Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4135
Gene name
LocationContig_38:10997..12047
Strand-
Gene length (bp)1050
Transcript length (bp)1050
Coding sequence length (bp)1050
Protein length (aa) 350

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999727

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6084
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|02570
Ophiocordyceps camponoti-rufipedis Ophun1|4135 (this protein)
Ophiocordyceps kimflemingae Ophio5|1003
Ophiocordyceps subramaniannii Hirsu2|2980
Ophiocordyceps subramaniannii Hirsu2|5589

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4135
MLRLPLLAWILSTAVNGQYAPPPYRQQDGSHPPSGLPTRIVQQLPPSTWIENMAVRSNGNLILTQLRPSAAVIQV
TDPSSPYSYYEVAGIFPSIDGLYGITEVSTDVFVVVGCRFATIGDNVKGSAETWMVNFKSTDRSGGPLVKRVGRH
PYMEFPNGMTSLPGVDDVVLIADSTLGLVWRLYLETGVTEVAIQLREMAYHQGTRLKIGINGIKIIDGYLWWSNS
YVGDLYRLRIDRLGNPERNARPEHMFRHEGRFIDDFVLDDRGLWGTTNQNNTVLFAAYGGRVSDVAGEQNGLDLA
VDTSCAFGRGERDGRILYVATGNNPKKGLGGKVVAVDTTSIRPRGNYFA*
Coding >Ophun1|4135
ATGTTACGACTCCCTCTTCTCGCCTGGATTCTATCAACAGCCGTCAACGGCCAATACGCGCCGCCCCCTTACCGC
CAACAAGACGGCAGCCACCCTCCTTCAGGCCTACCCACGCGGATCGTGCAGCAACTGCCGCCGTCAACATGGATA
GAGAACATGGCGGTTCGCAGCAACGGGAACCTCATCCTCACGCAACTGCGTCCCAGCGCGGCCGTCATACAGGTG
ACGGATCCGTCGAGCCCATACTCGTACTATGAAGTCGCCGGCATCTTCCCTTCCATCGACGGCTTATACGGTATC
ACCGAAGTGTCGACGGATGTCTTTGTCGTGGTGGGCTGTCGGTTCGCCACCATCGGTGATAACGTCAAGGGCTCG
GCTGAGACGTGGATGGTCAACTTCAAGAGCACGGATCGTAGCGGAGGTCCCTTGGTCAAGAGGGTGGGCAGACAT
CCGTACATGGAGTTCCCCAACGGCATGACGTCGCTTCCTGGCGTCGATGATGTCGTCCTCATCGCCGACTCAACC
CTCGGCCTGGTCTGGCGTCTATATCTGGAGACGGGCGTGACCGAAGTAGCAATCCAGCTGCGAGAAATGGCCTAC
CACCAAGGAACGAGGCTCAAGATCGGCATCAACGGCATCAAAATCATCGACGGCTACCTCTGGTGGTCCAACAGC
TACGTAGGCGACCTCTACCGCCTCCGAATCGACCGACTCGGCAACCCAGAGCGCAACGCCCGACCCGAACACATG
TTCCGCCACGAGGGCCGCTTCATCGACGACTTCGTCTTGGACGACCGCGGCCTATGGGGTACCACCAACCAGAAC
AACACGGTCCTGTTCGCTGCGTACGGGGGCCGAGTCTCCGACGTGGCGGGCGAGCAAAACGGCCTCGACCTCGCC
GTCGACACCTCATGCGCCTTCGGGAGAGGCGAAAGAGACGGAAGGATACTGTACGTTGCGACGGGGAATAATCCG
AAAAAGGGCCTGGGCGGGAAAGTCGTCGCTGTCGATACGACTTCCATCAGACCGCGCGGCAACTACTTTGCCTGA
Transcript >Ophun1|4135
ATGTTACGACTCCCTCTTCTCGCCTGGATTCTATCAACAGCCGTCAACGGCCAATACGCGCCGCCCCCTTACCGC
CAACAAGACGGCAGCCACCCTCCTTCAGGCCTACCCACGCGGATCGTGCAGCAACTGCCGCCGTCAACATGGATA
GAGAACATGGCGGTTCGCAGCAACGGGAACCTCATCCTCACGCAACTGCGTCCCAGCGCGGCCGTCATACAGGTG
ACGGATCCGTCGAGCCCATACTCGTACTATGAAGTCGCCGGCATCTTCCCTTCCATCGACGGCTTATACGGTATC
ACCGAAGTGTCGACGGATGTCTTTGTCGTGGTGGGCTGTCGGTTCGCCACCATCGGTGATAACGTCAAGGGCTCG
GCTGAGACGTGGATGGTCAACTTCAAGAGCACGGATCGTAGCGGAGGTCCCTTGGTCAAGAGGGTGGGCAGACAT
CCGTACATGGAGTTCCCCAACGGCATGACGTCGCTTCCTGGCGTCGATGATGTCGTCCTCATCGCCGACTCAACC
CTCGGCCTGGTCTGGCGTCTATATCTGGAGACGGGCGTGACCGAAGTAGCAATCCAGCTGCGAGAAATGGCCTAC
CACCAAGGAACGAGGCTCAAGATCGGCATCAACGGCATCAAAATCATCGACGGCTACCTCTGGTGGTCCAACAGC
TACGTAGGCGACCTCTACCGCCTCCGAATCGACCGACTCGGCAACCCAGAGCGCAACGCCCGACCCGAACACATG
TTCCGCCACGAGGGCCGCTTCATCGACGACTTCGTCTTGGACGACCGCGGCCTATGGGGTACCACCAACCAGAAC
AACACGGTCCTGTTCGCTGCGTACGGGGGCCGAGTCTCCGACGTGGCGGGCGAGCAAAACGGCCTCGACCTCGCC
GTCGACACCTCATGCGCCTTCGGGAGAGGCGAAAGAGACGGAAGGATACTGTACGTTGCGACGGGGAATAATCCG
AAAAAGGGCCTGGGCGGGAAAGTCGTCGCTGTCGATACGACTTCCATCAGACCGCGCGGCAACTACTTTGCCTGA
Gene >Ophun1|4135
ATGTTACGACTCCCTCTTCTCGCCTGGATTCTATCAACAGCCGTCAACGGCCAATACGCGCCGCCCCCTTACCGC
CAACAAGACGGCAGCCACCCTCCTTCAGGCCTACCCACGCGGATCGTGCAGCAACTGCCGCCGTCAACATGGATA
GAGAACATGGCGGTTCGCAGCAACGGGAACCTCATCCTCACGCAACTGCGTCCCAGCGCGGCCGTCATACAGGTG
ACGGATCCGTCGAGCCCATACTCGTACTATGAAGTCGCCGGCATCTTCCCTTCCATCGACGGCTTATACGGTATC
ACCGAAGTGTCGACGGATGTCTTTGTCGTGGTGGGCTGTCGGTTCGCCACCATCGGTGATAACGTCAAGGGCTCG
GCTGAGACGTGGATGGTCAACTTCAAGAGCACGGATCGTAGCGGAGGTCCCTTGGTCAAGAGGGTGGGCAGACAT
CCGTACATGGAGTTCCCCAACGGCATGACGTCGCTTCCTGGCGTCGATGATGTCGTCCTCATCGCCGACTCAACC
CTCGGCCTGGTCTGGCGTCTATATCTGGAGACGGGCGTGACCGAAGTAGCAATCCAGCTGCGAGAAATGGCCTAC
CACCAAGGAACGAGGCTCAAGATCGGCATCAACGGCATCAAAATCATCGACGGCTACCTCTGGTGGTCCAACAGC
TACGTAGGCGACCTCTACCGCCTCCGAATCGACCGACTCGGCAACCCAGAGCGCAACGCCCGACCCGAACACATG
TTCCGCCACGAGGGCCGCTTCATCGACGACTTCGTCTTGGACGACCGCGGCCTATGGGGTACCACCAACCAGAAC
AACACGGTCCTGTTCGCTGCGTACGGGGGCCGAGTCTCCGACGTGGCGGGCGAGCAAAACGGCCTCGACCTCGCC
GTCGACACCTCATGCGCCTTCGGGAGAGGCGAAAGAGACGGAAGGATACTGTACGTTGCGACGGGGAATAATCCG
AAAAAGGGCCTGGGCGGGAAAGTCGTCGCTGTCGATACGACTTCCATCAGACCGCGCGGCAACTACTTTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail