=Lactobacillus reuteri (strain JCM 1112) GN=rplN PE=3 SV=1 | 25 | 123 | 7.0E-13 |
| sp|A5VLJ5|RL14_LACRD | 50S ribosomal protein L14 OS=Lactobacillus reuteri (strain DSM 20016) GN=rplN PE=3 SV=1 | 25 | 123 | 7.0E-13 |
| sp|A4J121|RL14_DESRM | 50S ribosomal protein L14 OS=Desulfotomaculum reducens (strain MI-1) GN=rplN PE=3 SV=1 | 19 | 126 | 7.0E-13 |
| sp|A8LC46|RL14_FRASN | 50S ribosomal protein L14 OS=Frankia sp. (strain EAN1pec) GN=rplN PE=3 SV=1 | 25 | 123 | 8.0E-13 |
| sp|B1Z783|RL14_METPB | 50S ribosomal protein L14 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rplN PE=3 SV=2 | 25 | 123 | 8.0E-13 |
| sp|A9W4T0|RL14_METEP | 50S ribosomal protein L14 OS=Methylobacterium extorquens (strain PA1) GN=rplN PE=3 SV=1 | 25 | 123 | 8.0E-13 |
| sp|P38508|RL14_THEMA | 50S ribosomal protein L14 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rplN PE=3 SV=2 | 25 | 126 | 9.0E-13 |
| sp|Q11QC2|RL14_CYTH3 | 50S ribosomal protein L14 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rplN PE=3 SV=1 | 25 | 123 | 9.0E-13 |
| sp|B9K896|RL14_THENN | 50S ribosomal protein L14 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rplN PE=3 SV=1 | 25 | 126 | 9.0E-13 |
| sp|Q85FI6|RK14_ADICA | 50S ribosomal protein L14, chloroplastic OS=Adiantum capillus-veneris GN=rpl14 PE=2 SV=2 | 19 | 133 | 1.0E-12 |
| sp|A5IHQ4|RL14_LEGPC | 50S ribosomal protein L14 OS=Legionella pneumophila (strain Corby) GN=rplN PE=3 SV=1 | 19 | 139 | 1.0E-12 |
| sp|A4JAQ0|RL14_BURVG | 50S ribosomal protein L14 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rplN PE=3 SV=1 | 25 | 133 | 1.0E-12 |
| sp|Q0BJ36|RL14_BURCM | 50S ribosomal protein L14 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rplN PE=3 SV=1 | 25 | 133 | 1.0E-12 |
| sp|B1YRN9|RL14_BURA4 | 50S ribosomal protein L14 OS=Burkholderia ambifaria (strain MC40-6) GN=rplN PE=3 SV=1 | 25 | 133 | 1.0E-12 |
| sp|B1LWR6|RL14_METRJ | 50S ribosomal protein L14 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-12 |
| sp|B2A4E9|RL14_NATTJ | 50S ribosomal protein L14 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rplN PE=3 SV=1 | 23 | 126 | 1.0E-12 |
| sp|A8ESV3|RL14_ARCB4 | 50S ribosomal protein L14 OS=Arcobacter butzleri (strain RM4018) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-12 |
| sp|A0T0I9|RK14_PHATC | 50S ribosomal protein L14, chloroplastic OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=rpl14 PE=3 SV=1 | 23 | 123 | 1.0E-12 |
| sp|C0QQN3|RL14_PERMH | 50S ribosomal protein L14 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rplN PE=3 SV=1 | 22 | 133 | 1.0E-12 |
| sp|B4R8M7|RL14_PHEZH | 50S ribosomal protein L14 OS=Phenylobacterium zucineum (strain HLK1) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-12 |
| sp|A5EX89|RL14_DICNV | 50S ribosomal protein L14 OS=Dichelobacter nodosus (strain VCS1703A) GN=rplN PE=3 SV=1 | 25 | 133 | 1.0E-12 |
| sp|B2GJ03|RL14_KOCRD | 50S ribosomal protein L14 OS=Kocuria rhizophila (strain ATCC 9341 / DSM 348 / NBRC 103217 / DC2201) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-12 |
| sp|B8G6R5|RL14_CHLAD | 50S ribosomal protein L14 OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rplN PE=3 SV=1 | 25 | 133 | 1.0E-12 |
| sp|Q9MUU4|RK14_MESVI | 50S ribosomal protein L14, chloroplastic OS=Mesostigma viride GN=rpl14 PE=3 SV=1 | 25 | 123 | 1.0E-12 |
| sp|Q6NJC2|RL14_CORDI | 50S ribosomal protein L14 OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-12 |
| sp|Q7M8E3|RL14_WOLSU | 50S ribosomal protein L14 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-12 |
| sp|B9L6M3|RL14_NAUPA | 50S ribosomal protein L14 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rplN PE=3 SV=1 | 25 | 133 | 1.0E-12 |
| sp|B1MW04|RL14_LEUCK | 50S ribosomal protein L14 OS=Leuconostoc citreum (strain KM20) GN=rplN PE=3 SV=1 | 25 | 133 | 1.0E-12 |
| sp|B3EGY0|RL14_CHLL2 | 50S ribosomal protein L14 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rplN PE=3 SV=1 | 28 | 123 | 1.0E-12 |
| sp|B1X4Z8|RK14_PAUCH | 50S ribosomal protein L14, organellar chromatophore OS=Paulinella chromatophora GN=rpl14 PE=3 SV=1 | 25 | 126 | 1.0E-12 |
| sp|A7HZL6|RL14_CAMHC | 50S ribosomal protein L14 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rplN PE=3 SV=1 | 28 | 123 | 1.0E-12 |
| sp|Q21M48|RL14_SACD2 | 50S ribosomal protein L14 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rplN PE=3 SV=1 | 19 | 123 | 2.0E-12 |
| sp|B1GZ93|RL14_UNCTG | 50S ribosomal protein L14 OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rplN PE=3 SV=1 | 23 | 126 | 2.0E-12 |
| sp|Q2JV91|RL14_SYNJA | 50S ribosomal protein L14 OS=Synechococcus sp. (strain JA-3-3Ab) GN=rplN PE=3 SV=1 | 23 | 126 | 2.0E-12 |
| sp|Q03ZN5|RL14_LEUMM | 50S ribosomal protein L14 OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rplN PE=3 SV=1 | 25 | 133 | 2.0E-12 |
| sp|B7GJ77|RL14_ANOFW | 50S ribosomal protein L14 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-12 |
| sp|B0TC66|RL14_HELMI | 50S ribosomal protein L14 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-12 |
| sp|A1KRI3|RL14_NEIMF | 50S ribosomal protein L14 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rplN PE=3 SV=1 | 19 | 133 | 2.0E-12 |
| sp|Q7DDT2|RL14_NEIMB | 50S ribosomal protein L14 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rplN PE=1 SV=1 | 19 | 133 | 2.0E-12 |
| sp|Q9JQY4|RL14_NEIMA | 50S ribosomal protein L14 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rplN PE=3 SV=1 | 19 | 133 | 2.0E-12 |
| sp|A9M3V6|RL14_NEIM0 | 50S ribosomal protein L14 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rplN PE=3 SV=1 | 19 | 133 | 2.0E-12 |
| sp|Q3SLN9|RL14_THIDA | 50S ribosomal protein L14 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rplN PE=3 SV=1 | 23 | 133 | 2.0E-12 |
| sp|A5USH9|RL14_ROSS1 | 50S ribosomal protein L14 OS=Roseiflexus sp. (strain RS-1) GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-12 |
| sp|C4LL26|RL14_CORK4 | 50S ribosomal protein L14 OS=Corynebacterium kroppenstedtii (strain DSM 44385 / CCUG 35717) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-12 |
| sp|Q82X79|RL14_NITEU | 50S ribosomal protein L14 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rplN PE=3 SV=1 | 19 | 123 | 2.0E-12 |
| sp|Q2N9C1|RL14_ERYLH | 50S ribosomal protein L14 OS=Erythrobacter litoralis (strain HTCC2594) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-12 |
| sp|Q0AII6|RL14_NITEC | 50S ribosomal protein L14 OS=Nitrosomonas eutropha (strain C91) GN=rplN PE=3 SV=1 | 19 | 123 | 2.0E-12 |
| sp|A4XBN6|RL14_SALTO | 50S ribosomal protein L14 OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-12 |
| sp|A8M519|RL14_SALAI | 50S ribosomal protein L14 OS=Salinispora arenicola (strain CNS-205) GN=rplN PE=3 SV=1 | 25 | 123 | 2.0E-12 |
| sp|Q5SHP8|RL14_THET8 | 50S ribosomal protein L14 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rplN PE=1 SV=1 | 25 | 126 | 2.0E-12 |
| sp|Q5P322|RL14_AROAE | 50S ribosomal protein L14 OS=Aromatoleum aromaticum (strain EbN1) GN=rplN PE=3 SV=1 | 25 | 133 | 2.0E-12 |
| sp|B5Y978|RL14_COPPD | 50S ribosomal protein L14 OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-12 |
| sp|C4KZN6|RL14_EXISA | 50S ribosomal protein L14 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-12 |
| sp|A1KB17|RL14_AZOSB | 50S ribosomal protein L14 OS=Azoarcus sp. (strain BH72) GN=rplN PE=3 SV=1 | 25 | 133 | 2.0E-12 |
| sp|Q4A5D1|RL14_MYCS5 | 50S ribosomal protein L14 OS=Mycoplasma synoviae (strain 53) GN=rplN PE=3 SV=1 | 26 | 133 | 2.0E-12 |
| sp|P60558|RL14_THETH | 50S ribosomal protein L14 OS=Thermus thermophilus GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-12 |
| sp|Q72I14|RL14_THET2 | 50S ribosomal protein L14 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rplN PE=1 SV=1 | 25 | 126 | 2.0E-12 |
| sp|P60557|RL14_THEAQ | 50S ribosomal protein L14 OS=Thermus aquaticus GN=rplN PE=3 SV=1 | 25 | 126 | 2.0E-12 |
| sp|Q03IG1|RL14_STRTD | 50S ribosomal protein L14 OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rplN PE=3 SV=1 | 25 | 126 | 3.0E-12 |
| sp|Q5M2C3|RL14_STRT2 | 50S ribosomal protein L14 OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rplN PE=3 SV=1 | 25 | 126 | 3.0E-12 |
| sp|Q5LXS1|RL14_STRT1 | 50S ribosomal protein L14 OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rplN PE=3 SV=1 | 25 | 126 | 3.0E-12 |
| sp|B4RQY7|RL14_NEIG2 | 50S ribosomal protein L14 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rplN PE=3 SV=2 | 19 | 133 | 3.0E-12 |
| sp|Q5F5T7|RL14_NEIG1 | 50S ribosomal protein L14 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rplN PE=3 SV=1 | 19 | 133 | 3.0E-12 |
| sp|Q0ID15|RL14_SYNS3 | 50S ribosomal protein L14 OS=Synechococcus sp. (strain CC9311) GN=rplN PE=3 SV=1 | 25 | 126 | 3.0E-12 |
| sp|A4G9S8|RL14_HERAR | 50S ribosomal protein L14 OS=Herminiimonas arsenicoxydans GN=rplN PE=3 SV=1 | 25 | 133 | 3.0E-12 |
| sp|Q8KAI2|RL14_CHLTE | 50S ribosomal protein L14 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rplN PE=3 SV=1 | 28 | 123 | 3.0E-12 |
| sp|A1T0D2|RL14_PSYIN | 50S ribosomal protein L14 OS=Psychromonas ingrahamii (strain 37) GN=rplN PE=3 SV=1 | 19 | 123 | 3.0E-12 |
| sp|Q39KF7|RL14_BURL3 | 50S ribosomal protein L14 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rplN PE=3 SV=1 | 25 | 133 | 3.0E-12 |
| sp|B4E5D0|RL14_BURCJ | 50S ribosomal protein L14 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rplN PE=3 SV=1 | 25 | 133 | 3.0E-12 |
| sp|A0K3N5|RL14_BURCH | 50S ribosomal protein L14 OS=Burkholderia cenocepacia (strain HI2424) GN=rplN PE=3 SV=1 | 25 | 133 | 3.0E-12 |
| sp|B1JU32|RL14_BURCC | 50S ribosomal protein L14 OS=Burkholderia cenocepacia (strain MC0-3) GN=rplN PE=3 SV=1 | 25 | 133 | 3.0E-12 |
| sp|Q1BRV8|RL14_BURCA | 50S ribosomal protein L14 OS=Burkholderia cenocepacia (strain AU 1054) GN=rplN PE=3 SV=2 | 25 | 133 | 3.0E-12 |
| sp|Q03EC6|RL14_PEDPA | 50S ribosomal protein L14 OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-12 |
| sp|A4SCR9|RL14_CHLPM | 50S ribosomal protein L14 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rplN PE=3 SV=1 | 28 | 123 | 3.0E-12 |
| sp|A2BTC7|RL14_PROMS | 50S ribosomal protein L14 OS=Prochlorococcus marinus (strain AS9601) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-12 |
| sp|Q318J4|RL14_PROM9 | 50S ribosomal protein L14 OS=Prochlorococcus marinus (strain MIT 9312) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-12 |
| sp|A8G751|RL14_PROM2 | 50S ribosomal protein L14 OS=Prochlorococcus marinus (strain MIT 9215) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-12 |
| sp|A3PF37|RL14_PROM0 | 50S ribosomal protein L14 OS=Prochlorococcus marinus (strain MIT 9301) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-12 |
| sp|B8FES5|RL14_DESAA | 50S ribosomal protein L14 OS=Desulfatibacillum alkenivorans (strain AK-01) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-12 |
| sp|B9JVP7|RL14_AGRVS | 50S ribosomal protein L14 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-12 |
| sp|Q1H4M7|RL14_METFK | 50S ribosomal protein L14 OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rplN PE=3 SV=1 | 25 | 133 | 3.0E-12 |
| sp|Q02W34|RL14_LACLS | 50S ribosomal protein L14 OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rplN PE=3 SV=1 | 25 | 126 | 3.0E-12 |
| sp|A2RNP5|RL14_LACLM | 50S ribosomal protein L14 OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rplN PE=3 SV=1 | 25 | 126 | 3.0E-12 |
| sp|Q9CDX2|RL14_LACLA | 50S ribosomal protein L14 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rplN PE=3 SV=1 | 25 | 126 | 3.0E-12 |
| sp|Q13TI0|RL14_BURXL | 50S ribosomal protein L14 OS=Burkholderia xenovorans (strain LB400) GN=rplN PE=3 SV=1 | 25 | 133 | 3.0E-12 |
| sp|B2T741|RL14_BURPP | 50S ribosomal protein L14 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rplN PE=3 SV=1 | 25 | 133 | 3.0E-12 |
| sp|Q2RFQ7|RL14_MOOTA | 50S ribosomal protein L14 OS=Moorella thermoacetica (strain ATCC 39073) GN=rplN PE=3 SV=1 | 23 | 126 | 3.0E-12 |
| sp|Q28UU4|RL14_JANSC | 50S ribosomal protein L14 OS=Jannaschia sp. (strain CCS1) GN=rplN PE=3 SV=1 | 25 | 123 | 3.0E-12 |
| sp|B9LJE2|RL14_CHLSY | 50S ribosomal protein L14 OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rplN PE=3 SV=1 | 25 | 133 | 3.0E-12 |
| sp|A9WH76|RL14_CHLAA | 50S ribosomal protein L14 OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rplN PE=3 SV=1 | 25 | 133 | 3.0E-12 |
| sp|Q2JIL7|RL14_SYNJB | 50S ribosomal protein L14 OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=rplN PE=3 SV=1 | 23 | 126 | 4.0E-12 |
| sp|Q1GK19|RL14_RUEST | 50S ribosomal protein L14 OS=Ruegeria sp. (strain TM1040) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-12 |
| sp|Q5LW48|RL14_RUEPO | 50S ribosomal protein L14 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-12 |
| sp|Q06J57|RK14_BIGNA | 50S ribosomal protein L14, chloroplastic OS=Bigelowiella natans GN=rpl14 PE=3 SV=1 | 28 | 123 | 4.0E-12 |
| sp|Q47LK3|RL14_THEFY | 50S ribosomal protein L14 OS=Thermobifida fusca (strain YX) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-12 |
| sp|Q16AD4|RL14_ROSDO | 50S ribosomal protein L14 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-12 |
| sp|A8LM67|RL14_DINSH | 50S ribosomal protein L14 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-12 |
| sp|B0UHV9|RL14_METS4 | 50S ribosomal protein L14 OS=Methylobacterium sp. (strain 4-46) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-12 |
| sp|Q839F4|RL14_ENTFA | 50S ribosomal protein L14 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rplN PE=3 SV=1 | 25 | 126 | 4.0E-12 |
| sp|A7HWS1|RL14_PARL1 | 50S ribosomal protein L14 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-12 |
| sp|A6MW11|RK14_RHDSA | 50S ribosomal protein L14, chloroplastic OS=Rhodomonas salina GN=rpl14 PE=3 SV=1 | 25 | 123 | 4.0E-12 |
| sp|A9BH95|RL14_PETMO | 50S ribosomal protein L14 OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rplN PE=3 SV=1 | 25 | 133 | 4.0E-12 |
| sp|Q9ZI42|RL14_AQUPY | 50S ribosomal protein L14 OS=Aquifex pyrophilus GN=rplN PE=3 SV=1 | 25 | 123 | 4.0E-12 |
| sp|Q605C2|RL14_METCA | 50S ribosomal protein L14 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rplN PE=3 SV=1 | 19 | 133 | 5.0E-12 |
| sp|Q6F1Y4|RL14_MESFL | 50S ribosomal protein L14 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rplN PE=3 SV=1 | 25 | 133 | 5.0E-12 |
| sp|P58139|RK14_EUGLO | 50S ribosomal protein L14, plastid OS=Euglena longa GN=rpl14 PE=3 SV=1 | 19 | 127 | 5.0E-12 |
| sp|A6UZJ8|RL14_PSEA7 | 50S ribosomal protein L14 OS=Pseudomonas aeruginosa (strain PA7) GN=rplN PE=3 SV=1 | 19 | 133 | 5.0E-12 |
| sp|B3PMN7|RL14_MYCA5 | 50S ribosomal protein L14 OS=Mycoplasma arthritidis (strain 158L3-1) GN=rplN PE=3 SV=1 | 26 | 123 | 5.0E-12 |
| sp|Q47J93|RL14_DECAR | 50S ribosomal protein L14 OS=Dechloromonas aromatica (strain RCB) GN=rplN PE=3 SV=1 | 19 | 133 | 5.0E-12 |
| sp|Q6MJ24|RL14_BDEBA | 50S ribosomal protein L14 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rplN PE=3 SV=1 | 25 | 123 | 5.0E-12 |
| sp|A6H5L8|RK14_CYCTA | 50S ribosomal protein L14, chloroplastic OS=Cycas taitungensis GN=rpl14 PE=3 SV=1 | 26 | 133 | 5.0E-12 |
| sp|B9KEF0|RL14_CAMLR | 50S ribosomal protein L14 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rplN PE=3 SV=1 | 25 | 123 | 6.0E-12 |
| sp|A7HBM8|RL14_ANADF | 50S ribosomal protein L14 OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rplN PE=3 SV=1 | 23 | 123 | 6.0E-12 |
| sp|Q3API3|RL14_CHLCH | 50S ribosomal protein L14 OS=Chlorobium chlorochromatii (strain CaD3) GN=rplN PE=3 SV=1 | 28 | 123 | 6.0E-12 |
| sp|Q7U4J0|RL14_SYNPX | 50S ribosomal protein L14 OS=Synechococcus sp. (strain WH8102) GN=rplN PE=3 SV=1 | 25 | 126 | 6.0E-12 |
| sp|A2SLE6|RL14_METPP | 50S ribosomal protein L14 OS=Methylibium petroleiphilum (strain PM1) GN=rplN PE=3 SV=1 | 25 | 133 | 6.0E-12 |
| sp|Q8EUC3|RL14_MYCPE | 50S ribosomal protein L14 OS=Mycoplasma penetrans (strain HF-2) GN=rplN PE=3 SV=1 | 25 | 123 | 7.0E-12 |
| sp|Q8UE28|RL14_AGRFC | 50S ribosomal protein L14 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rplN PE=3 SV=1 | 25 | 123 | 7.0E-12 |
| sp|A6T3J4|RL14_JANMA | 50S ribosomal protein L14 OS=Janthinobacterium sp. (strain Marseille) GN=rplN PE=3 SV=1 | 25 | 133 | 7.0E-12 |
| sp|Q5NQ55|RL14_ZYMMO | 50S ribosomal protein L14 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=rplN PE=3 SV=2 | 25 | 123 | 7.0E-12 |
| sp|P52816|RL23_ONCVO | 60S ribosomal protein L23 (Fragment) OS=Onchocerca volvulus GN=RPL23 PE=2 SV=1 | 1 | 47 | 7.0E-12 |
| sp|B1JDX4|RL14_PSEPW | 50S ribosomal protein L14 OS=Pseudomonas putida (strain W619) GN=rplN PE=3 SV=1 | 19 | 133 | 7.0E-12 |
| sp|Q1IFV6|RL14_PSEE4 | 50S ribosomal protein L14 OS=Pseudomonas entomophila (strain L48) GN=rplN PE=3 SV=1 | 19 | 133 | 7.0E-12 |
| sp|B1HMX0|RL14_LYSSC | 50S ribosomal protein L14 OS=Lysinibacillus sphaericus (strain C3-41) GN=rplN PE=3 SV=1 | 25 | 123 | 7.0E-12 |
| sp|Q9HWE5|RL14_PSEAE | 50S ribosomal protein L14 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rplN PE=3 SV=1 | 19 | 133 | 7.0E-12 |
| sp|Q02T70|RL14_PSEAB | 50S ribosomal protein L14 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rplN PE=3 SV=1 | 19 | 133 | 7.0E-12 |
| sp|B7V654|RL14_PSEA8 | 50S ribosomal protein L14 OS=Pseudomonas aeruginosa (strain LESB58) GN=rplN PE=3 SV=1 | 19 | 133 | 7.0E-12 |
| sp|Q3B6F2|RL14_CHLL7 | 50S ribosomal protein L14 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rplN PE=3 SV=1 | 28 | 123 | 8.0E-12 |
| sp|B3R7R3|RL14_CUPTR | 50S ribosomal protein L14 OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=rplN PE=3 SV=1 | 25 | 133 | 8.0E-12 |
| sp|Q0K629|RL14_CUPNH | 50S ribosomal protein L14 OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rplN PE=3 SV=1 | 25 | 133 | 8.0E-12 |
| sp|Q7TU29|RL14_PROMP | 50S ribosomal protein L14 OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=rplN PE=3 SV=1 | 25 | 123 | 8.0E-12 |
| sp|A2BYS6|RL14_PROM5 | 50S ribosomal protein L14 OS=Prochlorococcus marinus (strain MIT 9515) GN=rplN PE=3 SV=1 | 25 | 123 | 8.0E-12 |
| sp|B0U0X9|RL14_FRAP2 | 50S ribosomal protein L14 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rplN PE=3 SV=1 | 25 | 133 | 8.0E-12 |
| sp|Q6AP61|RL14_DESPS | 50S ribosomal protein L14 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rplN PE=3 SV=1 | 23 | 123 | 8.0E-12 |
| sp|B0SSG7|RL14_LEPBP | 50S ribosomal protein L14 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rplN PE=3 SV=1 | 23 | 123 | 9.0E-12 |
| sp|B0SA37|RL14_LEPBA | 50S ribosomal protein L14 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rplN PE=3 SV=1 | 23 | 123 | 9.0E-12 |
| sp|Q2NIW4|RL14_AYWBP | 50S ribosomal protein L14 OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rplN PE=3 SV=1 | 27 | 139 | 9.0E-12 |
| sp|A5N4Q7|RL14_CLOK5 | 50S ribosomal protein L14 OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rplN PE=3 SV=1 | 23 | 123 | 9.0E-12 |
| sp|B2FQJ4|RL14_STRMK | 50S ribosomal protein L14 OS=Stenotrophomonas maltophilia (strain K279a) GN=rplN PE=3 SV=1 | 19 | 133 | 9.0E-12 |
| sp|B4SKX3|RL14_STRM5 | 50S ribosomal protein L14 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rplN PE=3 SV=1 | 19 | 133 | 9.0E-12 |
| sp|A9IW13|RL14_BART1 | 50S ribosomal protein L14 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rplN PE=3 SV=1 | 25 | 123 | 9.0E-12 |
| sp|Q6FZD2|RL14_BARQU | 50S ribosomal protein L14 OS=Bartonella quintana (strain Toulouse) GN=rplN PE=3 SV=1 | 25 | 123 | 9.0E-12 |
| sp|Q88XX6|RL14_LACPL | 50S ribosomal protein L14 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rplN PE=3 SV=1 | 25 | 123 | 9.0E-12 |
| sp|Q5HSA0|RL14_CAMJR | 50S ribosomal protein L14 OS=Campylobacter jejuni (strain RM1221) GN=rplN PE=3 SV=1 | 25 | 123 | 9.0E-12 |
| sp|A1W1V0|RL14_CAMJJ | 50S ribosomal protein L14 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rplN PE=3 SV=1 | 25 | 123 | 9.0E-12 |
| sp|Q0P7T4|RL14_CAMJE | 50S ribosomal protein L14 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rplN PE=3 SV=1 | 25 | 123 | 9.0E-12 |
| sp|A7H646|RL14_CAMJD | 50S ribosomal protein L14 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rplN PE=3 SV=1 | 25 | 123 | 9.0E-12 |
| sp|A8FP11|RL14_CAMJ8 | 50S ribosomal protein L14 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rplN PE=3 SV=1 | 25 | 123 | 9.0E-12 |
| sp|Q3AMP0|RL14_SYNSC | 50S ribosomal protein L14 OS=Synechococcus sp. (strain CC9605) GN=rplN PE=3 SV=1 | 25 | 126 | 9.0E-12 |
| sp|A4XZ80|RL14_PSEMY | 50S ribosomal protein L14 OS=Pseudomonas mendocina (strain ymp) GN=rplN PE=3 SV=1 | 19 | 133 | 9.0E-12 |
| sp|Q3AW83|RL14_SYNS9 | 50S ribosomal protein L14 OS=Synechococcus sp. (strain CC9902) GN=rplN PE=3 SV=1 | 23 | 126 | 1.0E-11 |
| sp|A5GIT5|RL14_SYNPW | 50S ribosomal protein L14 OS=Synechococcus sp. (strain WH7803) GN=rplN PE=3 SV=1 | 23 | 126 | 1.0E-11 |
| sp|A6LEI1|RL14_PARD8 | 50S ribosomal protein L14 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rplN PE=3 SV=1 | 28 | 123 | 1.0E-11 |
| sp|C0QW06|RL14_BRAHW | 50S ribosomal protein L14 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rplN PE=3 SV=1 | 19 | 123 | 1.0E-11 |
| sp|A0ALV8|RL14_LISW6 | 50S ribosomal protein L14 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-11 |
| sp|Q927L7|RL14_LISMO | 50S ribosomal protein L14 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-11 |
| sp|B8DB18|RL14_LISMH | 50S ribosomal protein L14 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-11 |
| sp|Q71WF6|RL14_LISMF | 50S ribosomal protein L14 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-11 |
| sp|C1KZH0|RL14_LISMC | 50S ribosomal protein L14 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-11 |
| sp|Q7ANU6|RL14_LISIN | 50S ribosomal protein L14 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rplN PE=3 SV=1 | 25 | 126 | 1.0E-11 |
| sp|Q46WF4|RL14_CUPPJ | 50S ribosomal protein L14 OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rplN PE=3 SV=1 | 25 | 133 | 1.0E-11 |
| sp|Q1LI47|RL14_CUPMC | 50S ribosomal protein L14 OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rplN PE=3 SV=1 | 25 | 133 | 1.0E-11 |
| sp|C5D3S7|RL14_GEOSW | 50S ribosomal protein L14 OS=Geobacillus sp. (strain WCH70) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-11 |
| sp|P56039|RL14_HELPY | 50S ribosomal protein L14 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rplN PE=1 SV=1 | 25 | 123 | 1.0E-11 |
| sp|B2UV72|RL14_HELPS | 50S ribosomal protein L14 OS=Helicobacter pylori (strain Shi470) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-11 |
| sp|Q1CRV1|RL14_HELPH | 50S ribosomal protein L14 OS=Helicobacter pylori (strain HPAG1) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-11 |
| sp|B5Z8V7|RL14_HELPG | 50S ribosomal protein L14 OS=Helicobacter pylori (strain G27) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-11 |
| sp|Q17ZC8|RL14_HELAH | 50S ribosomal protein L14 OS=Helicobacter acinonychis (strain Sheeba) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-11 |
| sp|Q9A8U3|RL14_CAUCR | 50S ribosomal protein L14 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-11 |
| sp|B8H4E4|RL14_CAUCN | 50S ribosomal protein L14 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rplN PE=3 SV=1 | 25 | 123 | 1.0E-11 |
| sp|A0RM21|RL14_CAMFF | 50S ribosomal protein L14 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rplN PE=3 SV=1 | 28 | 123 | 1.0E-11 |
| sp|A8IAQ6|RL14_AZOC5 | 50S ribosomal protein L14 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rplN PE=3 SV=2 | 25 | 123 | 1.0E-11 |
| sp|Q4ZMQ4|RL14_PSEU2 | 50S ribosomal protein L14 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rplN PE=3 SV=1 | 19 | 133 | 1.0E-11 |
| sp|Q889W1|RL14_PSESM | 50S ribosomal protein L14 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rplN PE=3 SV=1 | 19 | 133 | 1.0E-11 |
| sp|Q88QM5|RL14_PSEPK | 50S ribosomal protein L14 OS=Pseudomonas putida (strain KT2440) GN=rplN PE=3 SV=1 | 19 | 133 | 1.0E-11 |
| sp|B0KK77|RL14_PSEPG | 50S ribosomal protein L14 OS=Pseudomonas putida (strain GB-1) GN=rplN PE=3 SV=1 | 19 | 133 | 1.0E-11 |
| sp|Q3K5Z8|RL14_PSEPF | 50S ribosomal protein L14 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rplN PE=3 SV=1 | 19 | 133 | 1.0E-11 |
| sp|A5VXQ7|RL14_PSEP1 | 50S ribosomal protein L14 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rplN PE=3 SV=1 | 19 | 133 | 1.0E-11 |
| sp|C3K2W6|RL14_PSEFS | 50S ribosomal protein L14 OS=Pseudomonas fluorescens (strain SBW25) GN=rplN PE=3 SV=1 | 19 | 133 | 1.0E-11 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0003735 | structural constituent of ribosome | Yes |
| GO:0006412 | translation | Yes |
| GO:0005840 | ribosome | Yes |
| GO:0043043 | peptide biosynthetic process | No |
| GO:0043226 | organelle | No |
| GO:0043229 | intracellular organelle | No |
| GO:0043170 | macromolecule metabolic process | No |
| GO:1901576 | organic substance biosynthetic process | No |
| GO:0044271 | cellular nitrogen compound biosynthetic process | No |
| GO:0044260 | cellular macromolecule metabolic process | No |
| GO:0019538 | protein metabolic process | No |
| GO:0006518 | peptide metabolic process | No |
| GO:0008152 | metabolic process | No |
| GO:0009058 | biosynthetic process | No |
| GO:0009987 | cellular process | No |
| GO:0005198 | structural molecule activity | No |
| GO:0044238 | primary metabolic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0043232 | intracellular non-membrane-bounded organelle | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0110165 | cellular anatomical entity | No |
| GO:0043228 | non-membrane-bounded organelle | No |
| GO:0005575 | cellular_component | No |
| GO:0044249 | cellular biosynthetic process | No |
| GO:0003674 | molecular_function | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:1901566 | organonitrogen compound biosynthetic process | No |
| GO:0008150 | biological_process | No |
| GO:0009059 | macromolecule biosynthetic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:0034645 | cellular macromolecule biosynthetic process | No |
| GO:0043604 | amide biosynthetic process | No |
| GO:0043603 | cellular amide metabolic process | No |
| Orthofinder run ID | 4 |
| Orthogroup | 3142 |
| Change Orthofinder run |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >Ophun1|4139 MAKISRGAPGGKLKMTLGLPVGAVMNCADNSGARNLYIIAVKGIGARLNRLPAGGVGDMVMATVKKGKPELRKKV HPAVIVRQSKPWKRFDGVFLYFEDNAGVIVNPKGEMKGSAITGPVGKEAAELWPRIASNSGVVM* |
| Coding | >Ophun1|4139 ATGGCCAAGATCTCGCGCGGTGCCCCCGGCGGCAAGCTCAAAATGACGCTGGGTCTCCCCGTAGGCGCCGTCATG AACTGCGCCGACAACTCAGGCGCCCGTAACCTCTACATCATCGCCGTCAAGGGCATCGGCGCCCGCCTGAACCGC CTGCCCGCCGGTGGCGTCGGCGACATGGTCATGGCCACGGTCAAGAAGGGAAAGCCCGAGCTGCGCAAAAAGGTC CACCCCGCCGTCATCGTCCGCCAGTCCAAGCCGTGGAAGCGCTTCGACGGTGTCTTTCTCTACTTTGAGGACAAC GCCGGCGTGATTGTCAACCCCAAGGGCGAGATGAAGGGCTCTGCCATTACCGGCCCCGTCGGCAAGGAGGCGGCC GAGCTGTGGCCGCGTATCGCCAGCAACTCCGGCGTCGTCATGTAA |
| Transcript | >Ophun1|4139 ATGGCCAAGATCTCGCGCGGTGCCCCCGGCGGCAAGCTCAAAATGACGCTGGGTCTCCCCGTAGGCGCCGTCATG AACTGCGCCGACAACTCAGGCGCCCGTAACCTCTACATCATCGCCGTCAAGGGCATCGGCGCCCGCCTGAACCGC CTGCCCGCCGGTGGCGTCGGCGACATGGTCATGGCCACGGTCAAGAAGGGAAAGCCCGAGCTGCGCAAAAAGGTC CACCCCGCCGTCATCGTCCGCCAGTCCAAGCCGTGGAAGCGCTTCGACGGTGTCTTTCTCTACTTTGAGGACAAC GCCGGCGTGATTGTCAACCCCAAGGGCGAGATGAAGGGCTCTGCCATTACCGGCCCCGTCGGCAAGGAGGCGGCC GAGCTGTGGCCGCGTATCGCCAGCAACTCCGGCGTCGTCATGTAA |
| Gene | >Ophun1|4139 ATGGCCAAGATCTCGTAAGTCGCTCCATCGCGCTCTCTCAATTCCATCCGTGAGGCTCGAAATGCGACGCGAATG CCCCGGCCTGGACTCGACAGAAGGACAATTTTCGAGCAGCGACCAGGCGCATGCCACTGAACTCGACGGAACCGA AGCAGCTCCAACATCTTTCCCGCACGCGACAACGACGAAAAAATCCTTCAACTCCAGTCGAGCCGCTCCACCGGA AACAACACGCCTTCATAAACCATCCAGACAACAACGAGCAATCTTGCTAATGACCTCCGTCTGTACAGGCGCGGT GCCCCCGGCGGCAAGCTCAAAATGACGCTGGGTCTCCCCGTGTAGGTCCAGCCCGAAGCCCGACATCTTCCCACG CACCACACTGACGCAACGCGACAGAGGCGCCGTCATGAACTGCGCCGACAACTCAGGCGCCCGTAACCTCTACAT CATCGCCGTCAAGGGCATCGGCGCCCGCCTGAACCGCCTGCCCGCCGGTGGCGTCGGCGACATGGTCATGGCCAC GGTCAAGAAGGGAAAGCCCGAGCTGCGCAAAAAGGTCCACCCCGCCGTCATCGTCCGCCAGTCCAAGCCGTGGAA GCGCTTCGACGGTGTCTTTCTCTACTTTGAGGACAACGCCGGCGTGGTACGTCGTCGCACCATGCTGCACCGCTA CTTGCGAGTTTCGGCTGACACGAATATCCCCAGATTGTCAACCCCAAGGGCGAGATGAAGGGCTCTGCCATTACC GGCCCCGTCGGCAAGGAGGCGGCCGAGCTGTGGCCGGTAAGTCGACACTCCAACGAAGACCACGGAAACCCCCAG AGCTAACACTCGCAACCCCAGCGTATCGCCAGCAACTCCGGCGTCGTCATGTAA |