Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4134
Gene name
LocationContig_38:7522..10300
Strand+
Gene length (bp)2778
Transcript length (bp)2724
Coding sequence length (bp)2724
Protein length (aa) 908

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09494 Slx4 Slx4 endonuclease 1.9E-25 823 895

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HCM6|SLX4_CHAGB Structure-specific endonuclease subunit SLX4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SLX4 PE=3 SV=2 531 907 1.0E-58
sp|A4R1T1|SLX4_MAGO7 Structure-specific endonuclease subunit SLX4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SLX4 PE=3 SV=3 724 907 4.0E-39
sp|A6SK19|SLX4_BOTFB Structure-specific endonuclease subunit slx4 OS=Botryotinia fuckeliana (strain B05.10) GN=slx4 PE=3 SV=1 181 564 2.0E-36
sp|A7F2D1|SLX4_SCLS1 Structure-specific endonuclease subunit slx4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=slx4 PE=3 SV=1 181 564 3.0E-36
sp|A7F2D1|SLX4_SCLS1 Structure-specific endonuclease subunit slx4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=slx4 PE=3 SV=1 818 907 4.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2HCM6|SLX4_CHAGB Structure-specific endonuclease subunit SLX4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=SLX4 PE=3 SV=2 531 907 1.0E-58
sp|A4R1T1|SLX4_MAGO7 Structure-specific endonuclease subunit SLX4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SLX4 PE=3 SV=3 724 907 4.0E-39
sp|A6SK19|SLX4_BOTFB Structure-specific endonuclease subunit slx4 OS=Botryotinia fuckeliana (strain B05.10) GN=slx4 PE=3 SV=1 181 564 2.0E-36
sp|A7F2D1|SLX4_SCLS1 Structure-specific endonuclease subunit slx4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=slx4 PE=3 SV=1 181 564 3.0E-36
sp|A7F2D1|SLX4_SCLS1 Structure-specific endonuclease subunit slx4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=slx4 PE=3 SV=1 818 907 4.0E-32
sp|A6SK19|SLX4_BOTFB Structure-specific endonuclease subunit slx4 OS=Botryotinia fuckeliana (strain B05.10) GN=slx4 PE=3 SV=1 818 907 3.0E-29
sp|Q7SFJ3|SLX4_NEUCR Structure-specific endonuclease subunit slx4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=slx4 PE=3 SV=1 804 907 6.0E-25
sp|B6QL24|SLX4_TALMQ Structure-specific endonuclease subunit slx4 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=slx4 PE=3 SV=1 170 609 7.0E-24
sp|Q2U6E8|SLX4_ASPOR Structure-specific endonuclease subunit slx4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=slx4 PE=3 SV=2 181 600 8.0E-24
sp|B8NLN6|SLX4_ASPFN Structure-specific endonuclease subunit slx4 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=slx4 PE=3 SV=1 181 600 1.0E-23
sp|Q0C9R2|SLX4_ASPTN Structure-specific endonuclease subunit slx4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=slx4 PE=3 SV=2 186 564 3.0E-23
sp|A5AAW6|SLX4_ASPNC Structure-specific endonuclease subunit slx4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=slx4 PE=3 SV=2 171 564 7.0E-23
sp|A6R4H9|SLX4_AJECN Structure-specific endonuclease subunit SLX4 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SLX4 PE=3 SV=1 822 902 1.0E-22
sp|C0NBH5|SLX4_AJECG Structure-specific endonuclease subunit SLX4 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=SLX4 PE=3 SV=2 822 902 5.0E-22
sp|C5GBK9|SLX4_AJEDR Structure-specific endonuclease subunit SLX4 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=SLX4 PE=3 SV=1 822 896 7.0E-21
sp|C5JR12|SLX4_AJEDS Structure-specific endonuclease subunit SLX4 OS=Ajellomyces dermatitidis (strain SLH14081) GN=SLX4 PE=3 SV=1 822 896 8.0E-21
sp|B8MED8|SLX4_TALSN Structure-specific endonuclease subunit slx4 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=slx4 PE=3 SV=1 186 564 9.0E-21
sp|C1H7M6|SLX4_PARBA Structure-specific endonuclease subunit SLX4 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=SLX4 PE=3 SV=2 822 896 5.0E-20
sp|C0S0E2|SLX4_PARBP Structure-specific endonuclease subunit SLX4 OS=Paracoccidioides brasiliensis (strain Pb03) GN=SLX4 PE=3 SV=1 822 896 7.0E-20
sp|C1GAZ3|SLX4_PARBD Structure-specific endonuclease subunit SLX4 OS=Paracoccidioides brasiliensis (strain Pb18) GN=SLX4 PE=3 SV=3 822 896 8.0E-20
sp|B8NLN6|SLX4_ASPFN Structure-specific endonuclease subunit slx4 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=slx4 PE=3 SV=1 818 896 1.0E-19
sp|Q2U6E8|SLX4_ASPOR Structure-specific endonuclease subunit slx4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=slx4 PE=3 SV=2 818 896 1.0E-19
sp|C4JJE8|SLX4_UNCRE Structure-specific endonuclease subunit SLX4 OS=Uncinocarpus reesii (strain UAMH 1704) GN=SLX4 PE=3 SV=1 825 900 1.0E-18
sp|A1CZ18|SLX4_NEOFI Structure-specific endonuclease subunit slx4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=slx4 PE=3 SV=1 174 564 1.0E-18
sp|B0XUC7|SLX4_ASPFC Structure-specific endonuclease subunit slx4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=slx4 PE=3 SV=1 174 564 1.0E-18
sp|A1CEY6|SLX4_ASPCL Structure-specific endonuclease subunit slx4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=slx4 PE=3 SV=1 821 896 1.0E-18
sp|Q4WI38|SLX4_ASPFU Structure-specific endonuclease subunit slx4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=slx4 PE=3 SV=2 174 564 1.0E-18
sp|B6HBG5|SLX4_PENRW Structure-specific endonuclease subunit slx4 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=slx4 PE=3 SV=1 821 896 2.0E-18
sp|Q1DYR6|SLX4_COCIM Structure-specific endonuclease subunit SLX4 OS=Coccidioides immitis (strain RS) GN=SLX4 PE=3 SV=2 821 896 2.0E-18
sp|C5FSF3|SLX4_ARTOC Structure-specific endonuclease subunit SLX4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SLX4 PE=3 SV=1 821 896 2.0E-18
sp|Q7SFJ3|SLX4_NEUCR Structure-specific endonuclease subunit slx4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=slx4 PE=3 SV=1 183 440 2.0E-18
sp|C0S0E2|SLX4_PARBP Structure-specific endonuclease subunit SLX4 OS=Paracoccidioides brasiliensis (strain Pb03) GN=SLX4 PE=3 SV=1 183 564 4.0E-18
sp|C1GAZ3|SLX4_PARBD Structure-specific endonuclease subunit SLX4 OS=Paracoccidioides brasiliensis (strain Pb18) GN=SLX4 PE=3 SV=3 183 564 6.0E-18
sp|Q0C9R2|SLX4_ASPTN Structure-specific endonuclease subunit slx4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=slx4 PE=3 SV=2 825 896 1.0E-17
sp|Q4WI38|SLX4_ASPFU Structure-specific endonuclease subunit slx4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=slx4 PE=3 SV=2 821 904 1.0E-17
sp|A1CZ18|SLX4_NEOFI Structure-specific endonuclease subunit slx4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=slx4 PE=3 SV=1 821 904 1.0E-17
sp|A4R1T1|SLX4_MAGO7 Structure-specific endonuclease subunit SLX4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=SLX4 PE=3 SV=3 155 460 2.0E-17
sp|B0XUC7|SLX4_ASPFC Structure-specific endonuclease subunit slx4 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=slx4 PE=3 SV=1 814 904 2.0E-17
sp|C1H7M6|SLX4_PARBA Structure-specific endonuclease subunit SLX4 OS=Paracoccidioides lutzii (strain ATCC MYA-826 / Pb01) GN=SLX4 PE=3 SV=2 183 564 1.0E-16
sp|Q1DYR6|SLX4_COCIM Structure-specific endonuclease subunit SLX4 OS=Coccidioides immitis (strain RS) GN=SLX4 PE=3 SV=2 173 564 2.0E-16
sp|C0NBH5|SLX4_AJECG Structure-specific endonuclease subunit SLX4 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=SLX4 PE=3 SV=2 182 564 2.0E-16
sp|Q5B4M1|SLX4_EMENI Structure-specific endonuclease subunit slx4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=slx4 PE=3 SV=1 173 564 2.0E-16
sp|C5FSF3|SLX4_ARTOC Structure-specific endonuclease subunit SLX4 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=SLX4 PE=3 SV=1 182 564 6.0E-16
sp|Q0V640|SLX4_PHANO Structure-specific endonuclease subunit SLX4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SLX4 PE=3 SV=2 822 895 7.0E-16
sp|B8MED8|SLX4_TALSN Structure-specific endonuclease subunit slx4 OS=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) GN=slx4 PE=3 SV=1 821 896 1.0E-14
sp|B6QL24|SLX4_TALMQ Structure-specific endonuclease subunit slx4 OS=Talaromyces marneffei (strain ATCC 18224 / CBS 334.59 / QM 7333) GN=slx4 PE=3 SV=1 768 896 2.0E-14
sp|A6R4H9|SLX4_AJECN Structure-specific endonuclease subunit SLX4 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=SLX4 PE=3 SV=1 186 564 2.0E-14
sp|A5AAW6|SLX4_ASPNC Structure-specific endonuclease subunit slx4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=slx4 PE=3 SV=2 843 896 2.0E-12
sp|C5GBK9|SLX4_AJEDR Structure-specific endonuclease subunit SLX4 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=SLX4 PE=3 SV=1 171 564 1.0E-11
sp|C5JR12|SLX4_AJEDS Structure-specific endonuclease subunit SLX4 OS=Ajellomyces dermatitidis (strain SLH14081) GN=SLX4 PE=3 SV=1 171 564 2.0E-11
sp|A1CEY6|SLX4_ASPCL Structure-specific endonuclease subunit slx4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=slx4 PE=3 SV=1 186 564 2.0E-11
sp|Q0V640|SLX4_PHANO Structure-specific endonuclease subunit SLX4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SLX4 PE=3 SV=2 186 431 1.0E-09
sp|C4JJE8|SLX4_UNCRE Structure-specific endonuclease subunit SLX4 OS=Uncinocarpus reesii (strain UAMH 1704) GN=SLX4 PE=3 SV=1 182 564 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005634 nucleus Yes
GO:0033557 Slx1-Slx4 complex Yes
GO:0006281 DNA repair Yes
GO:0006260 DNA replication Yes
GO:0006259 DNA metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050896 response to stimulus No
GO:0140513 nuclear protein-containing complex No
GO:0043229 intracellular organelle No
GO:0044260 cellular macromolecule metabolic process No
GO:0032991 protein-containing complex No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0043227 membrane-bounded organelle No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0051716 cellular response to stimulus No
GO:0006807 nitrogen compound metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0043226 organelle No
GO:0110165 cellular anatomical entity No
GO:0033554 cellular response to stress No
GO:0005575 cellular_component No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0046483 heterocycle metabolic process No
GO:0008150 biological_process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043231 intracellular membrane-bounded organelle No
GO:0006950 response to stress No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4513
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6694
Ophiocordyceps australis map64 (Brazil) OphauB2|60
Ophiocordyceps camponoti-floridani Ophcf2|02569
Ophiocordyceps camponoti-rufipedis Ophun1|4134 (this protein)
Ophiocordyceps kimflemingae Ophio5|1002
Ophiocordyceps subramaniannii Hirsu2|9432

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4134
MSSPDVFITSSPRARRQALTANMSSSPGLPSVQEILSQKPQRPPIRSTPLEKNAPACKSRPWRALHGEEAAKRND
SGIHEAVEDIDTSFSVIEVPADSLKAGAKAQRLKKAGQKSAETPQPPATPTRSPVDDQPWRKYKSPNRSSEPLAN
ELKPASSGNDAPDCSRYFIKPSEANKTAKKVEDEPLNLEAAMTRRTDWTPPTQRVRIILDSDDTPDVDPMRHSQD
FNEKATSFETVLAPFKCDDAVQMQTGSETTDDSGFPKKRKLLELVQTNAGTASKPCKKRKAPKKTRTITEIATAA
YRPVTQPDDVASQGKAPDGAQAADTGNGKTKPRKRPPKASKKKEAPPKPILLSPEAAMRRVAHQDFLFGTSSQLA
REQSPSSKPRPTTSHSANVDLVDLRTPINSDAIEPAEQRQTLWDAAARDEDGDLFDVELGLLTDAPPELAEAAPE
ADPFGYVRSDNPVTVSLPSLSDTDEGRGGEPSASLPVMITAESMHNIPKYVPGAERPSAAEKEKQKTQAVKGPEG
RAGPRYELFTDAQLAKQVAQYGFKPVKKREAMVALLNRCRPDAVLDPSGTRSASTMAVVKKRGQGRTKAANAGGK
EAQEPAAKEKRSRGRGFDISDEELLKMVPTRKRSPARISDAVKEPTKGRRRQSRSRAGSVSHDEAISPTIEKPGR
GRSRRASKVRDSAEPPVEKKRRRSRSRVGSVSDDELEMWFMTPTRGERSRDRTIREQPPPSAQPPLSPRKGKSAA
SKPAAKRSTRKTAPATPKRRSRSRRKTPEMGDSQSESGSDTSASSSMGFGPSVDETELTLAMSSPTDQQRELFAQ
INKAVTTAPRTREPTQPSWHEKILMYDPIVLEDLTAWLNSGQLTRVGLDEEVSPVEVKAWCESRSICCVWRMSIH
GKERKRY*
Coding >Ophun1|4134
ATGTCGTCACCAGACGTGTTCATCACATCGTCGCCCCGCGCCAGGCGACAGGCCCTCACGGCTAATATGTCCTCA
TCGCCTGGTCTTCCTTCTGTGCAGGAGATCCTGTCGCAGAAGCCGCAGCGGCCGCCGATCCGGAGCACGCCCTTG
GAGAAGAACGCTCCTGCGTGCAAGTCCCGTCCCTGGAGGGCGCTACACGGCGAAGAAGCGGCCAAAAGGAATGAC
AGTGGCATTCACGAAGCTGTCGAAGATATTGACACGTCTTTCTCTGTGATTGAGGTGCCTGCGGACAGCCTCAAG
GCAGGGGCCAAGGCCCAACGGCTGAAGAAAGCAGGCCAGAAAAGCGCCGAGACGCCCCAGCCACCAGCGACTCCT
ACCAGGTCACCAGTCGACGATCAGCCATGGAGAAAATACAAGTCTCCGAATCGAAGCTCAGAGCCACTCGCGAAC
GAGTTGAAGCCGGCGAGTTCGGGCAACGATGCCCCCGACTGCAGCCGCTATTTCATCAAGCCCAGCGAAGCGAAT
AAGACGGCAAAAAAGGTCGAAGACGAGCCACTCAACCTCGAAGCCGCCATGACGCGACGGACGGATTGGACACCG
CCCACTCAGAGAGTTCGCATTATTCTTGACTCTGATGATACGCCCGACGTGGATCCTATGCGTCATTCGCAAGAC
TTTAACGAAAAGGCCACCTCTTTCGAGACTGTACTCGCTCCCTTCAAATGCGACGATGCGGTGCAGATGCAAACG
GGTTCAGAAACAACAGACGACAGCGGTTTTCCTAAGAAGCGAAAGTTGTTGGAGCTCGTTCAGACAAACGCCGGG
ACTGCTTCGAAACCCTGCAAGAAGCGGAAAGCACCCAAGAAGACGCGAACTATTACAGAGATTGCCACGGCGGCC
TACAGACCTGTGACCCAGCCCGATGATGTGGCAAGCCAGGGCAAAGCGCCTGACGGAGCTCAGGCTGCAGACACG
GGCAACGGTAAGACGAAGCCGCGAAAAAGACCTCCCAAGGCGTCGAAGAAGAAGGAAGCGCCGCCCAAGCCGATT
CTCTTATCCCCAGAGGCTGCAATGAGACGGGTGGCACATCAAGACTTTCTCTTTGGCACTTCTAGCCAACTCGCA
CGCGAGCAGTCTCCGTCTTCAAAGCCACGGCCGACCACAAGCCACTCTGCTAACGTGGACTTGGTCGATCTCAGG
ACGCCAATCAACAGCGATGCGATTGAGCCTGCGGAGCAAAGACAGACGTTATGGGATGCTGCGGCAAGAGACGAG
GACGGAGACTTGTTCGATGTTGAATTAGGTCTCTTGACGGATGCTCCGCCCGAGCTTGCCGAGGCCGCCCCTGAA
GCCGATCCATTTGGTTATGTTCGATCCGACAACCCAGTCACTGTCTCGCTGCCCTCACTCTCCGACACTGATGAG
GGTCGAGGTGGCGAGCCGTCGGCCAGTCTGCCTGTCATGATAACGGCCGAATCTATGCACAATATTCCTAAATAT
GTCCCCGGCGCTGAGAGGCCATCAGCTGCGGAGAAGGAGAAGCAAAAGACTCAGGCTGTCAAAGGGCCAGAGGGT
CGGGCAGGGCCTCGTTACGAGCTCTTTACAGATGCACAACTCGCCAAGCAAGTCGCGCAGTATGGATTCAAGCCT
GTCAAGAAGCGCGAGGCCATGGTTGCACTGTTGAATCGATGCAGACCAGACGCCGTGCTCGACCCGTCCGGAACA
AGATCAGCCAGCACCATGGCCGTCGTCAAGAAACGAGGTCAAGGTCGGACCAAAGCAGCCAACGCGGGCGGCAAA
GAAGCGCAAGAGCCGGCCGCCAAGGAGAAGCGAAGCCGAGGTAGAGGATTTGATATCAGCGACGAGGAACTGTTG
AAGATGGTTCCGACTAGGAAGAGGTCTCCGGCTCGAATCAGCGACGCGGTGAAAGAGCCAACCAAGGGAAGGAGA
CGCCAGAGTCGAAGCAGAGCAGGCAGCGTCAGTCACGACGAAGCCATCTCTCCAACGATAGAGAAGCCAGGACGA
GGTCGCAGTCGAAGGGCCAGCAAGGTACGAGATTCGGCAGAACCCCCCGTCGAGAAGAAGCGACGTCGAAGCCGG
AGCAGAGTTGGTAGCGTCAGCGATGATGAGCTGGAAATGTGGTTCATGACGCCAACCAGGGGAGAGCGATCCAGA
GACAGGACGATTCGGGAACAGCCGCCACCATCGGCACAACCCCCTTTATCGCCTCGCAAAGGAAAGTCGGCAGCA
TCAAAGCCAGCCGCGAAGAGGTCAACTCGGAAGACGGCCCCGGCGACGCCGAAGCGCAGAAGCAGGTCACGGCGG
AAGACGCCCGAGATGGGCGACTCGCAGTCAGAGTCCGGATCCGACACATCGGCATCGTCGTCGATGGGCTTCGGA
CCGTCGGTCGACGAGACGGAACTGACGCTGGCCATGTCGTCGCCGACGGATCAGCAGAGAGAGCTGTTTGCGCAA
ATCAACAAGGCGGTTACAACAGCACCTCGGACGAGGGAGCCGACACAGCCGTCGTGGCACGAGAAGATTCTCATG
TACGACCCCATCGTGCTCGAGGATCTGACGGCCTGGCTCAATAGTGGGCAGCTGACGCGCGTCGGGCTCGACGAG
GAGGTGAGTCCGGTCGAGGTCAAGGCGTGGTGCGAGTCGAGGAGCATATGCTGCGTGTGGCGGATGAGCATTCAT
GGTAAGGAGAGGAAGCGGTATTAG
Transcript >Ophun1|4134
ATGTCGTCACCAGACGTGTTCATCACATCGTCGCCCCGCGCCAGGCGACAGGCCCTCACGGCTAATATGTCCTCA
TCGCCTGGTCTTCCTTCTGTGCAGGAGATCCTGTCGCAGAAGCCGCAGCGGCCGCCGATCCGGAGCACGCCCTTG
GAGAAGAACGCTCCTGCGTGCAAGTCCCGTCCCTGGAGGGCGCTACACGGCGAAGAAGCGGCCAAAAGGAATGAC
AGTGGCATTCACGAAGCTGTCGAAGATATTGACACGTCTTTCTCTGTGATTGAGGTGCCTGCGGACAGCCTCAAG
GCAGGGGCCAAGGCCCAACGGCTGAAGAAAGCAGGCCAGAAAAGCGCCGAGACGCCCCAGCCACCAGCGACTCCT
ACCAGGTCACCAGTCGACGATCAGCCATGGAGAAAATACAAGTCTCCGAATCGAAGCTCAGAGCCACTCGCGAAC
GAGTTGAAGCCGGCGAGTTCGGGCAACGATGCCCCCGACTGCAGCCGCTATTTCATCAAGCCCAGCGAAGCGAAT
AAGACGGCAAAAAAGGTCGAAGACGAGCCACTCAACCTCGAAGCCGCCATGACGCGACGGACGGATTGGACACCG
CCCACTCAGAGAGTTCGCATTATTCTTGACTCTGATGATACGCCCGACGTGGATCCTATGCGTCATTCGCAAGAC
TTTAACGAAAAGGCCACCTCTTTCGAGACTGTACTCGCTCCCTTCAAATGCGACGATGCGGTGCAGATGCAAACG
GGTTCAGAAACAACAGACGACAGCGGTTTTCCTAAGAAGCGAAAGTTGTTGGAGCTCGTTCAGACAAACGCCGGG
ACTGCTTCGAAACCCTGCAAGAAGCGGAAAGCACCCAAGAAGACGCGAACTATTACAGAGATTGCCACGGCGGCC
TACAGACCTGTGACCCAGCCCGATGATGTGGCAAGCCAGGGCAAAGCGCCTGACGGAGCTCAGGCTGCAGACACG
GGCAACGGTAAGACGAAGCCGCGAAAAAGACCTCCCAAGGCGTCGAAGAAGAAGGAAGCGCCGCCCAAGCCGATT
CTCTTATCCCCAGAGGCTGCAATGAGACGGGTGGCACATCAAGACTTTCTCTTTGGCACTTCTAGCCAACTCGCA
CGCGAGCAGTCTCCGTCTTCAAAGCCACGGCCGACCACAAGCCACTCTGCTAACGTGGACTTGGTCGATCTCAGG
ACGCCAATCAACAGCGATGCGATTGAGCCTGCGGAGCAAAGACAGACGTTATGGGATGCTGCGGCAAGAGACGAG
GACGGAGACTTGTTCGATGTTGAATTAGGTCTCTTGACGGATGCTCCGCCCGAGCTTGCCGAGGCCGCCCCTGAA
GCCGATCCATTTGGTTATGTTCGATCCGACAACCCAGTCACTGTCTCGCTGCCCTCACTCTCCGACACTGATGAG
GGTCGAGGTGGCGAGCCGTCGGCCAGTCTGCCTGTCATGATAACGGCCGAATCTATGCACAATATTCCTAAATAT
GTCCCCGGCGCTGAGAGGCCATCAGCTGCGGAGAAGGAGAAGCAAAAGACTCAGGCTGTCAAAGGGCCAGAGGGT
CGGGCAGGGCCTCGTTACGAGCTCTTTACAGATGCACAACTCGCCAAGCAAGTCGCGCAGTATGGATTCAAGCCT
GTCAAGAAGCGCGAGGCCATGGTTGCACTGTTGAATCGATGCAGACCAGACGCCGTGCTCGACCCGTCCGGAACA
AGATCAGCCAGCACCATGGCCGTCGTCAAGAAACGAGGTCAAGGTCGGACCAAAGCAGCCAACGCGGGCGGCAAA
GAAGCGCAAGAGCCGGCCGCCAAGGAGAAGCGAAGCCGAGGTAGAGGATTTGATATCAGCGACGAGGAACTGTTG
AAGATGGTTCCGACTAGGAAGAGGTCTCCGGCTCGAATCAGCGACGCGGTGAAAGAGCCAACCAAGGGAAGGAGA
CGCCAGAGTCGAAGCAGAGCAGGCAGCGTCAGTCACGACGAAGCCATCTCTCCAACGATAGAGAAGCCAGGACGA
GGTCGCAGTCGAAGGGCCAGCAAGGTACGAGATTCGGCAGAACCCCCCGTCGAGAAGAAGCGACGTCGAAGCCGG
AGCAGAGTTGGTAGCGTCAGCGATGATGAGCTGGAAATGTGGTTCATGACGCCAACCAGGGGAGAGCGATCCAGA
GACAGGACGATTCGGGAACAGCCGCCACCATCGGCACAACCCCCTTTATCGCCTCGCAAAGGAAAGTCGGCAGCA
TCAAAGCCAGCCGCGAAGAGGTCAACTCGGAAGACGGCCCCGGCGACGCCGAAGCGCAGAAGCAGGTCACGGCGG
AAGACGCCCGAGATGGGCGACTCGCAGTCAGAGTCCGGATCCGACACATCGGCATCGTCGTCGATGGGCTTCGGA
CCGTCGGTCGACGAGACGGAACTGACGCTGGCCATGTCGTCGCCGACGGATCAGCAGAGAGAGCTGTTTGCGCAA
ATCAACAAGGCGGTTACAACAGCACCTCGGACGAGGGAGCCGACACAGCCGTCGTGGCACGAGAAGATTCTCATG
TACGACCCCATCGTGCTCGAGGATCTGACGGCCTGGCTCAATAGTGGGCAGCTGACGCGCGTCGGGCTCGACGAG
GAGGTGAGTCCGGTCGAGGTCAAGGCGTGGTGCGAGTCGAGGAGCATATGCTGCGTGTGGCGGATGAGCATTCAT
GGTAAGGAGAGGAAGCGGTATTAG
Gene >Ophun1|4134
ATGTCGTCACCAGACGTGTTCATCACATCGTCGCCCCGCGCCAGGCGACAGGCCCTCACGGCTAATATGTCCTCA
TCGCCTGGTCTTCCTTCTGTGCAGGAGATCCTGTCGCAGAAGCCGCAGCGGCCGCCGATCCGGAGCACGCCCTTG
GAGAAGAACGCTCCTGCGTGCAAGTCCCGTCCCTGGAGGGCGCTACACGGCGAAGAAGCGGCCAAAAGGAATGAC
AGTGGCATTCACGAAGCTGTCGAAGATATTGACACGTCTTTCTCTGTGATTGAGGTGCCTGCGGACAGCCTCAAG
GCAGGGGCCAAGGCCCAACGGCTGAAGAAAGCAGGCCAGAAAAGCGCCGAGACGCCCCAGCCACCAGCGACTCCT
ACCAGGTCACCAGTCGACGATCAGCCATGGAGAAAATACAAGTCTCCGAATCGAAGCTCAGAGCCACTCGCGAAC
GAGTTGAAGCCGGCGAGTTCGGGCAACGATGCCCCCGACTGCAGCCGCTATTTCATCAAGCCCAGCGAAGCGAAT
AAGACGGCAAAAAAGGTCGAAGACGAGCCACTCAACCTCGAAGCCGCCATGACGCGACGGACGGATTGGACACCG
CCCACTCAGAGAGTTCGCATTATTCTTGACTCTGATGATACGCCCGACGTGGATCCTATGCGTCATTCGCAAGAC
TTTAACGAAAAGGCCACCTCTTTCGAGACTGTACTCGCTCCCTTCAAATGCGACGATGCGGTGCAGATGCAAACG
GGTTCAGAAACAACAGACGACAGCGGTTTTCCTAAGAAGCGAAAGTTGTTGGAGCTCGTTCAGACAAACGCCGGG
ACTGCTTCGAAACCCTGCAAGAAGCGGAAAGCACCCAAGAAGACGCGAACTATTACAGAGATTGCCACGGCGGCC
TACAGACCTGTGACCCAGCCCGATGATGTGGCAAGCCAGGGCAAAGCGCCTGACGGAGCTCAGGCTGCAGACACG
GGCAACGGTAAGACGAAGCCGCGAAAAAGACCTCCCAAGGCGTCGAAGAAGAAGGAAGCGCCGCCCAAGCCGATT
CTCTTATCCCCAGAGGCTGCAATGAGACGGGTGGCACATCAAGACTTTCTCTTTGGCACTTCTAGCCAACTCGCA
CGCGAGCAGTCTCCGTCTTCAAAGCCACGGCCGACCACAAGCCACTCTGCTAACGTGGACTTGGTCGATCTCAGG
ACGCCAATCAACAGCGATGCGATTGAGCCTGCGGAGCAAAGACAGACGTTATGGGATGCTGCGGCAAGAGACGAG
GACGGAGACTTGTTCGATGTTGAATTAGGTCTCTTGACGGATGCTCCGCCCGAGCTTGCCGAGGCCGCCCCTGAA
GCCGATCCATTTGGTTATGTTCGATCCGACAACCCAGTCACTGTCTCGCTGCCCTCACTCTCCGACACTGATGAG
GGTCGAGGTGGCGAGCCGTCGGCCAGTCTGCCTGTCATGATAACGGCCGAATCTATGCACAGTGAGAAGGGGAGT
GGAATTATGTGTGGGGCTGATCGTGACGCAGCTCTCGCAGATATTCCTAAATATGTCCCCGGCGCTGAGAGGCCA
TCAGCTGCGGAGAAGGAGAAGCAAAAGACTCAGGCTGTCAAAGGGCCAGAGGGTCGGGCAGGGCCTCGTTACGAG
CTCTTTACAGATGCACAACTCGCCAAGCAAGTCGCGCAGTATGGATTCAAGCCTGTCAAGAAGCGCGAGGCCATG
GTTGCACTGTTGAATCGATGCAGACCAGACGCCGTGCTCGACCCGTCCGGAACAAGATCAGCCAGCACCATGGCC
GTCGTCAAGAAACGAGGTCAAGGTCGGACCAAAGCAGCCAACGCGGGCGGCAAAGAAGCGCAAGAGCCGGCCGCC
AAGGAGAAGCGAAGCCGAGGTAGAGGATTTGATATCAGCGACGAGGAACTGTTGAAGATGGTTCCGACTAGGAAG
AGGTCTCCGGCTCGAATCAGCGACGCGGTGAAAGAGCCAACCAAGGGAAGGAGACGCCAGAGTCGAAGCAGAGCA
GGCAGCGTCAGTCACGACGAAGCCATCTCTCCAACGATAGAGAAGCCAGGACGAGGTCGCAGTCGAAGGGCCAGC
AAGGTACGAGATTCGGCAGAACCCCCCGTCGAGAAGAAGCGACGTCGAAGCCGGAGCAGAGTTGGTAGCGTCAGC
GATGATGAGCTGGAAATGTGGTTCATGACGCCAACCAGGGGAGAGCGATCCAGAGACAGGACGATTCGGGAACAG
CCGCCACCATCGGCACAACCCCCTTTATCGCCTCGCAAAGGAAAGTCGGCAGCATCAAAGCCAGCCGCGAAGAGG
TCAACTCGGAAGACGGCCCCGGCGACGCCGAAGCGCAGAAGCAGGTCACGGCGGAAGACGCCCGAGATGGGCGAC
TCGCAGTCAGAGTCCGGATCCGACACATCGGCATCGTCGTCGATGGGCTTCGGACCGTCGGTCGACGAGACGGAA
CTGACGCTGGCCATGTCGTCGCCGACGGATCAGCAGAGAGAGCTGTTTGCGCAAATCAACAAGGCGGTTACAACA
GCACCTCGGACGAGGGAGCCGACACAGCCGTCGTGGCACGAGAAGATTCTCATGTACGACCCCATCGTGCTCGAG
GATCTGACGGCCTGGCTCAATAGTGGGCAGCTGACGCGCGTCGGGCTCGACGAGGAGGTGAGTCCGGTCGAGGTC
AAGGCGTGGTGCGAGTCGAGGAGCATATGCTGCGTGTGGCGGATGAGCATTCATGGTAAGGAGAGGAAGCGGTAT
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail