Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4109
Gene name
LocationContig_377:3251..4955
Strand+
Gene length (bp)1704
Transcript length (bp)1704
Coding sequence length (bp)1704
Protein length (aa) 568

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01535 PPR PPR repeat 2.7E-04 261 291

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protein At1g18900 OS=Arabidopsis thaliana GN=At1g18900 PE=2 SV=1 237 415 7.0E-07
sp|Q9SCP4|PP279_ARATH Pentatricopeptide repeat-containing protein At3g53170 OS=Arabidopsis thaliana GN=At3g53170 PE=3 SV=1 261 357 8.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4109
MRIPSRLDGFASRALLSGFPSAGRRVACTRSSLWLRSTFIAVAASPRAGETVPRRQRSRRYRSSAAARSPRKPVD
RQYLLSLVGGVDDESVHHLFDSYRDPGFALPDGPRIRISDRKPDVQYPSREETARADENALRIVVRLCTAIGQRL
RNPARISLEAIYDLYRRLPEPRMLLLTWHWRSRLMRVMGTPPQRSTDSMLRYFALVADVKNAGLTLRLCEWNYAL
SLAARYSVSATARHVESTLRLWRDMEREAHVPGNEVTFNILFDVAAKAGNFRLADMVYREMEGRGLEFNRFHHVS
LIHYFGLKLDSAGIRAAYREMVDSDEMIDTIVLNCVIAGLLRCGEEAAADYVYERMKSSHALAPELPQKNYMIKR
VISRVLLMFSRVAKRFPDLKNPLQTQVHLSPDLRTYKLLIRHHAIRLGSIAKVAQYLDEMRQLLVPVHPTIFLAL
FKAFYLHGGFPGSDWSEARLDGVLSAMYQARDDQVATFSIRVWLVIWALRAVEKCSSTAAVDKAYTELSRRWDVP
ESRRQFMCDIYDNIRTRKDLRAPWRSKNGSAMRHSLRDGGWL*
Coding >Ophun1|4109
ATGAGGATTCCCAGCCGACTGGACGGGTTCGCCTCTCGAGCGCTGCTCTCTGGCTTTCCGTCAGCCGGCCGGAGG
GTCGCCTGTACGCGGAGCTCCCTCTGGCTCCGCTCTACCTTTATCGCTGTTGCCGCTTCTCCTCGGGCTGGAGAG
ACGGTGCCTCGTCGGCAGAGGTCGAGGCGCTACCGCTCGTCTGCTGCGGCTCGTTCTCCTCGGAAGCCCGTCGAT
CGCCAGTATCTTCTTTCGCTTGTGGGTGGCGTGGACGATGAGAGCGTCCATCACCTCTTCGACTCTTACCGCGAT
CCTGGCTTTGCCCTACCCGATGGGCCCAGGATTCGCATCTCGGACCGCAAGCCGGACGTTCAATACCCTTCGCGC
GAGGAGACGGCCCGCGCAGACGAAAATGCGCTCCGAATCGTCGTCCGGCTCTGCACCGCCATCGGCCAGCGGCTG
CGCAACCCGGCCCGCATCTCGCTCGAGGCCATCTACGACCTCTACCGCCGGCTGCCGGAGCCGCGCATGCTGCTC
CTCACCTGGCATTGGCGCAGCCGGCTGATGAGGGTCATGGGCACGCCGCCGCAGCGGAGCACCGACTCGATGCTC
CGGTACTTTGCCCTCGTTGCCGACGTCAAGAATGCGGGCCTGACGCTTAGGCTCTGCGAGTGGAATTATGCGCTC
TCGCTGGCTGCTCGGTACTCGGTTTCCGCTACCGCGCGGCATGTCGAGTCGACGCTGAGGCTTTGGCGTGATATG
GAACGCGAGGCGCATGTTCCGGGCAACGAGGTGACGTTTAATATCCTCTTCGACGTGGCTGCCAAGGCCGGCAAT
TTTCGACTCGCCGACATGGTCTATCGCGAGATGGAGGGCCGCGGCCTCGAGTTCAACCGGTTTCATCATGTCAGC
CTCATTCATTACTTTGGCCTCAAGCTCGACTCGGCTGGCATCCGCGCTGCCTACCGTGAGATGGTCGACTCGGAC
GAGATGATCGATACCATCGTCCTCAACTGCGTCATCGCTGGTCTGCTTCGCTGCGGCGAGGAGGCTGCGGCCGAT
TACGTCTACGAGCGCATGAAGAGCAGCCACGCGCTTGCGCCCGAGCTGCCGCAAAAGAACTACATGATCAAGCGC
GTCATCTCGAGGGTTCTCCTCATGTTTTCCAGGGTTGCCAAGCGCTTCCCCGACCTAAAGAATCCGCTGCAGACG
CAGGTTCACCTCTCGCCCGACCTGCGCACTTACAAGCTCCTGATACGGCACCACGCCATCCGTCTCGGCAGCATT
GCAAAGGTGGCGCAGTACCTGGACGAGATGAGGCAGCTGCTCGTCCCCGTGCATCCAACCATATTTCTCGCCCTG
TTCAAGGCTTTTTACCTTCACGGCGGCTTCCCGGGTTCCGACTGGAGCGAGGCCAGGCTTGACGGTGTTCTTTCC
GCCATGTATCAGGCTAGAGATGACCAAGTCGCTACGTTTTCCATTCGCGTCTGGCTTGTCATCTGGGCGCTACGG
GCTGTTGAGAAGTGCTCGTCTACCGCGGCTGTCGACAAGGCCTATACCGAACTGAGCCGTCGATGGGACGTCCCC
GAAAGTCGTCGGCAGTTCATGTGTGATATATACGACAATATTCGGACGAGAAAGGATCTCAGGGCTCCCTGGCGC
AGCAAAAATGGCTCGGCGATGCGGCATAGTTTAAGAGATGGCGGTTGGCTGTGA
Transcript >Ophun1|4109
ATGAGGATTCCCAGCCGACTGGACGGGTTCGCCTCTCGAGCGCTGCTCTCTGGCTTTCCGTCAGCCGGCCGGAGG
GTCGCCTGTACGCGGAGCTCCCTCTGGCTCCGCTCTACCTTTATCGCTGTTGCCGCTTCTCCTCGGGCTGGAGAG
ACGGTGCCTCGTCGGCAGAGGTCGAGGCGCTACCGCTCGTCTGCTGCGGCTCGTTCTCCTCGGAAGCCCGTCGAT
CGCCAGTATCTTCTTTCGCTTGTGGGTGGCGTGGACGATGAGAGCGTCCATCACCTCTTCGACTCTTACCGCGAT
CCTGGCTTTGCCCTACCCGATGGGCCCAGGATTCGCATCTCGGACCGCAAGCCGGACGTTCAATACCCTTCGCGC
GAGGAGACGGCCCGCGCAGACGAAAATGCGCTCCGAATCGTCGTCCGGCTCTGCACCGCCATCGGCCAGCGGCTG
CGCAACCCGGCCCGCATCTCGCTCGAGGCCATCTACGACCTCTACCGCCGGCTGCCGGAGCCGCGCATGCTGCTC
CTCACCTGGCATTGGCGCAGCCGGCTGATGAGGGTCATGGGCACGCCGCCGCAGCGGAGCACCGACTCGATGCTC
CGGTACTTTGCCCTCGTTGCCGACGTCAAGAATGCGGGCCTGACGCTTAGGCTCTGCGAGTGGAATTATGCGCTC
TCGCTGGCTGCTCGGTACTCGGTTTCCGCTACCGCGCGGCATGTCGAGTCGACGCTGAGGCTTTGGCGTGATATG
GAACGCGAGGCGCATGTTCCGGGCAACGAGGTGACGTTTAATATCCTCTTCGACGTGGCTGCCAAGGCCGGCAAT
TTTCGACTCGCCGACATGGTCTATCGCGAGATGGAGGGCCGCGGCCTCGAGTTCAACCGGTTTCATCATGTCAGC
CTCATTCATTACTTTGGCCTCAAGCTCGACTCGGCTGGCATCCGCGCTGCCTACCGTGAGATGGTCGACTCGGAC
GAGATGATCGATACCATCGTCCTCAACTGCGTCATCGCTGGTCTGCTTCGCTGCGGCGAGGAGGCTGCGGCCGAT
TACGTCTACGAGCGCATGAAGAGCAGCCACGCGCTTGCGCCCGAGCTGCCGCAAAAGAACTACATGATCAAGCGC
GTCATCTCGAGGGTTCTCCTCATGTTTTCCAGGGTTGCCAAGCGCTTCCCCGACCTAAAGAATCCGCTGCAGACG
CAGGTTCACCTCTCGCCCGACCTGCGCACTTACAAGCTCCTGATACGGCACCACGCCATCCGTCTCGGCAGCATT
GCAAAGGTGGCGCAGTACCTGGACGAGATGAGGCAGCTGCTCGTCCCCGTGCATCCAACCATATTTCTCGCCCTG
TTCAAGGCTTTTTACCTTCACGGCGGCTTCCCGGGTTCCGACTGGAGCGAGGCCAGGCTTGACGGTGTTCTTTCC
GCCATGTATCAGGCTAGAGATGACCAAGTCGCTACGTTTTCCATTCGCGTCTGGCTTGTCATCTGGGCGCTACGG
GCTGTTGAGAAGTGCTCGTCTACCGCGGCTGTCGACAAGGCCTATACCGAACTGAGCCGTCGATGGGACGTCCCC
GAAAGTCGTCGGCAGTTCATGTGTGATATATACGACAATATTCGGACGAGAAAGGATCTCAGGGCTCCCTGGCGC
AGCAAAAATGGCTCGGCGATGCGGCATAGTTTAAGAGATGGCGGTTGGCTGTGA
Gene >Ophun1|4109
ATGAGGATTCCCAGCCGACTGGACGGGTTCGCCTCTCGAGCGCTGCTCTCTGGCTTTCCGTCAGCCGGCCGGAGG
GTCGCCTGTACGCGGAGCTCCCTCTGGCTCCGCTCTACCTTTATCGCTGTTGCCGCTTCTCCTCGGGCTGGAGAG
ACGGTGCCTCGTCGGCAGAGGTCGAGGCGCTACCGCTCGTCTGCTGCGGCTCGTTCTCCTCGGAAGCCCGTCGAT
CGCCAGTATCTTCTTTCGCTTGTGGGTGGCGTGGACGATGAGAGCGTCCATCACCTCTTCGACTCTTACCGCGAT
CCTGGCTTTGCCCTACCCGATGGGCCCAGGATTCGCATCTCGGACCGCAAGCCGGACGTTCAATACCCTTCGCGC
GAGGAGACGGCCCGCGCAGACGAAAATGCGCTCCGAATCGTCGTCCGGCTCTGCACCGCCATCGGCCAGCGGCTG
CGCAACCCGGCCCGCATCTCGCTCGAGGCCATCTACGACCTCTACCGCCGGCTGCCGGAGCCGCGCATGCTGCTC
CTCACCTGGCATTGGCGCAGCCGGCTGATGAGGGTCATGGGCACGCCGCCGCAGCGGAGCACCGACTCGATGCTC
CGGTACTTTGCCCTCGTTGCCGACGTCAAGAATGCGGGCCTGACGCTTAGGCTCTGCGAGTGGAATTATGCGCTC
TCGCTGGCTGCTCGGTACTCGGTTTCCGCTACCGCGCGGCATGTCGAGTCGACGCTGAGGCTTTGGCGTGATATG
GAACGCGAGGCGCATGTTCCGGGCAACGAGGTGACGTTTAATATCCTCTTCGACGTGGCTGCCAAGGCCGGCAAT
TTTCGACTCGCCGACATGGTCTATCGCGAGATGGAGGGCCGCGGCCTCGAGTTCAACCGGTTTCATCATGTCAGC
CTCATTCATTACTTTGGCCTCAAGCTCGACTCGGCTGGCATCCGCGCTGCCTACCGTGAGATGGTCGACTCGGAC
GAGATGATCGATACCATCGTCCTCAACTGCGTCATCGCTGGTCTGCTTCGCTGCGGCGAGGAGGCTGCGGCCGAT
TACGTCTACGAGCGCATGAAGAGCAGCCACGCGCTTGCGCCCGAGCTGCCGCAAAAGAACTACATGATCAAGCGC
GTCATCTCGAGGGTTCTCCTCATGTTTTCCAGGGTTGCCAAGCGCTTCCCCGACCTAAAGAATCCGCTGCAGACG
CAGGTTCACCTCTCGCCCGACCTGCGCACTTACAAGCTCCTGATACGGCACCACGCCATCCGTCTCGGCAGCATT
GCAAAGGTGGCGCAGTACCTGGACGAGATGAGGCAGCTGCTCGTCCCCGTGCATCCAACCATATTTCTCGCCCTG
TTCAAGGCTTTTTACCTTCACGGCGGCTTCCCGGGTTCCGACTGGAGCGAGGCCAGGCTTGACGGTGTTCTTTCC
GCCATGTATCAGGCTAGAGATGACCAAGTCGCTACGTTTTCCATTCGCGTCTGGCTTGTCATCTGGGCGCTACGG
GCTGTTGAGAAGTGCTCGTCTACCGCGGCTGTCGACAAGGCCTATACCGAACTGAGCCGTCGATGGGACGTCCCC
GAAAGTCGTCGGCAGTTCATGTGTGATATATACGACAATATTCGGACGAGAAAGGATCTCAGGGCTCCCTGGCGC
AGCAAAAATGGCTCGGCGATGCGGCATAGTTTAAGAGATGGCGGTTGGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail