Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4103
Gene name
LocationContig_376:9859..11088
Strand-
Gene length (bp)1229
Transcript length (bp)1017
Coding sequence length (bp)1017
Protein length (aa) 339

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 1.7E-36 83 220

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 12 255 3.0E-39
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 12 255 2.0E-38
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 29 255 9.0E-38
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 10 234 3.0E-36
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 5 255 6.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 12 255 3.0E-39
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 12 255 2.0E-38
sp|Q0CBM7|FAEA_ASPTN Probable feruloyl esterase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=faeA PE=3 SV=1 29 255 9.0E-38
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 10 234 3.0E-36
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 5 255 6.0E-36
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 24 255 9.0E-36
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 5 255 9.0E-36
sp|O42815|FAEA_ASPTU Feruloyl esterase A OS=Aspergillus tubingensis GN=faeA PE=3 SV=1 5 255 8.0E-34
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 59 261 3.0E-29
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 59 261 3.0E-29
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 25 234 9.0E-29
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 25 234 9.0E-29
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 65 265 6.0E-24
sp|P47145|YJ77_YEAST Putative lipase YJR107W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR107W PE=3 SV=2 50 218 3.0E-21
sp|Q9XTR8|LIP1_CAEEL Lipase ZK262.3 OS=Caenorhabditis elegans GN=ZK262.3 PE=1 SV=1 67 305 4.0E-17
sp|Q948R1|PLA11_ARATH Phospholipase A(1) DAD1, chloroplastic OS=Arabidopsis thaliana GN=DAD1 PE=1 SV=1 79 217 3.0E-10
sp|B9EYD3|PLA4_ORYSJ Phospholipase A1-II 4 OS=Oryza sativa subsp. japonica GN=Os01g0652300 PE=2 SV=2 79 227 3.0E-09
sp|Q3EBR6|PLA16_ARATH Phospholipase A1-Igamma2, chloroplastic OS=Arabidopsis thaliana GN=At2g30550 PE=1 SV=2 79 217 1.0E-08
sp|A2ZW16|PLA1_ORYSJ Phospholipase A1-II 1 OS=Oryza sativa subsp. japonica GN=Os01g0651100 PE=3 SV=2 80 233 7.0E-08
sp|A2WT95|PLA1_ORYSI Phospholipase A1-II 1 OS=Oryza sativa subsp. indica GN=OsI_03083 PE=3 SV=2 80 233 7.0E-08
sp|Q941F1|PLA15_ARATH Phospholipase A1-Igamma1, chloroplastic OS=Arabidopsis thaliana GN=At1g06800 PE=1 SV=2 66 217 6.0E-07
sp|Q8RZ40|PLA3_ORYSJ Phospholipase A1-II 3 OS=Oryza sativa subsp. japonica GN=Os01g0651800 PE=2 SV=1 79 218 9.0E-07
sp|A2WTA0|PLA3_ORYSI Phospholipase A1-II 3 OS=Oryza sativa subsp. indica GN=OsI_03088 PE=3 SV=1 79 218 1.0E-06
sp|Q0JKT4|PLA2_ORYSJ Phospholipase A1-II 2 OS=Oryza sativa subsp. japonica GN=Os01g0651200 PE=2 SV=1 79 227 4.0E-06
sp|A2WT96|PLA2_ORYSI Phospholipase A1-II 2 OS=Oryza sativa subsp. indica GN=OsI_03084 PE=3 SV=2 79 227 4.0E-06
sp|O23522|PLA14_ARATH Phospholipase A1-Ibeta2, chloroplastic OS=Arabidopsis thaliana GN=At4g16820 PE=1 SV=2 80 217 5.0E-06
sp|Q8S1D9|EG1_ORYSJ Phospholipase A1 EG1, chloroplastic OS=Oryza sativa subsp. japonica GN=EG1 PE=1 SV=1 75 217 1.0E-05
sp|A2WY00|EG1_ORYSI Phospholipase A1 EG1, chloroplastic OS=Oryza sativa subsp. indica GN=EG1 PE=3 SV=1 75 217 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 24 0.999739

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup409
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1744
Ophiocordyceps australis 1348a (Ghana) OphauG2|4903
Ophiocordyceps australis map64 (Brazil) OphauB2|1652
Ophiocordyceps australis map64 (Brazil) OphauB2|674
Ophiocordyceps camponoti-floridani Ophcf2|03566
Ophiocordyceps camponoti-floridani Ophcf2|04883
Ophiocordyceps camponoti-rufipedis Ophun1|4103 (this protein)
Ophiocordyceps kimflemingae Ophio5|4527
Ophiocordyceps subramaniannii Hirsu2|2280

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4103
MLWNTSKFQLGLLFTLALAGLTTAEKKPISEDTLDRLKRYSLLCGISYLDDCPNPPSGITIAHRFDNNATGIIFK
DANNKEIVVTFRGTMNFRDIATDANFLVQSDFESPGVSGCEGCKVHAGFLESWNTVAKDVISNLQGQLAENPGMK
VVVTGHSLGGAQASLAAMSIIGSGVDADVVTFGQPRTGNQAYADFVDKMAPGLMRVTHADDIVPQVPPKDLASSG
YQHHSTEIWQEKDPDAATTFQCEGQEPKDCNLSVKPKAKVPILGLPDINLIGNISLSELASGSVAHSNYMGVPMG
TFANGRACGKGGNIFGQVAEGLASIFLKGSSESVDKDN*
Coding >Ophun1|4103
ATGTTGTGGAACACTTCCAAGTTCCAGCTGGGCCTCCTCTTCACCCTCGCCCTCGCAGGACTCACCACCGCAGAG
AAGAAACCCATCTCAGAAGACACGCTCGACAGGTTAAAGCGCTACAGCCTCCTCTGCGGAATATCCTACCTGGAC
GACTGCCCCAACCCACCGAGCGGCATCACCATCGCCCACAGATTCGACAACAACGCCACAGGCATCATTTTCAAA
GATGCAAACAACAAGGAAATAGTCGTCACCTTTCGCGGAACCATGAACTTCCGCGACATCGCCACCGACGCCAAC
TTCCTCGTCCAATCCGACTTTGAGAGCCCAGGCGTCTCCGGCTGCGAGGGTTGCAAGGTGCACGCTGGATTCCTC
GAGTCGTGGAACACGGTTGCCAAGGACGTCATCTCCAATCTTCAGGGTCAACTCGCCGAGAATCCGGGCATGAAG
GTCGTCGTTACGGGCCATTCGCTCGGTGGTGCTCAGGCTTCTCTGGCGGCCATGTCCATTATTGGCTCTGGCGTG
GATGCCGATGTCGTTACCTTTGGACAGCCGCGGACGGGAAACCAGGCGTATGCCGACTTTGTGGATAAGATGGCG
CCGGGCTTGATGCGCGTAACTCATGCGGATGATATCGTGCCGCAGGTTCCGCCCAAGGATCTCGCCTCGTCTGGA
TACCAGCATCACTCTACAGAGATATGGCAGGAGAAGGATCCGGACGCGGCAACGACGTTTCAGTGCGAGGGACAG
GAGCCCAAGGACTGCAACCTCTCGGTCAAACCGAAAGCCAAAGTCCCCATCCTGGGCCTTCCCGACATCAACCTC
ATCGGCAACATCTCCCTCAGCGAACTCGCCTCCGGCAGTGTCGCACACTCAAACTACATGGGCGTTCCGATGGGC
ACCTTTGCCAATGGAAGGGCGTGCGGGAAGGGGGGTAACATCTTCGGCCAGGTGGCAGAGGGCCTCGCCAGCATC
TTCCTCAAGGGGTCGAGTGAATCCGTCGACAAAGACAACTGA
Transcript >Ophun1|4103
ATGTTGTGGAACACTTCCAAGTTCCAGCTGGGCCTCCTCTTCACCCTCGCCCTCGCAGGACTCACCACCGCAGAG
AAGAAACCCATCTCAGAAGACACGCTCGACAGGTTAAAGCGCTACAGCCTCCTCTGCGGAATATCCTACCTGGAC
GACTGCCCCAACCCACCGAGCGGCATCACCATCGCCCACAGATTCGACAACAACGCCACAGGCATCATTTTCAAA
GATGCAAACAACAAGGAAATAGTCGTCACCTTTCGCGGAACCATGAACTTCCGCGACATCGCCACCGACGCCAAC
TTCCTCGTCCAATCCGACTTTGAGAGCCCAGGCGTCTCCGGCTGCGAGGGTTGCAAGGTGCACGCTGGATTCCTC
GAGTCGTGGAACACGGTTGCCAAGGACGTCATCTCCAATCTTCAGGGTCAACTCGCCGAGAATCCGGGCATGAAG
GTCGTCGTTACGGGCCATTCGCTCGGTGGTGCTCAGGCTTCTCTGGCGGCCATGTCCATTATTGGCTCTGGCGTG
GATGCCGATGTCGTTACCTTTGGACAGCCGCGGACGGGAAACCAGGCGTATGCCGACTTTGTGGATAAGATGGCG
CCGGGCTTGATGCGCGTAACTCATGCGGATGATATCGTGCCGCAGGTTCCGCCCAAGGATCTCGCCTCGTCTGGA
TACCAGCATCACTCTACAGAGATATGGCAGGAGAAGGATCCGGACGCGGCAACGACGTTTCAGTGCGAGGGACAG
GAGCCCAAGGACTGCAACCTCTCGGTCAAACCGAAAGCCAAAGTCCCCATCCTGGGCCTTCCCGACATCAACCTC
ATCGGCAACATCTCCCTCAGCGAACTCGCCTCCGGCAGTGTCGCACACTCAAACTACATGGGCGTTCCGATGGGC
ACCTTTGCCAATGGAAGGGCGTGCGGGAAGGGGGGTAACATCTTCGGCCAGGTGGCAGAGGGCCTCGCCAGCATC
TTCCTCAAGGGGTCGAGTGAATCCGTCGACAAAGACAACTGA
Gene >Ophun1|4103
ATGTTGTGGAACACTTCCAAGGTATGAGATCCCCAACTCTCCTCATATCACAAGCTCACAGTTCCAGCTGGGCCT
CCTCTTCACCCTCGCCCTCGCAGGACTCACCACCGCAGAGAAGAAACCCAGTACGTCCCCCCAGCTCGACAACAG
ACAGCCACTAACCCGACCAAAGTCTCAGAAGACACGCTCGACAGGTTAAAGCGCTACAGCCTCCTCTGCGGAATA
TCCTACCTGGACGACTGCCCCAACCCACCGAGCGGCATCACCATCGCCCACAGATTCGACAACAACGCCACAGGC
ATCATTTTCAAAGATGCAAACAACAAGGAAATAGTCGTCACCTTTCGCGGAACCATGAACTTCCGCGACATCGCC
ACCGACGCCAACTTCCTCGTCCAATCCGACTTTGAGAGCCCAGGCGTCTCCGGCTGCGAGGGTTGCAAGGTACGA
AGCCCGTTGCCAGTACATAAAGAATAACCAGAAGCCAACCCTTGTAGGTGCACGCTGGATTCCTCGAGTCGTGGA
ACACGGTTGCCAAGGACGTCATCTCCAATCTTCAGGGTCAACTCGCCGAGAATCCGGGCATGAAGGTCGTCGTTA
CGGGCCATTCGCTCGGTGGTGCTCAGGCTTCTCTGGCGGCCATGTCCATTATTGGCTCTGGCGTGGATGCCGATG
TCGTTACCTTTGGACAGCCGCGGACGGGAAACCAGGCGTATGCCGACTTTGTGGATAAGATGGCGCCGGGCTTGA
TGCGCGTAACTCATGCGGATGATATCGTGCCGCAGGTTCCGCCCAAGGATCTCGCCTCGTCTGGATACCAGCATC
ACTCTACAGAGATATGGCAGGAGAAGGATCCGGACGCGGCAACGACGTTTCAGTGCGAGGGACAGGAGCCCAAGG
TATAACGAAAACATGCTCGTTGCTGTCTCCCCTCTTCAATTAATTCAGAAGCTAAGCGTATCCAACATCAGGACT
GCAACCTCTCGGTCAAACCGAAAGCCAAAGTCCCCATCCTGGGCCTTCCCGACATCAACCTCATCGGCAACATCT
CCCTCAGCGAACTCGCCTCCGGCAGTGTCGCACACTCAAACTACATGGGCGTTCCGATGGGCACCTTTGCCAATG
GAAGGGCGTGCGGGAAGGGGGGTAACATCTTCGGCCAGGTGGCAGAGGGCCTCGCCAGCATCTTCCTCAAGGGGT
CGAGTGAATCCGTCGACAAAGACAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail