Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4128
Gene name
LocationContig_379:12970..15549
Strand-
Gene length (bp)2579
Transcript length (bp)2235
Coding sequence length (bp)2235
Protein length (aa) 745

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12896 ANAPC4 Anaphase-promoting complex, cyclosome, subunit 4 5.1E-68 264 463
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 6.0E-10 27 118

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O42839|APC4_SCHPO Anaphase-promoting complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut20 PE=1 SV=2 11 509 4.0E-20
sp|Q5RAQ5|APC4_PONAB Anaphase-promoting complex subunit 4 OS=Pongo abelii GN=ANAPC4 PE=2 SV=1 198 456 5.0E-08
sp|Q9UJX5|APC4_HUMAN Anaphase-promoting complex subunit 4 OS=Homo sapiens GN=ANAPC4 PE=1 SV=2 198 456 8.0E-08
sp|O65418|APC4_ARATH Anaphase-promoting complex subunit 4 OS=Arabidopsis thaliana GN=APC4 PE=2 SV=2 75 456 1.0E-07
sp|Q91W96|APC4_MOUSE Anaphase-promoting complex subunit 4 OS=Mus musculus GN=Anapc4 PE=1 SV=1 18 456 3.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5019
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|543
Ophiocordyceps australis map64 (Brazil) OphauB2|6932
Ophiocordyceps camponoti-floridani Ophcf2|01873
Ophiocordyceps camponoti-rufipedis Ophun1|4128 (this protein)
Ophiocordyceps kimflemingae Ophio5|8218
Ophiocordyceps subramaniannii Hirsu2|2541

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4128
MAQAKQLVLFSETELDSRAPRGFPVGCPTLDVALTWDSGSSSLVVYRPPGQVISKVHQLAGAQGEAAPEAVAATW
SPDGQFLAVGWSDGIVRLIRLENNKVAHRIPGTGAQITYIGWTGSNMPKPTSTSASDFPTGNGGLPLSLPQALSF
LDVDSALPKISPLPSGSAGADEDANVFTLRASVDFLFQPLKQEDHDSVNVMVVGTSDGKVQLSIYDSFVIGTFQC
PTAGNKNVSKLVQHASHPDVSTHALILADDLSETGEVQVLPLDLPFVSSSRINLSLLASKLTTLQKLLRYMKQTQ
LHMQVEWRNARELPARFLRGIQADLADMQSGPRGIVPALYHVVVTGHAYEPVREWLVDTIADRGHKRWEKAVVSG
LENLRSLVHENFLPALERCVLILSRLRGLAQFHDDRDDIGFSVSQVSRALDIIGCLHLVGHKILVHVMDELEHFA
AFSVWLRFQIDGLTGGASQELTEKEATMDTFRVLAYIETYLASSPLDMFFDDISTKDFAADWDHCEDGPSLLEML
DTQLKKREDGQSSMRALPHVDFLVNYMTTWCDRIFKSVAESMERSVRFGTPIKLPVGASFSKMDVKVGKAAKGGA
IYTAVACRNSESKVYILRTEMDIASGISFNLPATGCCVDLANRQLIDAKFLNDETLIVLCKENDLSSIAISIPVQ
SSELPYATLGSGGLESVNIIPAHGFVKHVLPGQQAARMEVHDKSEVKGQIPKRICLLSNDGTRWRTYSI*
Coding >Ophun1|4128
ATGGCCCAGGCGAAGCAGCTCGTGCTCTTCAGCGAGACAGAGCTCGATTCCCGAGCTCCTCGCGGCTTCCCCGTT
GGCTGCCCGACGCTGGACGTGGCCTTGACGTGGGACAGCGGCAGCAGTAGCCTTGTCGTCTATAGGCCTCCAGGC
CAAGTGATATCCAAGGTGCACCAGTTAGCCGGTGCCCAAGGAGAAGCGGCACCGGAAGCCGTGGCAGCGACTTGG
AGCCCAGACGGGCAGTTCCTGGCCGTGGGCTGGAGCGATGGCATCGTCCGGCTTATAAGACTAGAGAATAACAAG
GTCGCCCATCGCATCCCGGGAACAGGAGCACAAATCACATATATCGGCTGGACAGGCAGCAACATGCCCAAGCCG
ACGTCTACTTCAGCCAGCGACTTTCCCACAGGCAACGGCGGGCTTCCTCTCAGCCTCCCTCAGGCGCTGTCCTTT
CTCGACGTTGACTCTGCCTTGCCCAAGATAAGTCCTCTGCCAAGCGGCAGTGCTGGCGCCGATGAGGATGCCAAC
GTCTTTACTCTACGAGCCAGCGTCGACTTCCTCTTCCAGCCCCTAAAGCAAGAGGACCACGATTCCGTCAACGTC
ATGGTGGTGGGAACCAGCGACGGCAAGGTGCAGCTGAGCATCTACGATTCCTTCGTCATCGGGACGTTTCAGTGC
CCGACAGCAGGCAACAAAAACGTGTCCAAGCTAGTTCAACATGCATCGCATCCCGACGTCTCGACCCACGCGCTC
ATCTTGGCAGATGACTTGTCGGAGACGGGCGAGGTCCAAGTGCTGCCCCTGGACCTACCCTTCGTCTCATCTTCG
CGCATCAACTTGTCCCTCCTCGCGTCCAAGTTGACTACGCTGCAGAAGCTTCTGAGGTATATGAAGCAGACGCAG
CTGCATATGCAGGTCGAATGGCGGAACGCGAGGGAGTTGCCGGCTCGCTTCCTCAGAGGCATTCAGGCCGACCTT
GCGGACATGCAAAGCGGACCGCGCGGCATCGTTCCGGCCTTGTATCATGTGGTGGTAACGGGCCATGCCTACGAA
CCGGTCCGCGAATGGCTCGTAGATACTATCGCAGACAGGGGCCACAAACGCTGGGAAAAAGCCGTTGTTTCCGGT
CTGGAGAATCTACGCAGCCTCGTCCACGAAAACTTTCTCCCGGCCCTCGAGCGCTGCGTTCTCATTCTCAGCCGG
CTTCGAGGGCTCGCCCAGTTTCACGACGACCGCGATGACATTGGCTTCTCTGTTTCCCAGGTCAGCCGCGCCTTG
GACATCATCGGCTGTCTGCACCTCGTTGGCCACAAGATCCTCGTCCACGTCATGGACGAGCTGGAGCACTTTGCA
GCCTTTTCCGTCTGGTTGCGTTTCCAGATCGACGGCTTGACCGGCGGAGCGAGCCAAGAACTCACAGAGAAAGAG
GCCACGATGGACACTTTCAGAGTCCTCGCGTACATCGAGACTTACCTCGCTTCGAGCCCGCTCGACATGTTCTTC
GACGACATCTCGACTAAGGACTTTGCGGCCGACTGGGATCATTGCGAGGACGGACCGAGCCTGCTGGAGATGCTG
GACACGCAGCTCAAGAAGCGGGAAGATGGGCAGTCGAGCATGAGAGCGCTACCCCACGTGGACTTTCTCGTCAAC
TACATGACGACGTGGTGCGATAGGATCTTCAAGAGCGTCGCCGAATCCATGGAAAGGAGTGTACGTTTTGGAACG
CCCATCAAGCTCCCGGTTGGAGCCTCGTTCAGCAAGATGGATGTGAAAGTTGGCAAGGCTGCAAAGGGAGGCGCC
ATCTACACCGCCGTGGCGTGCAGAAACAGCGAGAGCAAAGTGTACATCTTGCGCACTGAAATGGACATTGCCAGC
GGCATCAGCTTCAATCTGCCGGCGACGGGCTGCTGCGTCGACCTGGCCAACCGCCAGCTCATTGACGCCAAATTC
CTCAACGACGAAACACTCATCGTGCTTTGCAAGGAAAACGACCTATCTTCGATCGCGATATCCATACCGGTCCAG
TCAAGTGAACTGCCATATGCCACGTTGGGCTCCGGGGGGCTCGAAAGCGTCAACATCATCCCAGCACATGGCTTC
GTCAAACATGTGCTACCCGGACAGCAAGCGGCGAGGATGGAGGTACACGACAAGAGCGAGGTCAAGGGGCAGATT
CCCAAGAGGATATGTCTCCTCAGCAACGACGGAACCAGATGGCGAACGTACTCGATATGA
Transcript >Ophun1|4128
ATGGCCCAGGCGAAGCAGCTCGTGCTCTTCAGCGAGACAGAGCTCGATTCCCGAGCTCCTCGCGGCTTCCCCGTT
GGCTGCCCGACGCTGGACGTGGCCTTGACGTGGGACAGCGGCAGCAGTAGCCTTGTCGTCTATAGGCCTCCAGGC
CAAGTGATATCCAAGGTGCACCAGTTAGCCGGTGCCCAAGGAGAAGCGGCACCGGAAGCCGTGGCAGCGACTTGG
AGCCCAGACGGGCAGTTCCTGGCCGTGGGCTGGAGCGATGGCATCGTCCGGCTTATAAGACTAGAGAATAACAAG
GTCGCCCATCGCATCCCGGGAACAGGAGCACAAATCACATATATCGGCTGGACAGGCAGCAACATGCCCAAGCCG
ACGTCTACTTCAGCCAGCGACTTTCCCACAGGCAACGGCGGGCTTCCTCTCAGCCTCCCTCAGGCGCTGTCCTTT
CTCGACGTTGACTCTGCCTTGCCCAAGATAAGTCCTCTGCCAAGCGGCAGTGCTGGCGCCGATGAGGATGCCAAC
GTCTTTACTCTACGAGCCAGCGTCGACTTCCTCTTCCAGCCCCTAAAGCAAGAGGACCACGATTCCGTCAACGTC
ATGGTGGTGGGAACCAGCGACGGCAAGGTGCAGCTGAGCATCTACGATTCCTTCGTCATCGGGACGTTTCAGTGC
CCGACAGCAGGCAACAAAAACGTGTCCAAGCTAGTTCAACATGCATCGCATCCCGACGTCTCGACCCACGCGCTC
ATCTTGGCAGATGACTTGTCGGAGACGGGCGAGGTCCAAGTGCTGCCCCTGGACCTACCCTTCGTCTCATCTTCG
CGCATCAACTTGTCCCTCCTCGCGTCCAAGTTGACTACGCTGCAGAAGCTTCTGAGGTATATGAAGCAGACGCAG
CTGCATATGCAGGTCGAATGGCGGAACGCGAGGGAGTTGCCGGCTCGCTTCCTCAGAGGCATTCAGGCCGACCTT
GCGGACATGCAAAGCGGACCGCGCGGCATCGTTCCGGCCTTGTATCATGTGGTGGTAACGGGCCATGCCTACGAA
CCGGTCCGCGAATGGCTCGTAGATACTATCGCAGACAGGGGCCACAAACGCTGGGAAAAAGCCGTTGTTTCCGGT
CTGGAGAATCTACGCAGCCTCGTCCACGAAAACTTTCTCCCGGCCCTCGAGCGCTGCGTTCTCATTCTCAGCCGG
CTTCGAGGGCTCGCCCAGTTTCACGACGACCGCGATGACATTGGCTTCTCTGTTTCCCAGGTCAGCCGCGCCTTG
GACATCATCGGCTGTCTGCACCTCGTTGGCCACAAGATCCTCGTCCACGTCATGGACGAGCTGGAGCACTTTGCA
GCCTTTTCCGTCTGGTTGCGTTTCCAGATCGACGGCTTGACCGGCGGAGCGAGCCAAGAACTCACAGAGAAAGAG
GCCACGATGGACACTTTCAGAGTCCTCGCGTACATCGAGACTTACCTCGCTTCGAGCCCGCTCGACATGTTCTTC
GACGACATCTCGACTAAGGACTTTGCGGCCGACTGGGATCATTGCGAGGACGGACCGAGCCTGCTGGAGATGCTG
GACACGCAGCTCAAGAAGCGGGAAGATGGGCAGTCGAGCATGAGAGCGCTACCCCACGTGGACTTTCTCGTCAAC
TACATGACGACGTGGTGCGATAGGATCTTCAAGAGCGTCGCCGAATCCATGGAAAGGAGTGTACGTTTTGGAACG
CCCATCAAGCTCCCGGTTGGAGCCTCGTTCAGCAAGATGGATGTGAAAGTTGGCAAGGCTGCAAAGGGAGGCGCC
ATCTACACCGCCGTGGCGTGCAGAAACAGCGAGAGCAAAGTGTACATCTTGCGCACTGAAATGGACATTGCCAGC
GGCATCAGCTTCAATCTGCCGGCGACGGGCTGCTGCGTCGACCTGGCCAACCGCCAGCTCATTGACGCCAAATTC
CTCAACGACGAAACACTCATCGTGCTTTGCAAGGAAAACGACCTATCTTCGATCGCGATATCCATACCGGTCCAG
TCAAGTGAACTGCCATATGCCACGTTGGGCTCCGGGGGGCTCGAAAGCGTCAACATCATCCCAGCACATGGCTTC
GTCAAACATGTGCTACCCGGACAGCAAGCGGCGAGGATGGAGGTACACGACAAGAGCGAGGTCAAGGGGCAGATT
CCCAAGAGGATATGTCTCCTCAGCAACGACGGAACCAGATGGCGAACGTACTCGATATGA
Gene >Ophun1|4128
ATGGCCCAGGCGAAGCAGCTCGTGCTCTTCAGCGAGACAGAGCTCGATTCCCGAGCTCCTCGCGGCTTCCCCGTT
GGCTGCCCGACGCTGGACGTGGCCTTGACGTGGGACAGCGGCAGCAGTAGCCTTGTCGTCTATAGGCCTCCAGGC
CAAGTGATATCCAAGGTGCACCAGTTAGCCGGTGCCCAAGGAGAAGCGGCACCGGAAGCCGTGGCAGCGACTTGG
AGCCCAGACGGTTCGTTTGGCCGCTAGACGCACGCGTAACGAGATGCCTGACAGCGCAGGCCTTTAGGGCAGTTC
CTGGCCGTGGGCTGGAGCGATGGCATCGTCCGGCTTATAAGACTAGAGAATAACAAGGTCGCCCATCGCATCCCG
GGAACAGGAGCACAAATCACATATATCGGCTGGACAGGCAGCAACATGCCCAAGCCGACGTCTACTTCAGCCAGC
GACTTTCCCACAGGCAACGGCGGGCTTCCTCTCAGCCTCCCTCAGGCGCTGTCCTTTCTCGACGTTGACTCTGCC
TTGCCCAAGATAAGTCCTCTGCCAAGCGGCAGTGCTGGCGCCGAGTAAGCTCCCAGATTGAGCGTTCAATTCACT
GGTAGGAACGCTGACCTGACCCATGATCCCAGTGAGGATGCCAACGTCTTTACTCTACGAGCCAGCGTCGACTTC
CTCTTCCAGCCCCTAAAGCAAGAGGACCACGATTCCGTCAACGTCATGGTGGTGGGAACCAGCGACGGCAAGGTG
CAGCTGAGCATCTACGATTCCTTCGTCATCGGGACGTTTCAGTGCCCGACAGCAGGCAACAAAAACGTGTCCAAG
CTAGTTCAACATGCATCGCATCCCGACGTCTCGACCCACGCGCTCATCTTGGCAGATGACTTGTCGGAGACGGGC
GAGGTCCAAGTGCTGCCCCTGGACCTACCCTTCGTCTCATCTTCGCGCATCAACTTGTCCCTCCTCGCGTCCAAG
TTGACTACGCTGCAGAAGCTTCTGAGGTATATGAAGCAGACGCAGCTGCATATGCAGGTCGAATGGCGGAACGCG
AGGGAGTTGCCGGCTCGCTTCCTCAGAGGCATTCAGGCCGACCTTGCGGACATGCAAAGCGGACCGCGCGGCATC
GTTCCGGCCTTGTATCATGTGGTGGTAACGGGCCATGCCTACGAACCGGTCCGCGAATGGCTCGTAGATACTATC
GCAGACAGGGTTGGTCGGATCTGATGCTATCAGACGTGTCCTCCTTGGCTAACACTTGGTGACTCCAGGGCCACA
AACGCTGGGAAAAAGCCGTTGTTTCCGGTCTGGAGAATCTACGCAGCCTCGTCCACGAAAACTTTCTCCCGGCCC
TCGAGCGCTGCGTTCTCATTCTCAGCCGGCTTCGAGGGCTCGCCCAGTTTCACGACGACCGCGATGACATTGGCT
TCTCTGTTTCCCAGGTCAGCCGCGCCTTGGACATCATCGGCTGTCTGCACCTCGTTGGCCACAAGATCCTCGTCC
ACGTCATGGACGAGCTGGAGCACTTTGCAGCCTTTTCCGTCTGGTTGCGTTTCCAGATCGACGGCTTGACCGGCG
GAGCGAGCCAAGAACTCACAGAGAAAGAGGCCACGATGGACACTTTCAGAGTCCTCGCGTACATCGAGACTTACC
TCGCTTCGAGCCCGCTCGACATGTTCTTCGACGACATCTCGACTAAGGACTTTGCGGCCGACTGGGATCATTGCG
AGGACGGACCGAGCCTGCTGGAGATGCTGGACACGCAGCTCAAGAAGCGGGAAGATGGGCAGTCGAGCATGAGAG
CGCTACCCCACGTGGACTTTCTCGTCAACTACATGACGACGTGGTGCGATAGGATCTTCAAGAGCGTCGCCGAAT
CCATGGAAAGGAGTGTACGTTTTGGAACGCCCATCAAGCTCCCGGTTGGAGCCTCGTTCAGCAAGATGGATGTGA
AAGTTGGCAAGGCTGCAAAGGTATGACGTTGGCTGGCCCTGTTCTTTGGTCGATGTCCTGACGCGTTCCACGGTA
CAGGGAGGCGCCATCTACACCGCCGTGGCGTGCAGAAACAGCGAGAGCAAAGGTACGAGGTTCATCGTCTGGCAA
GCAACAAGTCATGTTGACGTTTGAGGGCAAGTGTACATCTTGCGCACTGAAATGGACATTGCCAGCGGCATCAGC
TTCAATCTGCCGGCGACGGGCTGCTGCGTCGACCTGGCCAACCGCCAGCTCATTGACGCCAAATTCCTCAACGAC
GAAACACTCATCGTGCTTTGCAAGGAAAACGGTACATGATGATTCTGGCTGGTTCCATATGCTTCATCACTAATC
TCGATCCAGACCTATCTTCGATCGCGATATCCATACCGGTCCAGTCAAGTGAACTGCCATATGCCACGTTGGGCT
CCGGGGGGCTCGAAAGCGTCAACATCATCCCAGCACATGGCTTCGTCAAACATGTGCTACCCGGACAGCAAGCGG
CGAGGATGGAGGTACACGACAAGAGCGAGGTCAAGGGGCAGATTCCCAAGAGGATATGTCTCCTCAGCAACGACG
GAACCAGATGGCGAACGTACTCGATATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail