Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4111
Gene name
LocationContig_377:6315..9647
Strand+
Gene length (bp)3332
Transcript length (bp)3276
Coding sequence length (bp)3276
Protein length (aa) 1092

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13234 rRNA_proc-arch rRNA-processing arch domain 2.9E-92 611 888
PF08148 DSHCT DSHCT (NUC185) domain 8.7E-48 916 1085
PF00270 DEAD DEAD/DEAH box helicase 4.9E-17 160 306
PF00271 Helicase_C Helicase conserved C-terminal domain 6.6E-06 471 557

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 38 1091 0.0E+00
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 84 1091 0.0E+00
sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1 35 1091 0.0E+00
sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 57 1091 0.0E+00
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 126 1091 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O14232|MTR4_SCHPO ATP-dependent RNA helicase mtr4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mtr4 PE=1 SV=1 38 1091 0.0E+00
sp|P47047|MTR4_YEAST ATP-dependent RNA helicase DOB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTR4 PE=1 SV=1 84 1091 0.0E+00
sp|Q9CZU3|SK2L2_MOUSE Superkiller viralicidic activity 2-like 2 OS=Mus musculus GN=Skiv2l2 PE=1 SV=1 35 1091 0.0E+00
sp|P42285|SK2L2_HUMAN Superkiller viralicidic activity 2-like 2 OS=Homo sapiens GN=SKIV2L2 PE=1 SV=3 57 1091 0.0E+00
sp|O13799|YE02_SCHPO Uncharacterized helicase C17H9.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17H9.02 PE=1 SV=1 126 1091 0.0E+00
sp|Q9XIF2|MTR4_ARATH DExH-box ATP-dependent RNA helicase DExH9 OS=Arabidopsis thaliana GN=MTR4 PE=2 SV=1 126 1091 0.0E+00
sp|Q23223|MTR4_CAEEL mRNA transport homolog 4 OS=Caenorhabditis elegans GN=mtr-4 PE=3 SV=1 121 1091 0.0E+00
sp|Q9ZVW2|HEN2_ARATH DExH-box ATP-dependent RNA helicase DExH10 OS=Arabidopsis thaliana GN=HEN2 PE=1 SV=2 126 1091 0.0E+00
sp|Q15477|SKIV2_HUMAN Helicase SKI2W OS=Homo sapiens GN=SKIV2L PE=1 SV=3 125 1090 0.0E+00
sp|F4JAA5|SKI2_ARATH DExH-box ATP-dependent RNA helicase DExH11 OS=Arabidopsis thaliana GN=SKI2 PE=1 SV=1 133 1091 4.0E-179
sp|O59801|SKI2_SCHPO Putative ATP-dependent RNA helicase C550.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC550.03c PE=3 SV=1 60 1091 8.0E-167
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 150 694 2.0E-136
sp|P9WMR1|HELY_MYCTU Probable helicase HelY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=helY PE=1 SV=1 156 667 1.0E-82
sp|P9WMR0|HELY_MYCTO Probable helicase HelY OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=helY PE=3 SV=1 156 667 1.0E-82
sp|Q9ZBD8|HELY_MYCLE Probable helicase HelY OS=Mycobacterium leprae (strain TN) GN=helY PE=3 SV=1 156 1088 8.0E-82
sp|B9DFG3|ISE2_ARATH DExH-box ATP-dependent RNA helicase DExH15 chloroplastic OS=Arabidopsis thaliana GN=ISE2 PE=1 SV=2 148 603 1.0E-74
sp|Q4JC00|HELS_SULAC ATP-dependent DNA helicase Hel308 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=hel308 PE=3 SV=1 157 573 1.0E-39
sp|Q9HJX7|HELS_THEAC ATP-dependent DNA helicase Hel308 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=hel308 PE=3 SV=1 156 582 3.0E-38
sp|D0KN27|HELS_SULS9 ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain 98/2) GN=hel308 PE=1 SV=1 134 620 7.0E-35
sp|Q97VY9|HELS_SULSO ATP-dependent DNA helicase Hel308 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=hel308 PE=3 SV=1 157 627 7.0E-34
sp|Q9YFQ8|HELS_AERPE ATP-dependent DNA helicase Hel308 OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=hel308 PE=3 SV=2 167 569 7.0E-34
sp|F0NDL2|HELS_SULIR ATP-dependent DNA helicase Hel308 OS=Sulfolobus islandicus (strain REY15A) GN=hel308 PE=3 SV=1 157 666 2.0E-33
sp|P0DMI1|HELS_ARCFU ATP-dependent DNA helicase Hel308 OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=hel308 PE=1 SV=1 157 627 3.0E-33
sp|Q97AI2|HELS_THEVO ATP-dependent DNA helicase Hel308 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=hel308 PE=3 SV=1 156 590 2.0E-32
sp|Q974S1|HELS_SULTO ATP-dependent DNA helicase Hel308 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=hel308 PE=1 SV=1 158 573 2.0E-32
sp|Q12WZ6|HELS_METBU ATP-dependent DNA helicase Hel308 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=hel308 PE=3 SV=1 173 562 3.0E-31
sp|O59025|HELS_PYRHO ATP-dependent DNA helicase Hel308 OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=hel308 PE=3 SV=1 157 590 5.0E-30
sp|Q9V0A9|HELS_PYRAB ATP-dependent DNA helicase Hel308 OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=hel308 PE=3 SV=1 157 590 2.0E-29
sp|Q588V7|TEB_ARATH Helicase and polymerase-containing protein TEBICHI OS=Arabidopsis thaliana GN=TEB PE=2 SV=1 157 562 6.0E-28
sp|A7IB61|HELS_METB6 ATP-dependent DNA helicase Hel308 OS=Methanoregula boonei (strain 6A8) GN=hel308 PE=3 SV=1 167 570 2.0E-27
sp|A8MB76|HELS_CALMQ ATP-dependent DNA helicase Hel308 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=hel308 PE=3 SV=1 167 573 4.0E-27
sp|O26901|HELS_METTH ATP-dependent DNA helicase Hel308 OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=hel308 PE=1 SV=1 157 562 1.0E-26
sp|O73946|HELS_PYRFU ATP-dependent DNA helicase Hel308 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=hel308 PE=1 SV=1 167 590 2.0E-26
sp|Q8TL39|HELS_METAC ATP-dependent DNA helicase Hel308 OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=hel308 PE=3 SV=1 173 567 4.0E-26
sp|Q8PZR7|HELS_METMA ATP-dependent DNA helicase Hel308 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=hel308 PE=3 SV=1 147 567 5.0E-26
sp|P51979|HFM1_YEAST ATP-dependent DNA helicase MER3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HFM1 PE=1 SV=3 147 705 1.0E-25
sp|Q3IU46|HELS_NATPD ATP-dependent DNA helicase Hel308 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=hel308 PE=3 SV=1 173 569 8.0E-25
sp|Q5UYM9|HELS_HALMA ATP-dependent DNA helicase Hel308 OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=hel308 PE=3 SV=1 157 568 1.0E-24
sp|P35207|SKI2_YEAST Antiviral helicase SKI2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKI2 PE=1 SV=2 876 1091 2.0E-24
sp|Q9HMV6|HELS_HALSA ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=hel308 PE=3 SV=1 174 573 2.0E-24
sp|B0R7Q2|HELS_HALS3 ATP-dependent DNA helicase Hel308 OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=hel308 PE=3 SV=1 174 573 2.0E-24
sp|A3MSA1|HELS_PYRCJ ATP-dependent DNA helicase Hel308 OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=hel308 PE=3 SV=1 167 590 2.0E-24
sp|Q0W6L1|HELS_METAR ATP-dependent DNA helicase Hel308 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=hel308 PE=3 SV=1 173 570 2.0E-24
sp|Q8CGS6|DPOLQ_MOUSE DNA polymerase theta OS=Mus musculus GN=Polq PE=1 SV=2 162 604 3.0E-24
sp|Q465R3|HELS_METBF ATP-dependent DNA helicase Hel308 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=hel308 PE=3 SV=1 174 562 4.0E-23
sp|O75417|DPOLQ_HUMAN DNA polymerase theta OS=Homo sapiens GN=POLQ PE=1 SV=2 162 570 1.0E-22
sp|A0FLQ6|DPOLQ_CAEEL DNA polymerase theta OS=Caenorhabditis elegans GN=polq-1 PE=1 SV=2 172 582 5.0E-22
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 157 595 4.0E-21
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 123 570 4.0E-21
sp|A6UN73|HELS_METVS ATP-dependent DNA helicase Hel308 OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=hel308 PE=3 SV=1 169 565 9.0E-21
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 158 595 9.0E-21
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 158 595 1.0E-20
sp|P32639|BRR2_YEAST Pre-mRNA-splicing helicase BRR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRR2 PE=1 SV=2 69 669 1.0E-20
sp|Q9U2G0|U520_CAEEL Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Caenorhabditis elegans GN=Y46G5A.4 PE=3 SV=1 139 595 1.0E-20
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 158 595 2.0E-20
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 123 661 4.0E-20
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 172 570 4.0E-20
sp|Q9FNQ1|DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana GN=At5g61140 PE=2 SV=1 172 595 5.0E-20
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 154 566 5.0E-20
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 172 570 8.0E-20
sp|Q54G57|HELC1_DICDI Activating signal cointegrator 1 complex subunit 3 OS=Dictyostelium discoideum GN=ascc3 PE=3 SV=1 99 570 1.0E-19
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 133 595 3.0E-19
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 172 570 3.0E-19
sp|Q9UT24|BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=brr2 PE=1 SV=1 172 562 5.0E-19
sp|Q58524|HELS_METJA ATP-dependent DNA helicase Hel308 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=hel308 PE=3 SV=1 162 519 7.0E-19
sp|O18475|DPOLQ_DROME DNA polymerase theta OS=Drosophila melanogaster GN=mus308 PE=1 SV=1 174 609 1.0E-18
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 160 595 1.0E-18
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 172 570 2.0E-18
sp|Q9VUV9|U520_DROME Putative U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Drosophila melanogaster GN=l(3)72Ab PE=2 SV=4 130 595 3.0E-18
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 90 570 3.0E-18
sp|O60072|MUG81_SCHPO Putative helicase mug81 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug81 PE=1 SV=1 158 592 5.0E-18
sp|Q9SYP1|DEXHC_ARATH DExH-box ATP-dependent RNA helicase DExH12 OS=Arabidopsis thaliana GN=EMB1507 PE=2 SV=1 107 562 2.0E-17
sp|Q5D892|MER3_ARATH DExH-box ATP-dependent RNA helicase DExH17 OS=Arabidopsis thaliana GN=MER3 PE=2 SV=1 172 568 2.0E-17
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 452 567 3.0E-17
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 137 383 6.0E-17
sp|Q2VPA6|HELQ_MOUSE Helicase POLQ-like OS=Mus musculus GN=Helq PE=1 SV=2 164 571 8.0E-17
sp|Q55CI8|HELCL_DICDI Activating signal cointegrator 1 complex subunit 3-like OS=Dictyostelium discoideum GN=ascc3l PE=3 SV=1 170 637 4.0E-16
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 172 335 4.0E-16
sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=2 430 607 1.0E-15
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 115 562 4.0E-15
sp|A2PYH4|HFM1_HUMAN Probable ATP-dependent DNA helicase HFM1 OS=Homo sapiens GN=HFM1 PE=1 SV=2 172 335 9.0E-15
sp|Q54XN7|Y8827_DICDI Uncharacterized helicase DDB_G0278827 OS=Dictyostelium discoideum GN=DDB_G0278827 PE=3 SV=1 120 338 1.0E-14
sp|F1LNJ2|U520_RAT U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Rattus norvegicus GN=Snrnp200 PE=1 SV=1 158 567 2.0E-14
sp|Q6P4T2|U520_MOUSE U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Mus musculus GN=Snrnp200 PE=1 SV=1 158 567 2.0E-14
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 476 607 2.0E-14
sp|Q5JGV6|HELS_THEKO ATP-dependent DNA helicase Hel308 OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=hel308 PE=3 SV=1 173 529 5.0E-14
sp|O75643|U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 158 567 1.0E-13
sp|Q8TDG4|HELQ_HUMAN Helicase POLQ-like OS=Homo sapiens GN=HELQ PE=1 SV=2 164 571 1.0E-13
sp|F1NTD6|ASCC3_CHICK Activating signal cointegrator 1 complex subunit 3 OS=Gallus gallus GN=ascc3 PE=3 SV=2 95 595 3.0E-13
sp|Q09475|YP93_CAEEL Uncharacterized helicase C28H8.3 OS=Caenorhabditis elegans GN=C28H8.3 PE=3 SV=2 147 314 4.0E-13
sp|Q9P7T8|YIW2_SCHPO Uncharacterized helicase C694.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC694.02 PE=3 SV=1 471 564 2.0E-12
sp|A2RUV5|HFM1_XENTR Probable ATP-dependent DNA helicase HFM1 OS=Xenopus tropicalis GN=hfm1 PE=2 SV=1 172 315 5.0E-12
sp|Q8IY21|DDX60_HUMAN Probable ATP-dependent RNA helicase DDX60 OS=Homo sapiens GN=DDX60 PE=1 SV=3 137 317 6.0E-11
sp|B6DMK2|MER3_ORYSJ ATP-dependent DNA helicase MER3 homolog OS=Oryza sativa subsp. japonica GN=MER3 PE=2 SV=1 167 315 1.0E-10
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 477 570 2.0E-10
sp|Q54XN7|Y8827_DICDI Uncharacterized helicase DDB_G0278827 OS=Dictyostelium discoideum GN=DDB_G0278827 PE=3 SV=1 475 567 1.0E-09
sp|Q58796|Y1401_METJA Probable ATP-dependent helicase MJ1401 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1401 PE=3 SV=1 158 338 3.0E-09
sp|D3Z4R1|HFM1_MOUSE Probable ATP-dependent DNA helicase HFM1 OS=Mus musculus GN=Hfm1 PE=3 SV=2 480 568 1.0E-08
sp|O48534|DEXHD_ARATH DExH-box ATP-dependent RNA helicase DExH13 OS=Arabidopsis thaliana GN=At2g42270 PE=2 SV=1 418 658 3.0E-08
sp|Q5H9U9|DDX6L_HUMAN Probable ATP-dependent RNA helicase DDX60-like OS=Homo sapiens GN=DDX60L PE=2 SV=2 148 317 4.0E-08
sp|E9PZJ8|ASCC3_MOUSE Activating signal cointegrator 1 complex subunit 3 OS=Mus musculus GN=Ascc3 PE=1 SV=1 476 595 1.0E-07
sp|E1BNG3|ASCC3_BOVIN Activating signal cointegrator 1 complex subunit 3 OS=Bos taurus GN=ascc3 PE=3 SV=1 476 595 2.0E-07
sp|F1LPQ2|ASCC3_RAT Activating signal cointegrator 1 complex subunit 3 OS=Rattus norvegicus GN=Ascc3 PE=3 SV=1 476 595 2.0E-07
sp|E7F8F4|ASCC3_DANRE Activating signal cointegrator 1 complex subunit 3 OS=Danio rerio GN=ascc3 PE=3 SV=2 480 592 5.0E-07
sp|Q8N3C0|ASCC3_HUMAN Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens GN=ASCC3 PE=1 SV=3 476 595 5.0E-07
sp|P53327|SLH1_YEAST Antiviral helicase SLH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLH1 PE=1 SV=2 106 347 2.0E-06
sp|Q914M3|Y007_SIFVH Putative helicase 7 OS=Sulfolobus islandicus filamentous virus (isolate Iceland/Hveragerdi) GN=SIFV0007 PE=3 SV=1 155 334 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0097367 carbohydrate derivative binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:0032555 purine ribonucleotide binding No
GO:0005488 binding No
GO:0043167 ion binding No
GO:1901363 heterocyclic compound binding No
GO:0036094 small molecule binding No
GO:0097159 organic cyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0003674 molecular_function No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4687
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|852
Ophiocordyceps australis map64 (Brazil) OphauB2|2894
Ophiocordyceps camponoti-floridani Ophcf2|03749
Ophiocordyceps camponoti-rufipedis Ophun1|4111 (this protein)
Ophiocordyceps kimflemingae Ophio5|382
Ophiocordyceps subramaniannii Hirsu2|9878

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4111
MDEMFDVFEGKAGPQSDSDGERAKSRDKSKKRKADEAINGAAASSSAPRETVDVEMGDATESSNDDDSDEESDTP
SQQDKKRRKKEDGVGPVMTDAFKTEQSREVAAAKTLLPQDASLVLSHNIQHQVALPPDLDYEYVPLSEHKSPDEP
ARTWSFKLDPFQSLSVASIERDESVLVSAHTSAGKTVVAEYAIAQCLKRNQRVIYTSPIKALSNQKFRDFDGIFG
DVGLMTGDVTINPTASCLVMTTEILRSMLYRGSEIMREVAWVVFDEIHYMRDKTRGVVWEETIILLPDKVRYVFL
SATIPNAFQFAEWIAKIHHQACHVVYTDFRPTPLQNYFYPTGGKGARIVVDEKGIFNEKNFNSVMEEVEELKGSA
SADPNARMKGKGKNKKINKGGADPGSPIYKIIKMTIKNNFNPVIVFNFSKRECEDIAKKLSGLDFNDDSEKAMVR
KVFESAIEQLSEQDRELPTLQYILPLLEKGIGVHHSGLLPLLKETIEILFQESLIKVLVATETFSIGLNMPAKTV
VFTQVTKWDGTAVRAITSSEYVQMSGRAGRRGIDARGIVLMMVDDKLEPSVAKQIVTGQQDKLNSAFHLGYNMIL
NLLRIEAISPEYMLEKCFHQFQNAASVPTLEKDLMALQQERDDMSIPDEATIKDYYQIRQQLNTFTRDMRAVIQH
PQYSLDFLQPGRLVQIYNPKQSPDNVGGGVDFGWGVILNHSPRKGPRMGEPQYSAQESYMIEVLLPISASSKEIG
PSQPAGEMPPGLSPATSEQDTIHEVVPCLLSCVKAISQIRIFMPKDGLKAGEDKEQAYKSLTEVKRRFPDGVPIL
DPIENMDIADESFKKLMRKIEVLESRLLANPLHMSPLLPSLWDQYHNKMQIAEKIKEKKKTMAKAHSISQLEELK
SRKRVLRRLGFINDSEVVQLKARVACEISSTEGHELLLSELLFDRFFNELPPDKCAAVLSCFVCEEKLETQALKE
ELQKPFREIQAKARIVAKVAQEAKLDMNPEEYALSFKWQLMETVYRWAQGRSFLEISKMTKMYEGSLIRVFRRLE
ELLRQMAQAAKVMGNDDLVKKFEECLQKVRRDIVAAQSLFL*
Coding >Ophun1|4111
ATGGACGAAATGTTTGACGTGTTCGAGGGCAAGGCGGGCCCGCAGAGCGACAGCGATGGTGAGCGGGCCAAGAGC
CGCGACAAGTCCAAGAAACGAAAGGCGGACGAGGCCATCAACGGCGCCGCCGCCAGCAGCAGTGCGCCCCGGGAA
ACTGTCGATGTCGAGATGGGCGATGCCACCGAGTCTTCCAACGACGACGACTCGGATGAAGAGTCCGACACGCCC
AGCCAGCAGGACAAGAAGCGGCGCAAAAAGGAAGACGGCGTTGGTCCCGTCATGACCGATGCCTTCAAGACGGAG
CAGTCGAGAGAGGTGGCCGCCGCCAAGACGCTTCTCCCTCAGGATGCCTCGCTCGTCCTGTCGCACAATATCCAG
CACCAGGTCGCCCTGCCCCCGGACCTGGACTACGAGTACGTGCCGCTTTCCGAGCACAAGTCGCCCGACGAGCCT
GCCCGCACCTGGAGCTTCAAGCTCGACCCTTTCCAGAGCTTGTCGGTGGCGTCGATTGAGCGCGACGAGAGCGTG
CTGGTCTCGGCGCACACGAGCGCCGGCAAGACGGTCGTGGCCGAATACGCCATCGCGCAGTGCCTCAAACGCAAC
CAGCGCGTCATCTACACCAGTCCCATCAAGGCTCTTAGCAATCAGAAATTTCGCGACTTCGACGGCATCTTCGGC
GACGTCGGCCTCATGACGGGAGACGTCACCATCAACCCCACCGCCAGCTGCCTGGTCATGACGACGGAGATCCTC
CGCTCGATGCTGTACCGTGGCTCGGAGATTATGCGAGAGGTGGCCTGGGTTGTCTTTGACGAGATTCACTATATG
CGCGACAAGACGCGCGGCGTTGTCTGGGAGGAAACCATCATCTTGCTGCCCGACAAGGTCAGATACGTCTTTCTG
TCGGCCACGATCCCCAACGCCTTTCAGTTCGCCGAATGGATCGCCAAGATCCATCACCAAGCCTGCCACGTCGTC
TACACCGATTTCCGACCGACACCGCTGCAAAACTACTTTTACCCTACTGGCGGCAAGGGGGCGCGCATCGTCGTC
GACGAAAAGGGCATCTTCAACGAGAAAAACTTCAACTCGGTCATGGAGGAGGTTGAGGAGTTGAAAGGCAGCGCA
TCGGCCGACCCCAACGCCCGGATGAAGGGCAAGGGCAAGAACAAGAAGATCAACAAAGGGGGCGCCGACCCGGGC
TCTCCCATTTACAAGATCATCAAAATGACAATCAAGAACAATTTCAACCCCGTCATCGTCTTCAACTTTAGCAAG
CGGGAGTGCGAGGATATTGCTAAAAAGCTATCCGGCCTCGACTTCAACGACGATTCGGAAAAGGCCATGGTGAGA
AAGGTGTTTGAAAGCGCCATAGAACAGCTCTCGGAGCAGGATCGCGAGCTCCCTACCCTCCAGTATATCCTGCCG
CTCCTGGAGAAAGGGATCGGCGTCCACCACTCGGGCCTGCTCCCTTTGCTCAAGGAGACGATTGAAATCTTGTTC
CAGGAGTCTCTTATCAAGGTCCTCGTCGCGACCGAGACCTTTTCTATCGGCCTCAACATGCCGGCCAAGACGGTA
GTCTTTACCCAGGTCACAAAGTGGGATGGCACAGCGGTGCGGGCCATCACGTCGTCCGAGTACGTGCAAATGTCT
GGACGGGCCGGCCGGCGAGGCATCGACGCCCGCGGCATCGTCCTTATGATGGTCGATGACAAGCTGGAGCCGAGC
GTGGCCAAGCAGATTGTGACGGGGCAGCAGGACAAGCTGAACTCGGCCTTTCACCTCGGATACAACATGATACTC
AATCTCCTCCGAATCGAGGCCATCTCGCCCGAGTACATGCTGGAGAAGTGCTTCCATCAGTTCCAAAATGCCGCC
AGCGTGCCGACGCTGGAAAAGGACCTGATGGCGCTGCAGCAGGAGCGTGACGACATGTCGATCCCGGACGAGGCC
ACCATCAAGGACTACTATCAGATCCGGCAGCAGCTCAACACCTTTACACGGGATATGCGGGCCGTCATCCAGCAC
CCGCAGTACAGCCTCGACTTCTTGCAGCCGGGCCGGCTGGTGCAGATCTACAACCCGAAGCAGTCTCCGGACAAC
GTGGGCGGCGGCGTCGACTTTGGCTGGGGCGTCATTCTCAACCACAGCCCGCGCAAGGGGCCGCGGATGGGTGAG
CCCCAGTACAGCGCGCAGGAGTCGTACATGATTGAGGTGCTGCTGCCCATCTCGGCTTCGAGCAAGGAGATTGGG
CCCAGCCAGCCAGCCGGGGAGATGCCGCCGGGCCTTTCGCCTGCCACAAGCGAGCAGGACACGATCCATGAAGTG
GTTCCCTGCCTGCTCAGCTGCGTCAAAGCCATCAGCCAGATCCGCATCTTCATGCCCAAGGATGGCCTCAAGGCG
GGCGAGGACAAGGAGCAGGCGTACAAGTCGCTCACCGAAGTCAAGCGCAGGTTCCCCGATGGGGTGCCGATCCTT
GACCCGATCGAGAACATGGACATTGCCGACGAATCTTTCAAGAAGCTCATGCGCAAGATTGAGGTGCTCGAGTCG
CGGCTGCTGGCGAACCCGCTGCACATGTCACCGCTGCTGCCGTCGCTCTGGGACCAGTATCACAACAAGATGCAG
ATAGCGGAGAAGATCAAGGAGAAGAAGAAGACGATGGCCAAGGCGCACAGCATATCGCAGCTGGAAGAGCTCAAG
TCTCGGAAGCGGGTCCTGCGTCGGCTCGGCTTCATCAACGACTCCGAGGTGGTGCAGCTCAAGGCACGGGTGGCC
TGCGAGATCTCGTCGACCGAGGGCCACGAGCTGCTGCTGTCAGAGCTGCTCTTCGACCGCTTCTTCAACGAGCTG
CCGCCGGACAAGTGCGCGGCTGTGCTGAGCTGCTTCGTGTGCGAGGAAAAGCTGGAGACGCAGGCGCTCAAGGAG
GAGCTGCAGAAGCCGTTTCGTGAGATCCAGGCCAAGGCGCGCATCGTGGCAAAGGTGGCGCAGGAGGCCAAGCTC
GACATGAACCCGGAGGAGTACGCCTTGAGCTTCAAATGGCAGCTGATGGAGACGGTCTACCGATGGGCCCAAGGG
CGGTCATTTCTCGAAATCAGCAAAATGACCAAGATGTACGAGGGCTCCCTCATTCGCGTCTTTCGTCGGCTGGAG
GAGCTGCTGCGGCAGATGGCGCAGGCGGCCAAGGTGATGGGCAACGACGACCTCGTGAAGAAGTTTGAGGAGTGT
CTGCAGAAGGTCCGGAGGGATATTGTCGCAGCACAGAGCCTCTTCCTCTGA
Transcript >Ophun1|4111
ATGGACGAAATGTTTGACGTGTTCGAGGGCAAGGCGGGCCCGCAGAGCGACAGCGATGGTGAGCGGGCCAAGAGC
CGCGACAAGTCCAAGAAACGAAAGGCGGACGAGGCCATCAACGGCGCCGCCGCCAGCAGCAGTGCGCCCCGGGAA
ACTGTCGATGTCGAGATGGGCGATGCCACCGAGTCTTCCAACGACGACGACTCGGATGAAGAGTCCGACACGCCC
AGCCAGCAGGACAAGAAGCGGCGCAAAAAGGAAGACGGCGTTGGTCCCGTCATGACCGATGCCTTCAAGACGGAG
CAGTCGAGAGAGGTGGCCGCCGCCAAGACGCTTCTCCCTCAGGATGCCTCGCTCGTCCTGTCGCACAATATCCAG
CACCAGGTCGCCCTGCCCCCGGACCTGGACTACGAGTACGTGCCGCTTTCCGAGCACAAGTCGCCCGACGAGCCT
GCCCGCACCTGGAGCTTCAAGCTCGACCCTTTCCAGAGCTTGTCGGTGGCGTCGATTGAGCGCGACGAGAGCGTG
CTGGTCTCGGCGCACACGAGCGCCGGCAAGACGGTCGTGGCCGAATACGCCATCGCGCAGTGCCTCAAACGCAAC
CAGCGCGTCATCTACACCAGTCCCATCAAGGCTCTTAGCAATCAGAAATTTCGCGACTTCGACGGCATCTTCGGC
GACGTCGGCCTCATGACGGGAGACGTCACCATCAACCCCACCGCCAGCTGCCTGGTCATGACGACGGAGATCCTC
CGCTCGATGCTGTACCGTGGCTCGGAGATTATGCGAGAGGTGGCCTGGGTTGTCTTTGACGAGATTCACTATATG
CGCGACAAGACGCGCGGCGTTGTCTGGGAGGAAACCATCATCTTGCTGCCCGACAAGGTCAGATACGTCTTTCTG
TCGGCCACGATCCCCAACGCCTTTCAGTTCGCCGAATGGATCGCCAAGATCCATCACCAAGCCTGCCACGTCGTC
TACACCGATTTCCGACCGACACCGCTGCAAAACTACTTTTACCCTACTGGCGGCAAGGGGGCGCGCATCGTCGTC
GACGAAAAGGGCATCTTCAACGAGAAAAACTTCAACTCGGTCATGGAGGAGGTTGAGGAGTTGAAAGGCAGCGCA
TCGGCCGACCCCAACGCCCGGATGAAGGGCAAGGGCAAGAACAAGAAGATCAACAAAGGGGGCGCCGACCCGGGC
TCTCCCATTTACAAGATCATCAAAATGACAATCAAGAACAATTTCAACCCCGTCATCGTCTTCAACTTTAGCAAG
CGGGAGTGCGAGGATATTGCTAAAAAGCTATCCGGCCTCGACTTCAACGACGATTCGGAAAAGGCCATGGTGAGA
AAGGTGTTTGAAAGCGCCATAGAACAGCTCTCGGAGCAGGATCGCGAGCTCCCTACCCTCCAGTATATCCTGCCG
CTCCTGGAGAAAGGGATCGGCGTCCACCACTCGGGCCTGCTCCCTTTGCTCAAGGAGACGATTGAAATCTTGTTC
CAGGAGTCTCTTATCAAGGTCCTCGTCGCGACCGAGACCTTTTCTATCGGCCTCAACATGCCGGCCAAGACGGTA
GTCTTTACCCAGGTCACAAAGTGGGATGGCACAGCGGTGCGGGCCATCACGTCGTCCGAGTACGTGCAAATGTCT
GGACGGGCCGGCCGGCGAGGCATCGACGCCCGCGGCATCGTCCTTATGATGGTCGATGACAAGCTGGAGCCGAGC
GTGGCCAAGCAGATTGTGACGGGGCAGCAGGACAAGCTGAACTCGGCCTTTCACCTCGGATACAACATGATACTC
AATCTCCTCCGAATCGAGGCCATCTCGCCCGAGTACATGCTGGAGAAGTGCTTCCATCAGTTCCAAAATGCCGCC
AGCGTGCCGACGCTGGAAAAGGACCTGATGGCGCTGCAGCAGGAGCGTGACGACATGTCGATCCCGGACGAGGCC
ACCATCAAGGACTACTATCAGATCCGGCAGCAGCTCAACACCTTTACACGGGATATGCGGGCCGTCATCCAGCAC
CCGCAGTACAGCCTCGACTTCTTGCAGCCGGGCCGGCTGGTGCAGATCTACAACCCGAAGCAGTCTCCGGACAAC
GTGGGCGGCGGCGTCGACTTTGGCTGGGGCGTCATTCTCAACCACAGCCCGCGCAAGGGGCCGCGGATGGGTGAG
CCCCAGTACAGCGCGCAGGAGTCGTACATGATTGAGGTGCTGCTGCCCATCTCGGCTTCGAGCAAGGAGATTGGG
CCCAGCCAGCCAGCCGGGGAGATGCCGCCGGGCCTTTCGCCTGCCACAAGCGAGCAGGACACGATCCATGAAGTG
GTTCCCTGCCTGCTCAGCTGCGTCAAAGCCATCAGCCAGATCCGCATCTTCATGCCCAAGGATGGCCTCAAGGCG
GGCGAGGACAAGGAGCAGGCGTACAAGTCGCTCACCGAAGTCAAGCGCAGGTTCCCCGATGGGGTGCCGATCCTT
GACCCGATCGAGAACATGGACATTGCCGACGAATCTTTCAAGAAGCTCATGCGCAAGATTGAGGTGCTCGAGTCG
CGGCTGCTGGCGAACCCGCTGCACATGTCACCGCTGCTGCCGTCGCTCTGGGACCAGTATCACAACAAGATGCAG
ATAGCGGAGAAGATCAAGGAGAAGAAGAAGACGATGGCCAAGGCGCACAGCATATCGCAGCTGGAAGAGCTCAAG
TCTCGGAAGCGGGTCCTGCGTCGGCTCGGCTTCATCAACGACTCCGAGGTGGTGCAGCTCAAGGCACGGGTGGCC
TGCGAGATCTCGTCGACCGAGGGCCACGAGCTGCTGCTGTCAGAGCTGCTCTTCGACCGCTTCTTCAACGAGCTG
CCGCCGGACAAGTGCGCGGCTGTGCTGAGCTGCTTCGTGTGCGAGGAAAAGCTGGAGACGCAGGCGCTCAAGGAG
GAGCTGCAGAAGCCGTTTCGTGAGATCCAGGCCAAGGCGCGCATCGTGGCAAAGGTGGCGCAGGAGGCCAAGCTC
GACATGAACCCGGAGGAGTACGCCTTGAGCTTCAAATGGCAGCTGATGGAGACGGTCTACCGATGGGCCCAAGGG
CGGTCATTTCTCGAAATCAGCAAAATGACCAAGATGTACGAGGGCTCCCTCATTCGCGTCTTTCGTCGGCTGGAG
GAGCTGCTGCGGCAGATGGCGCAGGCGGCCAAGGTGATGGGCAACGACGACCTCGTGAAGAAGTTTGAGGAGTGT
CTGCAGAAGGTCCGGAGGGATATTGTCGCAGCACAGAGCCTCTTCCTCTGA
Gene >Ophun1|4111
ATGGACGAAATGTTTGACGTGTTCGAGGGCAAGGCGGGCCCGCAGAGCGACAGCGATGGTGAGCGGGCCAAGAGC
CGCGACAAGTCCAAGAAACGAAAGGCGGACGAGGCCATCAACGGCGCCGCCGCCAGCAGCAGTGCGCCCCGGGAA
ACTGTCGATGTCGAGATGGGCGATGCCACCGAGTCTTCCAACGACGACGACTCGGATGAAGAGTCCGACACGCCC
AGCCAGCAGGACAAGAAGCGGCGCAAAAAGGAAGACGGCGTTGGTCCCGTCATGACCGATGCCTTCAAGACGGAG
CAGTCGAGAGAGGTGGCCGCCGCCAAGACGCTTCTCCCTCAGGATGCCTCGCTCGTCCTGTCGCACAATATCCAG
CACCAGGTCGCCCTGCCCCCGGACCTGGACTACGAGTACGTGCCGCTTTCCGAGCACAAGTCGCCCGACGAGCCT
GCCCGCACCTGGAGCTTCAAGCTCGACCCTTTCCAGAGCTTGTCGGTGGCGTCGATTGAGCGCGACGAGAGCGTG
CTGGTCTCGGCGCACACGAGCGCCGGCAAGACGGTCGTGGCCGAATACGCCATCGCGCAGTGCCTCAAACGCAAC
CAGCGCGTCATCTACACCAGTCCCATCAAGGCTCTTAGCAATCAGAAATTTCGCGACTTCGACGGCATCTTCGGC
GACGTCGGCCTCATGACGGGAGACGTCACCATCAACCCCACCGCCAGCTGCCTGGTCATGACGACGGAGATCCTC
CGCTCGATGCTGTACCGTGGCTCGGAGATTATGCGAGAGGTGGCCTGGGTTGTCTTTGACGAGATTCACTATATG
CGCGACAAGACGCGCGGCGTTGTCTGGGAGGAAACCATCATCTTGCTGCCCGACAAGGTCAGATACGTCTTTCTG
TCGGCCACGATCCCCAACGCCTTTCAGTTCGCCGAATGGATCGCCAAGATCCATCACCAAGCCTGCCACGTCGTC
TACACCGATTTCCGACCGACACCGCTGCAAAACTACTTTTACCCTACTGGCGGCAAGGGGGCGCGCATCGTCGTC
GACGAAAAGGGCATCTTCAACGAGAAAAACTTCAACTCGGTCATGGAGGAGGTTGAGGAGTTGAAAGGCAGCGCA
TCGGCCGACCCCAACGCCCGGATGAAGGGCAAGGGCAAGAACAAGAAGATCAACAAAGGGGGCGCCGACCCGGGC
TCTCCCATTTACAAGATCATCAAAATGACAATCAAGAACAATTTCAACCCCGTCATCGTCTTCAACTTTAGCAAG
CGGGAGTGCGAGGATATTGCTAAAAAGCTATCCGGCCTCGACTTCAACGACGATTCGGAAAAGGCCATGGTGAGA
AAGGTGTTTGAAAGCGCCATAGAACAGCTCTCGGAGCAGGATCGCGAGCTCCCTACCCTCCAGTATATCCTGCCG
CTCCTGGAGAAAGGGATCGGCGTCCACCACTCGGGCCTGCTCCCTTTGCTCAAGGAGACGATTGAAATCTTGTTC
CAGGAGTCTCTTATCAAGGTCCTCGTCGCGACCGAGACCTTTTCTATCGGCCTCAACATGCCGGCCAAGACGGTA
GTCTTTACCCAGGTCACAAAGTGGGATGGCACAGCGGTGCGGGCCATCACGTCGTCCGAGTACGTGCAAATGTCT
GGACGGGCCGGCCGGCGAGGCATCGACGCCCGCGGCATCGTCCTTATGATGGTCGATGACAAGCTGGAGCCGAGC
GTGGCCAAGCAGATTGTGACGGGGCAGCAGGACAAGCTGAACTCGGCCTTTCACCTCGGATACAACATGATACTC
AATCTCCTCCGAATCGAGGCCATCTCGCCCGAGTACATGCTGGAGAAGTGCTTCCATCAGTTCCAAAATGCCGCC
AGCGTGCCGACGCTGGAAAAGGACCTGATGGCGCTGCAGCAGGAGCGTGACGACATGTCGATCCCGGACGAGGCC
ACCATCAAGGACTACTATCAGATCCGGCAGCAGCTCAACACCTTTACACGGGATATGCGGGCCGTCATCCAGCAC
CCGCAGTACAGCCTCGACTTCTTGCAGCCGGGCCGGCTGGTGCAGATCTACAACCCGAAGCAGTCTCCGGACAAC
GTGGGCGGCGGCGTCGACTTTGGCTGGGGCGTCATTCTCAACCACAGCCCGCGCAAGGGGCCGCGGATGGGTGAG
CCCCAGTACAGCGCGCAGGAGTCGTACATGATTGAGGTGCTGCTGCCCATCTCGGCTTCGAGCAAGGAGATTGGG
CCCAGCCAGCCAGCCGGGGAGATGCCGCCGGGCCTTTCGCCTGCCACAAGCGAGCAGGACACGATCCATGAAGTG
GTTCCCTGCCTGCTCAGCTGCGTCAAAGCCATCAGCCAGATCCGCATCTTCATGCCCAAGGATGGCCTCAAGGCG
GGCGAGGACAAGGAGCAGGCGTACAAGTCGCTCACCGAAGTCAAGCGCAGGTTCCCCGATGGGGTGCCGATCCTT
GACCCGATCGAGAACATGGACATTGCCGACGAATCTTTCAAGAAGCTCATGCGCAAGATTGAGGTGCTCGAGTCG
CGGCTGCTGGCGAACCCGCTGCACATGTCACCGCTGCTGCCGTCGCTCTGGGACCAGTATCACAACAAGATGCAG
ATAGCGGAGAAGATCAAGGAGAAGAAGAAGACGATGGCCAAGGCGCACAGCATATCGCAGCTGGAAGAGCTCAAG
TCTCGGAAGCGGGTCCTGCGTCGGCTCGGCTTCATCAACGACTCCGAGGTGGTGCAGCTCAAGGCACGGGTGGCC
TGCGAGATCTCGTCGACCGAGGGCCACGAGCTGCTGCTGTCAGAGCTGCTCTTCGACCGCTTCTTCAACGAGCTG
CCGCCGGACAAGTGCGCGGCTGTGCTGAGCTGCTTCGTGTGCGAGGAAAAGCTGGAGACGCAGGCGCTCAAGGAG
GAGCTGCAGAAGCCGTTTCGTGAGATCCAGGCCAAGGCGCGCATCGTGGCAAAGGTGGCGCAGGAGGCCAAGCTC
GACATGAACCCGGAGGAGTACGCCTTGAGCTTCAAATGGCAGCTGATGGAGACGGTCTACCGATGGGCCCAAGGG
CGGTCATTTCTCGAAATCAGGTCCGTTACTTCTATTCCCTGTGTTTGTTGACCGAGAGCTGACACGATGAATGCA
GCAAAATGACCAAGATGTACGAGGGCTCCCTCATTCGCGTCTTTCGTCGGCTGGAGGAGCTGCTGCGGCAGATGG
CGCAGGCGGCCAAGGTGATGGGCAACGACGACCTCGTGAAGAAGTTTGAGGAGTGTCTGCAGAAGGTCCGGAGGG
ATATTGTCGCAGCACAGAGCCTCTTCCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail