Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4113
Gene name
LocationContig_377:11317..14768
Strand+
Gene length (bp)3451
Transcript length (bp)2898
Coding sequence length (bp)2898
Protein length (aa) 966

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09779 Ima1_N Ima1 N-terminal domain 6.4E-26 2 105

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O13681|IINMP_SCHPO Integral inner nuclear membrane protein ima1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=IMA1 PE=4 SV=2 2 281 1.0E-22

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

Domain # Start End Length
1 141 163 22
2 205 227 22
3 269 291 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4113
MCRFCEATNYLDEKGEITDPPVATDGDVAPTTTQFAAPKRSVPTDSIFCASCLKNQYLLTTSLAQYLPDDPSDPD
YAPLERNYHRYRRGLEKRYPQVCDSCADRVEARLRQAGYAAKTDHLRRMMELSRGRRRQKASSRGFVDWVAGLGA
AVWRAGFAMQVVGHLVAVAPLLKDRGDGLRDPAEGVSVLARLGGLAEGLPLPGCFAGWGVVAAVAAVWWNPYLVQ
LVRGFTRHLSGFSQWYSFQGLVVVFRLVCWRLVGGIEGQTRQASISIHVAMAAVTILIYLVMGRLIRVDSSPLFG
IGASPGTKEPAVTPVRNREEASKTLSDMLIDALETTTQKQGQRPLPDVSPSPQTGFSPSSIPPQRQSYENHHNIV
TPSRLPQQVQYDEEMDWSPVTPRHRALAPVQETPSRGMDTLEKSPFWYKVPAAPVTPARQLRNPPRAPTAKPTAT
EVHQGFNFSPAATRQRGNGVRSTGVEFRQQQFFAPERDDANSLADLLGQSFSLSQEGGDDDDDDDDDDDDGEVKG
AEMNKGVATQRTNRKPTRTRRGVSTWHRRLEPVAAIMLPVLWTLTLSSTLPFQTECQTAMMALSGLLSLLTAGDD
RRNKLSAAWATAELAASCWVLSALWTDEGRRAWWCGAGVLASGALRRLGMERWVHMPHADNLPEPTIAGLVLRVN
DGPLKPSEAAPLRTSHPSEPISTLRERYGTDGYVFLKGLLPRADVLAAREAYFRSVAPSGVLKAGTQPVEGIFDG
DASAADFPGIGAGSVANSRPGDTAKAAVFVDLALAAHTAAWYAGSEDEVGFARHAKLREFVAAFSGWGERTLAVR
RSLLRNNTPGNGAIGVHYDQTFMRHGDVLGQELEADFNTKAKEAGMSDEEMRSAFNAHMMSSGFLSDGPAAFARG
CGRRWLVSAYEAGDVVLHRPHMIHASTINEDPEGRIRLGTDLRFVDTGRPWDERWNHHFRFDDGV*
Coding >Ophun1|4113
ATGTGTCGGTTCTGCGAGGCGACCAACTACCTGGACGAGAAGGGCGAAATCACGGATCCTCCTGTCGCGACTGAC
GGTGATGTCGCGCCGACGACGACGCAGTTTGCTGCTCCGAAGCGATCCGTTCCCACAGACAGCATCTTCTGCGCG
TCCTGTCTCAAGAACCAGTACCTCCTTACGACGTCGCTGGCCCAGTACCTCCCCGACGATCCCTCCGACCCAGAC
TACGCGCCGCTGGAGCGCAACTATCACCGCTATCGTCGCGGCCTGGAGAAGCGCTACCCGCAGGTATGCGACTCG
TGCGCCGACCGGGTCGAAGCCCGGCTCCGACAGGCGGGCTATGCGGCCAAGACGGATCACCTCCGGCGCATGATG
GAGCTGAGCCGCGGGAGGAGAAGACAGAAGGCTTCGTCCAGGGGGTTTGTCGACTGGGTTGCTGGCCTGGGTGCT
GCTGTGTGGCGGGCGGGATTCGCGATGCAGGTGGTTGGTCACCTCGTTGCTGTTGCGCCGCTGCTGAAGGACCGA
GGCGATGGGCTGCGAGATCCGGCTGAGGGGGTTTCGGTCCTGGCTCGGCTTGGGGGTCTGGCTGAAGGGCTTCCT
TTGCCGGGTTGCTTTGCTGGCTGGGGTGTTGTGGCGGCGGTTGCGGCGGTGTGGTGGAATCCTTACCTTGTGCAG
CTGGTCCGAGGCTTTACGAGGCATCTCTCGGGGTTCTCGCAGTGGTATTCGTTTCAGGGGCTGGTTGTTGTCTTC
CGGCTTGTCTGCTGGAGGCTTGTTGGTGGGATCGAGGGCCAGACGCGTCAGGCGAGCATCAGCATTCACGTGGCC
ATGGCGGCTGTCACGATACTGATATACCTCGTCATGGGCAGGTTGATTCGCGTCGACTCATCGCCTCTTTTCGGC
ATCGGAGCGAGTCCTGGGACCAAAGAGCCGGCTGTTACTCCGGTGCGGAACAGGGAAGAAGCGAGCAAGACGCTG
TCTGATATGCTCATCGACGCTCTCGAGACGACGACACAGAAACAGGGGCAACGCCCTTTGCCTGACGTCTCTCCC
AGTCCTCAGACGGGCTTCTCGCCCAGTTCAATCCCTCCACAGAGACAGTCTTACGAAAATCACCATAACATCGTC
ACGCCTAGCCGTCTGCCGCAGCAGGTTCAGTACGACGAGGAGATGGACTGGTCCCCCGTGACGCCTCGGCATCGC
GCTCTGGCTCCCGTACAAGAGACGCCAAGCCGGGGCATGGACACGCTCGAAAAGAGCCCCTTTTGGTACAAGGTT
CCCGCAGCGCCGGTGACGCCCGCACGACAGCTACGAAACCCGCCGCGGGCACCTACAGCGAAGCCGACGGCCACG
GAAGTCCATCAGGGCTTCAACTTCTCGCCAGCTGCGACGCGTCAAAGGGGAAACGGGGTGAGGAGCACTGGTGTC
GAGTTTCGGCAGCAGCAGTTTTTCGCGCCGGAGCGGGATGATGCGAATTCGCTGGCTGACTTGCTGGGGCAGAGC
TTTAGTTTGAGCCAGGAGGGGGGTGACGATGATGATGACGACGACGACGACGATGATGATGGCGAGGTCAAGGGG
GCGGAGATGAACAAGGGGGTTGCGACGCAAAGGACGAACCGGAAGCCTACGAGGACTCGTCGAGGCGTCAGCACA
TGGCATCGCCGTCTCGAGCCTGTTGCGGCTATAATGCTACCCGTCCTATGGACACTGACACTCTCCTCAACACTA
CCCTTCCAAACCGAGTGCCAGACGGCGATGATGGCCCTCTCCGGCCTCTTATCCCTCCTGACGGCCGGCGACGAC
CGCCGCAACAAGCTCAGTGCAGCCTGGGCCACGGCCGAGCTGGCAGCCTCGTGCTGGGTCTTATCCGCCCTGTGG
ACGGACGAGGGGCGGCGGGCGTGGTGGTGCGGCGCGGGAGTGTTGGCTTCGGGGGCGCTGAGGCGGCTCGGCATG
GAACGCTGGGTGCATATGCCTCACGCAGACAACCTCCCAGAGCCTACTATAGCAGGCCTCGTCCTCCGCGTCAAC
GACGGCCCCCTCAAGCCCTCAGAAGCAGCCCCCCTCCGCACCTCGCACCCGTCAGAGCCAATATCGACACTCCGA
GAACGCTACGGAACAGACGGCTACGTCTTCCTCAAAGGCCTCCTCCCACGAGCCGACGTCCTCGCCGCCCGAGAA
GCCTACTTCCGCTCCGTGGCCCCCAGCGGCGTCCTCAAAGCCGGAACGCAACCCGTCGAGGGCATCTTCGACGGC
GACGCCTCGGCCGCCGACTTCCCCGGCATTGGAGCCGGTAGCGTTGCCAACTCCAGGCCTGGGGATACGGCCAAG
GCGGCTGTTTTCGTGGATCTGGCTCTGGCGGCTCATACGGCGGCTTGGTATGCTGGCTCCGAGGACGAGGTTGGG
TTCGCGCGTCATGCCAAGTTGAGGGAGTTTGTTGCTGCTTTTTCGGGCTGGGGGGAGAGGACTTTGGCGGTTAGG
CGGTCGCTTTTGAGGAATAATACGCCTGGGAATGGAGCTATTGGCGTGCATTACGATCAGACCTTTATGCGCCAT
GGAGATGTTCTTGGCCAGGAGTTGGAAGCCGACTTCAACACCAAGGCCAAGGAGGCGGGCATGAGCGACGAGGAG
ATGCGCAGCGCCTTCAACGCCCACATGATGAGCTCTGGCTTCCTGAGTGATGGACCGGCGGCGTTTGCGAGGGGG
TGTGGGAGGCGGTGGCTTGTTTCTGCGTATGAGGCTGGGGATGTGGTGCTTCATCGACCGCACATGATTCACGCG
TCGACGATTAATGAGGATCCGGAGGGGAGGATTCGGCTAGGGACGGATTTGAGGTTTGTGGACACGGGGAGGCCG
TGGGATGAGCGGTGGAATCATCACTTTCGGTTTGATGATGGGGTTTGA
Transcript >Ophun1|4113
ATGTGTCGGTTCTGCGAGGCGACCAACTACCTGGACGAGAAGGGCGAAATCACGGATCCTCCTGTCGCGACTGAC
GGTGATGTCGCGCCGACGACGACGCAGTTTGCTGCTCCGAAGCGATCCGTTCCCACAGACAGCATCTTCTGCGCG
TCCTGTCTCAAGAACCAGTACCTCCTTACGACGTCGCTGGCCCAGTACCTCCCCGACGATCCCTCCGACCCAGAC
TACGCGCCGCTGGAGCGCAACTATCACCGCTATCGTCGCGGCCTGGAGAAGCGCTACCCGCAGGTATGCGACTCG
TGCGCCGACCGGGTCGAAGCCCGGCTCCGACAGGCGGGCTATGCGGCCAAGACGGATCACCTCCGGCGCATGATG
GAGCTGAGCCGCGGGAGGAGAAGACAGAAGGCTTCGTCCAGGGGGTTTGTCGACTGGGTTGCTGGCCTGGGTGCT
GCTGTGTGGCGGGCGGGATTCGCGATGCAGGTGGTTGGTCACCTCGTTGCTGTTGCGCCGCTGCTGAAGGACCGA
GGCGATGGGCTGCGAGATCCGGCTGAGGGGGTTTCGGTCCTGGCTCGGCTTGGGGGTCTGGCTGAAGGGCTTCCT
TTGCCGGGTTGCTTTGCTGGCTGGGGTGTTGTGGCGGCGGTTGCGGCGGTGTGGTGGAATCCTTACCTTGTGCAG
CTGGTCCGAGGCTTTACGAGGCATCTCTCGGGGTTCTCGCAGTGGTATTCGTTTCAGGGGCTGGTTGTTGTCTTC
CGGCTTGTCTGCTGGAGGCTTGTTGGTGGGATCGAGGGCCAGACGCGTCAGGCGAGCATCAGCATTCACGTGGCC
ATGGCGGCTGTCACGATACTGATATACCTCGTCATGGGCAGGTTGATTCGCGTCGACTCATCGCCTCTTTTCGGC
ATCGGAGCGAGTCCTGGGACCAAAGAGCCGGCTGTTACTCCGGTGCGGAACAGGGAAGAAGCGAGCAAGACGCTG
TCTGATATGCTCATCGACGCTCTCGAGACGACGACACAGAAACAGGGGCAACGCCCTTTGCCTGACGTCTCTCCC
AGTCCTCAGACGGGCTTCTCGCCCAGTTCAATCCCTCCACAGAGACAGTCTTACGAAAATCACCATAACATCGTC
ACGCCTAGCCGTCTGCCGCAGCAGGTTCAGTACGACGAGGAGATGGACTGGTCCCCCGTGACGCCTCGGCATCGC
GCTCTGGCTCCCGTACAAGAGACGCCAAGCCGGGGCATGGACACGCTCGAAAAGAGCCCCTTTTGGTACAAGGTT
CCCGCAGCGCCGGTGACGCCCGCACGACAGCTACGAAACCCGCCGCGGGCACCTACAGCGAAGCCGACGGCCACG
GAAGTCCATCAGGGCTTCAACTTCTCGCCAGCTGCGACGCGTCAAAGGGGAAACGGGGTGAGGAGCACTGGTGTC
GAGTTTCGGCAGCAGCAGTTTTTCGCGCCGGAGCGGGATGATGCGAATTCGCTGGCTGACTTGCTGGGGCAGAGC
TTTAGTTTGAGCCAGGAGGGGGGTGACGATGATGATGACGACGACGACGACGATGATGATGGCGAGGTCAAGGGG
GCGGAGATGAACAAGGGGGTTGCGACGCAAAGGACGAACCGGAAGCCTACGAGGACTCGTCGAGGCGTCAGCACA
TGGCATCGCCGTCTCGAGCCTGTTGCGGCTATAATGCTACCCGTCCTATGGACACTGACACTCTCCTCAACACTA
CCCTTCCAAACCGAGTGCCAGACGGCGATGATGGCCCTCTCCGGCCTCTTATCCCTCCTGACGGCCGGCGACGAC
CGCCGCAACAAGCTCAGTGCAGCCTGGGCCACGGCCGAGCTGGCAGCCTCGTGCTGGGTCTTATCCGCCCTGTGG
ACGGACGAGGGGCGGCGGGCGTGGTGGTGCGGCGCGGGAGTGTTGGCTTCGGGGGCGCTGAGGCGGCTCGGCATG
GAACGCTGGGTGCATATGCCTCACGCAGACAACCTCCCAGAGCCTACTATAGCAGGCCTCGTCCTCCGCGTCAAC
GACGGCCCCCTCAAGCCCTCAGAAGCAGCCCCCCTCCGCACCTCGCACCCGTCAGAGCCAATATCGACACTCCGA
GAACGCTACGGAACAGACGGCTACGTCTTCCTCAAAGGCCTCCTCCCACGAGCCGACGTCCTCGCCGCCCGAGAA
GCCTACTTCCGCTCCGTGGCCCCCAGCGGCGTCCTCAAAGCCGGAACGCAACCCGTCGAGGGCATCTTCGACGGC
GACGCCTCGGCCGCCGACTTCCCCGGCATTGGAGCCGGTAGCGTTGCCAACTCCAGGCCTGGGGATACGGCCAAG
GCGGCTGTTTTCGTGGATCTGGCTCTGGCGGCTCATACGGCGGCTTGGTATGCTGGCTCCGAGGACGAGGTTGGG
TTCGCGCGTCATGCCAAGTTGAGGGAGTTTGTTGCTGCTTTTTCGGGCTGGGGGGAGAGGACTTTGGCGGTTAGG
CGGTCGCTTTTGAGGAATAATACGCCTGGGAATGGAGCTATTGGCGTGCATTACGATCAGACCTTTATGCGCCAT
GGAGATGTTCTTGGCCAGGAGTTGGAAGCCGACTTCAACACCAAGGCCAAGGAGGCGGGCATGAGCGACGAGGAG
ATGCGCAGCGCCTTCAACGCCCACATGATGAGCTCTGGCTTCCTGAGTGATGGACCGGCGGCGTTTGCGAGGGGG
TGTGGGAGGCGGTGGCTTGTTTCTGCGTATGAGGCTGGGGATGTGGTGCTTCATCGACCGCACATGATTCACGCG
TCGACGATTAATGAGGATCCGGAGGGGAGGATTCGGCTAGGGACGGATTTGAGGTTTGTGGACACGGGGAGGCCG
TGGGATGAGCGGTGGAATCATCACTTTCGGTTTGATGATGGGGTTTGA
Gene >Ophun1|4113
ATGTGTCGGTTCTGCGAGGCGACCAACTACCTGGACGAGGTGCGTCTTTTCTTCCTCGCGATTCTTTCCGTGGAT
GCTGACTTGGGGGTGGTAGAAGGGCGAAATCACGGATCCTCCTGTCGCGACTGACGGTGATGTCGCGCCGACGAC
GACGCAGTTTGCTGCTCCGAAGCGATCCGTTCCCACAGACAGCATCTTCTGCGCGTCCTGTCTCAAGAACCAGTA
CCTCCTTACGACGTCGCTGGCCCAGTACCTCCCCGACGATCCCTCCGACCCAGACTACGCGCCGCTGGAGCGCAA
CTATCACCGCTATCGTCGCGGCCTGGAGAAGCGCTACCCGCAGGTATGCGACTCGTGCGCCGACCGGGTCGAAGC
CCGGCTCCGACAGGCGGGCTATGCGGCCAAGACGGATCACCTCCGGCGCATGATGGAGCTGAGCCGCGGGAGGAG
AAGACAGAAGGCTTCGTCCAGGGGGTTTGTCGACTGGGTTGCTGGCCTGGGTGCTGCTGTGTGGCGGGCGGGATT
CGCGATGCAGGTGGTTGGTCACCTCGTTGCTGTTGCGCCGCTGCTGAAGGACCGAGGCGATGGGCTGCGAGATCC
GGCTGAGGGGGTTTCGGTCCTGGCTCGGCTTGGGGGTCTGGCTGAAGGGCTTCCTTTGCCGGGTTGCTTTGCTGG
CTGGGGTGTTGTGGCGGCGGTTGCGGCGGTGTGGTGGAATCCTTACCTTGTGCAGCTGGTCCGAGGCTTTACGAG
GCATCTCTCGGGGTTCTCGCAGTGGTATTCGTTTCAGGGGCTGGTTGTTGTCTTCCGGCTTGTCTGCTGGAGGCT
TGTTGGTGGGATCGAGGGCCAGACGCGTCAGGCGAGCATCAGCATTCACGTGGCCATGGCGGCTGTCACGATACT
GGTAAGTTTGGGGGGAGAGACGATTGCGGTCGTGGGATTTACTGAGAGATGGGCAGATATACCTCGTCATGGGCA
GGTTGATTCGCGTCGACTCATCGCCTCTTTTCGGCATCGGAGCGAGTCCTGGGACCAAAGAGCCGGCTGTTACTC
CGGTGCGGAACAGGGAAGAAGCGAGCAAGACGCTGTCTGATATGCTCATCGACGCTCTCGAGACGACGACACAGA
AACAGGGGCAACGCCCTTTGCCTGACGTCTCTCCCAGTCCTCAGACGGGCTTCTCGCCCAGTTCAATCCCTCCAC
AGAGACAGTCTTACGAAAATCACCATAACATCGTCACGCCTAGCCGTCTGCCGCAGCAGGTTCAGTACGACGAGG
AGATGGACTGGTCCCCCGTGACGCCTCGGCATCGCGCTCTGGCTCCCGTACAAGAGACGCCAAGCCGGGGCATGG
ACACGCTCGAAAAGAGCCCCTTTTGGTACAAGGTTCCCGCAGCGCCGGTGACGCCCGCACGACAGCTACGAAACC
CGCCGCGGGCACCTACAGCGAAGCCGACGGCCACGGAAGTCCATCAGGGCTTCAACTTCTCGCCAGCTGCGACGC
GTCAAAGGGGAAACGGGGTGAGGAGCACTGGTGTCGAGTTTCGGCAGCAGCAGTTTTTCGCGCCGGAGCGGGATG
ATGCGAATTCGCTGGCTGACTTGCTGGGGCAGAGCTTTAGTTTGAGCCAGGAGGGGGGTGACGATGATGATGACG
ACGACGACGACGATGATGATGGCGAGGTCAAGGGGGCGGAGATGAACAAGGGGGTTGCGACGCAAAGGACGAACC
GGAAGCCTACGAGGACTCGTCGAGGCGTCAGCACATGGCATCGCCGTCTCGAGCCTGTTGCGGCTATAATGCTAC
CCGTCCTATGGACACTGACACTCTCCTCAACACTACCCTTCCAAACCGAGTGCCAGACGGCGATGATGGCCCTCT
CCGGCCTCTTATCCCTCCTGACGGCCGGCGACGACCGCCGCAACAAGCTCAGTGCAGCCTGGGCCACGGCCGAGC
TGGCAGCCTCGTGCTGGGTCTTATCCGCCCTGTGGACGGACGAGGGGCGGCGGGCGTGGTGGTGCGGCGCGGGAG
TGTTGGCTTCGGGGGCGCTGAGGCGGCTCGGCATGGAACGCTGGGTGCATGTACGAGGATGAGTTGTGAGCCGTG
TTGATGGCGGTTTGGTATTTAAAGGGTGTGCTTTGGTTAGGAGTTTGGGTTTTGATATCGACTGCTCGTTGCTGA
TATCATTGAGTTTGTCGTGTTTAGGGTTGGCTACGAAGACTCTTCATCTCTCACCTTTTGTCTTGTTTGTGTCTC
AAGTCTCGACTGTCAAGATGCCTCACGCAGACAACCTCCCAGAGCCTACTATAGCAGGCCTCGTCCTCCGCGTCA
ACGACGGCCCCCTCAAGCCCTCAGAAGCAGCCCCCCTCCGCACCTCGCACCCGTCAGAGCCAATATCGACACTCC
GAGAACGCTACGGAACAGACGGCTACGTCTTCCTCAAAGGCCTCCTCCCACGAGCCGACGTCCTCGCCGCCCGAG
AAGCCTACTTCCGCTCCGTGGCCCCCAGCGGCGTCCTCAAAGCCGGAACGCAACCCGTCGAGGGCATCTTCGACG
GCGACGCCTCGGCCGCCGACTTCCCCGGCATTGGAGCCGGTAGCGTTGCCAACTCCAGGCCTGGGGATACGGCCA
AGGCGGCTGTTTTCGTGGATCTGGCTCTGGCGGCTCATACGGCGGCTTGGTATGCTGGCTCCGAGGACGAGGTTG
GGTTCGCGCGTCATGCCAAGTTGAGGGAGTTTGTTGCTGCTTTTTCGGGCTGGGGGGAGAGGACTTTGGCGGTTA
GGCGGTCGCTTTTGAGGAATAATACGCCTGGGAATGGAGCTATTGGCGTGCATTACGATCAGACCTTTATGCGCC
ATGGTGAGCCGACGGCTGTGACGGCTTGGGTTCCCATGGGAGACATTCGGCTTGAGGGAGGGGGGCTGATCTATC
TTGAAGGCGGTGGGTGTCTTGAACAAGGGGTTGAAGAGTTGAGGCTGACGCTTCATCAATAGGAGATGTTCTTGG
CCAGGAGTTGGAAGCCGACTTCAACACCAAGGCCAAGGAGGCGGGCATGAGCGACGAGGAGATGCGCAGCGCCTT
CAACGCCCACATGATGAGCTCTGGCTTCCTGAGTGATGGACCGGCGGCGTTTGCGAGGGGGTGTGGGAGGCGGTG
GCTTGTTTCTGCGTATGAGGCTGGGGATGTGGTGCTTCATCGACCGCACATGGTGAGTTGAGGGCTGGTGATGAG
CATGTTGTTTCGATACCAATGCTGAGGGCGGGCAGATTCACGCGTCGACGATTAATGAGGATCCGGAGGGGAGGA
TTCGGCTAGGGACGGATTTGAGGTTTGTGGACACGGGGAGGCCGTGGGATGAGGTGAGTTTGGTGGTGTTGCTTT
TGGGGAGTTGAATATTGGAGTGTGCTGACGGTTATAGCGGTGGAATCATCACTTTCGGTTTGATGATGGGGTTTG
A

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail