Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4115
Gene name
LocationContig_377:16821..17813
Strand-
Gene length (bp)992
Transcript length (bp)882
Coding sequence length (bp)882
Protein length (aa) 294

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20238 DUF6595 Family of unknown function (DUF6595) 1.3E-30 44 188

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 22 0.999546

Transmembrane Domains

Domain # Start End Length
1 237 259 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup337
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|1921
Ophiocordyceps camponoti-floridani Ophcf2|03744
Ophiocordyceps camponoti-floridani Ophcf2|05312
Ophiocordyceps camponoti-rufipedis Ophun1|4115 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5809
Ophiocordyceps kimflemingae Ophio5|388
Ophiocordyceps kimflemingae Ophio5|8115
Ophiocordyceps subramaniannii Hirsu2|409
Ophiocordyceps subramaniannii Hirsu2|6076

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4115
MRYTLENMLAVGLALLVTSSSAGHGDTTKSANNPSTASTTSDTMGPAKIMWPRPRKWTADLDNTAPCGSMLDIPE
RTKFPLKGGKVSLVGQDDHYNVQIGISYSQRPTSNSDFEMLKIDKKIDDLDPGHTCVPLPDAFNDVKAGTNATFQ
MIYESNWDKPHNQTFYVCSDITFAEVIEVKAMEALCFDANEPGEDNINPPWIKQVEKTPIGKGPSGSHAGADASV
TTSKSKLGGGAIAGITIGALSGAVVVAAIALFVYRRGQQKKRKENIARMENAREQQGPMEKYAGHSNA*
Coding >Ophun1|4115
ATGCGCTACACGCTGGAAAACATGCTGGCCGTCGGCCTGGCCCTTCTGGTCACGTCGTCATCCGCTGGCCACGGT
GACACGACCAAGTCGGCCAACAACCCGTCGACGGCGTCTACTACCAGTGATACCATGGGTCCTGCTAAAATCATG
TGGCCGAGACCGCGGAAGTGGACGGCCGATCTGGATAACACGGCGCCTTGCGGCTCGATGCTTGATATCCCCGAA
CGAACCAAGTTCCCTCTCAAGGGTGGGAAGGTCTCGCTGGTGGGCCAGGACGACCATTATAACGTCCAGATCGGC
ATCTCGTACAGCCAGCGCCCTACCTCGAACAGCGATTTCGAGATGCTCAAAATCGACAAGAAGATCGACGACCTC
GACCCGGGCCACACCTGCGTCCCGCTGCCCGACGCCTTCAACGATGTCAAGGCCGGCACAAATGCAACCTTCCAG
ATGATCTACGAGAGCAACTGGGACAAGCCCCATAACCAAACCTTTTACGTCTGCTCCGACATCACCTTCGCCGAG
GTGATCGAGGTCAAGGCCATGGAGGCACTGTGCTTCGACGCCAACGAACCAGGCGAGGATAACATCAACCCCCCC
TGGATCAAGCAGGTAGAGAAGACGCCCATCGGTAAGGGTCCCAGTGGCAGCCATGCCGGAGCCGACGCGTCTGTC
ACCACCAGCAAGAGCAAGCTGGGCGGCGGTGCCATCGCGGGCATCACCATCGGTGCTCTGTCCGGGGCCGTTGTC
GTGGCTGCCATTGCCTTGTTCGTGTACCGTCGTGGCCAGCAGAAGAAGCGTAAGGAGAACATTGCTCGGATGGAG
AATGCGCGGGAACAGCAGGGGCCTATGGAGAAGTATGCCGGTCACAGCAATGCGTAG
Transcript >Ophun1|4115
ATGCGCTACACGCTGGAAAACATGCTGGCCGTCGGCCTGGCCCTTCTGGTCACGTCGTCATCCGCTGGCCACGGT
GACACGACCAAGTCGGCCAACAACCCGTCGACGGCGTCTACTACCAGTGATACCATGGGTCCTGCTAAAATCATG
TGGCCGAGACCGCGGAAGTGGACGGCCGATCTGGATAACACGGCGCCTTGCGGCTCGATGCTTGATATCCCCGAA
CGAACCAAGTTCCCTCTCAAGGGTGGGAAGGTCTCGCTGGTGGGCCAGGACGACCATTATAACGTCCAGATCGGC
ATCTCGTACAGCCAGCGCCCTACCTCGAACAGCGATTTCGAGATGCTCAAAATCGACAAGAAGATCGACGACCTC
GACCCGGGCCACACCTGCGTCCCGCTGCCCGACGCCTTCAACGATGTCAAGGCCGGCACAAATGCAACCTTCCAG
ATGATCTACGAGAGCAACTGGGACAAGCCCCATAACCAAACCTTTTACGTCTGCTCCGACATCACCTTCGCCGAG
GTGATCGAGGTCAAGGCCATGGAGGCACTGTGCTTCGACGCCAACGAACCAGGCGAGGATAACATCAACCCCCCC
TGGATCAAGCAGGTAGAGAAGACGCCCATCGGTAAGGGTCCCAGTGGCAGCCATGCCGGAGCCGACGCGTCTGTC
ACCACCAGCAAGAGCAAGCTGGGCGGCGGTGCCATCGCGGGCATCACCATCGGTGCTCTGTCCGGGGCCGTTGTC
GTGGCTGCCATTGCCTTGTTCGTGTACCGTCGTGGCCAGCAGAAGAAGCGTAAGGAGAACATTGCTCGGATGGAG
AATGCGCGGGAACAGCAGGGGCCTATGGAGAAGTATGCCGGTCACAGCAATGCGTAG
Gene >Ophun1|4115
ATGCGCTACACGCTGGAAAACATGCTGGCCGTCGGCCTGGCCCTTCTGGTCACGTCGTCATCCGCTGGCCACGGT
GACACGACCAAGTCGGCCAACAACCCGTCGACGGCGTCTACTACCAGTGATACCATGGGTCCTGCTAAAATCATG
TGGCCGAGACCGCGGAAGTGGACGGCCGATCTGGATAACACGGCGCCTTGCGGCTCGATGCTTGATATCCCCGAA
CGAACCAAGTTCCCTCTCAGTGAGTTGACTGTCAATGGCCTGTCAACAGAGGCGTTGCTGACGTTGGGTAGAGGG
TGGGAAGGTCTCGCTGGTGGGCCAGGACGACCATTATAACGTCCAGATCGGCATCTCGTACAGCCAGCGTACGTT
TCTATCCATCTAACATAACACACCAGCATCCCTTCCACTAACACGACCAAGGCCCTACCTCGAACAGCGATTTCG
AGATGCTCAAAATCGACAAGAAGATCGACGACCTCGACCCGGGCCACACCTGCGTCCCGCTGCCCGACGCCTTCA
ACGATGTCAAGGCCGGCACAAATGCAACCTTCCAGATGATCTACGAGAGCAACTGGGACAAGCCCCATAACCAAA
CCTTTTACGTCTGCTCCGACATCACCTTCGCCGAGGTGATCGAGGTCAAGGCCATGGAGGCACTGTGCTTCGACG
CCAACGAACCAGGCGAGGATAACATCAACCCCCCCTGGATCAAGCAGGTAGAGAAGACGCCCATCGGTAAGGGTC
CCAGTGGCAGCCATGCCGGAGCCGACGCGTCTGTCACCACCAGCAAGAGCAAGCTGGGCGGCGGTGCCATCGCGG
GCATCACCATCGGTGCTCTGTCCGGGGCCGTTGTCGTGGCTGCCATTGCCTTGTTCGTGTACCGTCGTGGCCAGC
AGAAGAAGCGTAAGGAGAACATTGCTCGGATGGAGAATGCGCGGGAACAGCAGGGGCCTATGGAGAAGTATGCCG
GTCACAGCAATGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail