Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4097
Gene name
LocationContig_375:8684..17548
Strand+
Gene length (bp)8864
Transcript length (bp)8514
Coding sequence length (bp)8514
Protein length (aa) 2838

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01328 Peroxidase_2 Peroxidase, family 2 5.0E-39 90 283

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00668|STCC_EMENI Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 94 283 5.0E-17
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1789 1930 1.0E-12
sp|P04963|PRXC_LEPFU Chloroperoxidase OS=Leptoxyphium fumago GN=CPO PE=1 SV=3 91 284 4.0E-11
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1814 1960 7.0E-11
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1821 1968 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00668|STCC_EMENI Putative sterigmatocystin biosynthesis peroxidase stcC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcC PE=3 SV=2 94 283 5.0E-17
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1789 1930 1.0E-12
sp|P04963|PRXC_LEPFU Chloroperoxidase OS=Leptoxyphium fumago GN=CPO PE=1 SV=3 91 284 4.0E-11
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1814 1960 7.0E-11
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1821 1968 2.0E-10
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1903 2063 2.0E-09
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1733 1887 4.0E-09
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1873 2024 5.0E-09
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1946 2076 2.0E-08
sp|B9W4V8|APO1_COPRA Aromatic peroxygenase (Fragments) OS=Coprinellus radians GN=APO PE=1 SV=2 90 283 1.0E-07
sp|P94017|CAP9_ARATH Putative clathrin assembly protein At1g14910 OS=Arabidopsis thaliana GN=At1g14910 PE=2 SV=2 1816 2036 1.0E-07
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1976 2107 3.0E-07
sp|O13936|SPT5_SCHPO Transcription elongation factor spt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt5 PE=1 SV=1 1611 1755 6.0E-07
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 1708 1861 7.0E-07
sp|P94017|CAP9_ARATH Putative clathrin assembly protein At1g14910 OS=Arabidopsis thaliana GN=At1g14910 PE=2 SV=2 1852 1981 1.0E-06
sp|O13936|SPT5_SCHPO Transcription elongation factor spt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt5 PE=1 SV=1 1546 1740 2.0E-06
sp|O13936|SPT5_SCHPO Transcription elongation factor spt5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spt5 PE=1 SV=1 1620 1805 2.0E-06
sp|Q49537|VLPE_MYCHR Variant surface antigen E OS=Mycoplasma hyorhinis GN=vlpE PE=4 SV=1 2042 2154 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004601 peroxidase activity Yes
GO:0003674 molecular_function No
GO:0016209 antioxidant activity No
GO:0016684 oxidoreductase activity, acting on peroxide as acceptor No
GO:0003824 catalytic activity No
GO:0016491 oxidoreductase activity No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 19 0.998716

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup10
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01575
Ophiocordyceps camponoti-floridani Ophcf2|04934
Ophiocordyceps camponoti-floridani Ophcf2|04444
Ophiocordyceps camponoti-floridani Ophcf2|03872
Ophiocordyceps camponoti-floridani Ophcf2|01486
Ophiocordyceps camponoti-floridani Ophcf2|01298
Ophiocordyceps camponoti-rufipedis Ophun1|3812
Ophiocordyceps camponoti-rufipedis Ophun1|2843
Ophiocordyceps camponoti-rufipedis Ophun1|2652
Ophiocordyceps camponoti-rufipedis Ophun1|1703
Ophiocordyceps camponoti-rufipedis Ophun1|4097 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5039
Ophiocordyceps kimflemingae Ophio5|3515
Ophiocordyceps kimflemingae Ophio5|6027
Ophiocordyceps kimflemingae Ophio5|5537
Ophiocordyceps kimflemingae Ophio5|1636
Ophiocordyceps kimflemingae Ophio5|1831
Ophiocordyceps kimflemingae Ophio5|3860
Ophiocordyceps subramaniannii Hirsu2|176
Ophiocordyceps subramaniannii Hirsu2|2725
Ophiocordyceps subramaniannii Hirsu2|3527
Ophiocordyceps subramaniannii Hirsu2|4531
Ophiocordyceps subramaniannii Hirsu2|8567
Ophiocordyceps subramaniannii Hirsu2|4975
Ophiocordyceps subramaniannii Hirsu2|5395
Ophiocordyceps subramaniannii Hirsu2|5900
Ophiocordyceps subramaniannii Hirsu2|5920
Ophiocordyceps subramaniannii Hirsu2|7409
Ophiocordyceps subramaniannii Hirsu2|7976
Ophiocordyceps subramaniannii Hirsu2|8011
Ophiocordyceps subramaniannii Hirsu2|1636

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4097
MVGRQLWLFALCGIDAVVGFSQLASFSHTLQQALGNSSIQADSTLQRTTEALMSSSIQQVLMNSYANIESLKAST
AEHLMAGYDTLWQSHPYIPAGPNDSRGPCPTLNALANHGYFKRDGKNLLLSDMLIGLFLGVGLSPELGAIILAFA
ILSAEKPLTGTISLRDLSTHETGIEHDCSMSRQDHAIGDDGVFDPELWAVAYDEMKKSKVLNPIRFGQAKAARVK
DARRLNPKTLFGPKAWFNGFSELGLILSVFGFFPGLAKLDVVNTVFTEERLPYDLGWRPYPFVPNTPVVLAIGAI
STLGDTGAFGTYGSVISQEPAEILQVFLPPSLDHLPELEKLIKNLGFNNGPMKLLSGVMRGLSKQKNPVAEEEKL
TGDKGFHGSGATSFNIPPPGTSLQALGGQNSKIKPPADVIGTLKRLLGIKDKKPNVISGNSNLASLMFPGLGGGS
SGGSGGSNPGSGLFGSPNNGNGVGDNSGGSTGLPSYGNGGFNNPSNGNGGFNNPSNGNGGLNYPNNGNNGFNNPG
GYNNNGNGGYNNPGSSRPGSGYPGYPNNGNNGNNGYNNLGGSRPGYGSPGYPNNGNNGYNNNGNNGYNNPGGYNN
NGNNGYNNPAGSRPGSGSPAYGSYSYRYSSNNPGGTSPNPGSPGFSFSYSNGRGGSGSFNYNNNNNNGGNNYNNL
RARDLSSSIPQYSDIFDPDDFDPENDPDLDIGDLDPDRNSIPWYPHYPPSDPYSYNPKSPGRSPSRPGNNGPSNS
DYGPDPNGPGGPDGYGGSSNYPGSSGGSGSKPKGPGGSSGRPGNNSPGNSGYGPDPNGPGGPDGYGGSSNYPGSS
GGSGSKPKGPGGSSGRPGNNSPGNGYGPDPNGPGGPDGYGGSSNYPGSSGGSGGKPKGPGRPGNNSPSNPGYGPD
PNGPGGIDGYGGSSNYPGTSGGSGSNPNTYGKPKGPGGSSGRPGNNRPSNPGYGPDPNGPGGPDGYGGSGNNPNY
PDLEDPAAHLEAVAMALAIRGTAQVHMVPAATPIAQALDLEDLATHLATQGTETLEGLVPHPTQVMATLVPMAQE
ASLETLEDLVARPATQGMATQVTVALIPTTTETQALDPQVALAATLTTQALDLEDLAAHLATQDTAALVPKVREA
TLITLGTTATRIMATQMTATMIPMTFTETPTMDIQTPAAIPTVQEVRDLEDLADNQATLDMAAPATLDTETRTAQ
GDLDPEDLANNLATRDTATRIPMAQGVLAMEDLVAIPTAQEALDLEDLAANPVTQDTATRIPMAQEVLATEDLAI
HLTTLGTTTPATQGTETRTVQEVPTTGVPATTLTAQEAPLGILDLEVPVAGLATLGTTVPAIQDTEAATPTAREA
LQKTRDLLEMATRQATQDTAMDLVTLEQTDLTARPTARGTEADLTAHLTARGTAADLTARLIARGMEADLTAPPM
ARGLEMDPTAPLMARDMAADLAARDTVTDRTTRLETRDTATDLAAQDTVTDRTIQDTVTDRTIQDMMGLVALDMV
TDLTTLLETRSSGENPNSGSPGGGKTPSNPGYGNGPSNPTKNPGYGDGPGSPGYGDGPDSPGYGDGPDSPGYGDG
PDSPGYGNGPGSSGDGPGNPGYGDGPDTPPNNPGYGDGPDNPGYGNGPGNSGDDNGPGSPGYGNGPDSPGYGEGP
DSPGYGDGPDGPGYGNGPGSPGDGNGPDSPGYGDGPGNPGYDNGPGSPGYGDGPGSPGYGDGPNNPGDGNGAGGP
PSNPGYGDGPGNPPSNPGYGDGPGNPGYGGSKPSSGPPGSGGPGNPPNNPGYGDGPSNPGYDNSNPGSGPPGSKG
PSNPGYGNGPSNPPSNPGYGDGPSSPPSNPGYGDGPSNPPSNPGYGDGPDNSPNNPGYGDGPGSPPSNPGYGDGP
DNPPNNPGYGDGPGNPPSNPPSNPGYGDGPDNSPNNPGYGDGPGNPPSNPGYGDGPGNPPSKPPKNPGYGDGPNS
PPNNPGYGNGPSNPPSNPPSNPGYGDGPDNSPDNPGYGNGPGNPPSNPGYGDGPGSQPTNPGYGDGPGNVPSNPP
SNPGYGDGPGNPPSNPPSNPGYGDGPSNPPSNPGYGDGPDNPPSNPGYGDGPGNPPSNPPNNPGYGDPGYGDRPG
NPGDGDGPGSPGYGDGPDNSPSNPGYGDGPGDSPTNPGYGDGPDNSPTNPGYGESNPGYGEPDSGYPDSGYPDGS
DNDGPPQNPGYGDSNGSGDSGGYGGDGSGSYDGSDTDPFNPPDGSPDGSTDYPAYGNPNGSYDNEGYGGDNVADF
DGSDNNPFGPPNGPPDGPPNGPPNGPPENPGYGDSNGSGGSDSYGGNDSGSPNGPPDGPPDGPPNGPPDGPPENP
GYGDSSGPGGSDGYGGNDSGYPNGPPDGPPNGPPDGPPENPGYGDSSGSGDSNGYGGDDSGSPNGPPDGPPDGPP
DGPPDGPPSNPGYGDASGPGGPDGYGGNSGSPNGPNPFNPPNGPPNGPPSNPPDNSGYGDPNGPGGPDGYGGSDN
GSPDDPSNNPFSYNNPNGPAGSNGNPGSGGPGNSPNNPGYGGSNGPTGPGYNPNGSEGPGYGPDGPTNPGYNPNG
PGGNNGPGGPGYGPDGPTNPGYNPNGPGGNNPGNNPNGPGGPGYGPDGPTNPGYNPNGPGGDSPGYNPNGPGGPN
SPGGNNPGNNPGNNPFSYNNPNNPSDPSYNPNGPAIDPDSLADPGYGNPSYSNPGTTPTSSNPIKDLLNKDQSLT
GKLFPDGSPLALGGTVGRTQNGGLGFDVNGGIGVPGLGINLGLSGGADGKNVGLNNNVGVTLGDKTYGFNLNNGL
SNNGGGITPYSTAQAGSNPLDAGSILGAYDPNKQGAKGGGVDFVDQVKNLKVPEGVSNLLGL*
Coding >Ophun1|4097
ATGGTGGGCCGACAGCTATGGCTCTTTGCCCTCTGCGGCATAGACGCCGTCGTCGGCTTCTCGCAACTGGCCAGC
TTTTCACACACGCTGCAGCAGGCATTGGGCAACAGCTCGATACAGGCTGACAGCACACTTCAGAGGACAACAGAG
GCGCTGATGAGCAGCTCCATACAGCAAGTCTTGATGAACAGCTACGCCAACATCGAGTCTCTCAAGGCATCGACG
GCTGAGCACCTGATGGCCGGATATGACACGCTGTGGCAGTCGCATCCGTATATTCCCGCGGGACCCAACGACTCA
CGAGGCCCCTGTCCAACCCTCAACGCCCTGGCCAACCACGGCTACTTCAAACGCGACGGCAAGAACCTCCTTCTG
TCCGATATGCTCATCGGCCTCTTCCTCGGCGTCGGCCTCTCCCCCGAACTGGGCGCCATCATCTTGGCCTTTGCC
ATCCTATCAGCGGAAAAGCCGCTGACGGGCACTATAAGTCTCCGTGATCTGTCCACGCACGAGACGGGCATCGAA
CATGATTGCAGCATGTCTCGACAGGACCATGCCATCGGTGACGACGGCGTCTTCGACCCGGAGTTATGGGCTGTC
GCCTATGACGAGATGAAGAAGAGTAAAGTGTTGAATCCCATTCGCTTTGGCCAGGCCAAAGCCGCGCGTGTCAAG
GACGCCAGAAGACTGAATCCCAAGACCCTGTTCGGGCCCAAAGCTTGGTTCAACGGTTTCTCTGAATTGGGCCTC
ATTCTATCAGTCTTTGGCTTCTTTCCTGGTCTGGCTAAGCTGGATGTAGTCAACACTGTCTTCACGGAGGAGAGG
TTGCCGTATGATCTCGGCTGGCGGCCCTATCCCTTTGTTCCCAACACGCCTGTCGTTCTGGCTATTGGCGCCATT
TCCACCCTCGGTGATACCGGGGCCTTTGGAACTTATGGCAGCGTGATTAGCCAGGAACCAGCCGAAATCTTGCAA
GTCTTCTTGCCCCCTTCGCTCGACCACCTTCCCGAGCTCGAGAAGCTCATTAAAAACCTTGGCTTCAACAACGGT
CCCATGAAGCTCCTCAGCGGCGTCATGAGGGGCCTCTCCAAGCAGAAGAACCCGGTGGCCGAGGAGGAGAAACTC
ACGGGAGACAAGGGCTTCCACGGCTCTGGCGCCACGTCCTTCAACATCCCGCCCCCGGGCACCAGTCTTCAAGCC
CTGGGCGGCCAGAACTCGAAGATCAAGCCCCCTGCAGACGTCATTGGTACCCTCAAGCGTCTTCTCGGTATCAAG
GACAAGAAACCGAATGTGATCTCCGGAAACAGCAACTTGGCTAGCTTGATGTTTCCAGGTCTCGGTGGTGGTAGT
TCTGGCGGGTCAGGGGGCTCCAATCCTGGTTCTGGATTGTTTGGATCTCCCAACAACGGTAATGGCGTTGGTGAC
AATTCAGGAGGCTCTACTGGATTACCTAGTTACGGTAATGGCGGCTTTAATAATCCAAGCAACGGCAATGGCGGC
TTCAACAACCCAAGCAACGGTAATGGGGGCTTGAATTATCCAAACAACGGTAATAACGGCTTCAACAATCCAGGG
GGCTACAACAACAATGGTAATGGCGGCTACAACAACCCCGGGAGCTCTCGCCCTGGATCTGGATATCCCGGATAT
CCTAACAACGGTAACAACGGTAATAATGGCTACAACAACCTAGGAGGCTCTCGCCCTGGATATGGATCTCCCGGA
TATCCCAACAACGGTAACAATGGCTATAACAACAACGGTAATAATGGCTACAACAACCCCGGGGGCTATAACAAC
AACGGCAATAATGGCTACAACAACCCGGCAGGCTCTCGCCCTGGCTCTGGGTCTCCTGCATATGGCAGTTACAGT
TATCGTTACAGTAGCAACAACCCGGGAGGCACTAGTCCTAACCCTGGATCGCCCGGGTTCTCTTTCAGTTACAGC
AATGGCCGAGGGGGCTCTGGATCCTTCAATTACAACAACAACAACAACAATGGGGGAAATAACTACAACAACCTC
AGAGCCAGAGACCTCAGCTCCAGCATCCCCCAATACAGCGACATCTTTGATCCAGATGATTTCGACCCTGAGAAC
GATCCTGACCTGGACATTGGTGATTTGGACCCTGATAGAAATTCCATCCCTTGGTATCCTCACTACCCTCCCAGC
GATCCTTACAGCTACAACCCCAAGAGCCCGGGGAGATCACCTAGTAGGCCCGGGAACAACGGCCCGAGCAACTCG
GATTACGGCCCGGACCCCAACGGCCCAGGTGGTCCTGATGGCTACGGAGGATCGAGTAACTATCCTGGATCCTCG
GGAGGTTCTGGCAGCAAGCCCAAGGGTCCAGGTGGTTCGTCCGGTAGACCTGGGAACAACAGCCCCGGCAATTCA
GGATACGGCCCTGATCCAAACGGTCCAGGTGGTCCCGATGGCTACGGAGGATCGAGTAACTATCCTGGATCCTCG
GGAGGTTCTGGCAGCAAGCCCAAGGGTCCAGGTGGTTCATCCGGTAGACCTGGGAACAACAGCCCTGGCAATGGA
TACGGCCCCGATCCAAACGGTCCAGGTGGTCCCGATGGCTACGGAGGATCAAGCAACTACCCTGGATCCTCGGGA
GGTTCTGGCGGCAAGCCCAAGGGTCCAGGCAGACCTGGAAATAACAGCCCCAGCAATCCAGGGTACGGCCCAGAT
CCCAACGGCCCAGGAGGTATCGATGGCTACGGGGGTTCGAGTAACTACCCTGGGACTTCGGGGGGTTCTGGTAGC
AACCCCAACACTTATGGCAAGCCCAAGGGTCCAGGTGGTTCATCCGGTAGACCCGGGAATAATCGCCCCAGCAAT
CCAGGATATGGCCCTGACCCGAACGGTCCGGGAGGCCCCGATGGCTACGGAGGTTCAGGCAACAACCCCAATTAC
CCAGACCTGGAGGACCCGGCAGCTCACCTGGAAGCGGTGGCAATGGCCCTAGCAATCCGGGGTACGGCTCAAGTC
CATATGGTCCCGGCCGCAACCCCAATAGCCCAGGCTCTGGACCTAGAGGACCTGGCAACTCACCTGGCAACCCAG
GGTACGGAAACTCTGGAAGGCCTGGTACCTCACCCAACCCAGGTTATGGCAACTCTGGTCCCAATGGCCCAGGAG
GCTTCCCTGGAAACTCTGGAGGACCTGGTCGCTCGCCCAGCAACCCAGGGTATGGCAACCCAAGTTACGGTGGCT
CTAATCCCAACAACTACGGAAACCCAGGCTCTGGATCCCCAAGTGGCCCTGGCCGCAACCCTAACAACTCAGGCT
CTGGACCTAGAGGACCTGGCAGCTCACCTAGCAACCCAGGATACGGCAGCTCTGGTCCCCAAGGTCCGGGAGGCT
ACCCTGATTACTCTGGGTACTACGGCGACTCGGATTATGGCGACCCAGATGACGGCGACTATGATCCCGATGACA
TTTACGGAGACCCCGACTATGGATATCCAAACTCCGGCGGCAATCCCTACGGTCCAGGAGGTTCGAGACCTGGAG
GACCTGGCAGACAACCAAGCAACCCTGGATATGGCGGCCCCGGCAACCCTGGATACGGAAACTCGAACGGCCCAG
GGGGATCTGGACCCGGAGGACCTGGCAAACAACCTGGCAACCCGGGATACGGCAACTCGAATCCCAATGGCCCAG
GGGGTCCTGGCTATGGAGGATCTGGTAGCAATCCCAACGGCCCAGGAGGCTCTAGACCTGGAGGACCTGGCAGCA
AACCCAGTAACCCAGGATACGGCAACTCGAATCCCAATGGCCCAGGAGGTCCTGGCTACGGAGGATCTGGCAATT
CACCTAACAACCCTGGGTACAACAACCCCAGCAACCCAGGGTACGGAGACTCGAACGGTCCAGGAGGTCCCAACT
ACGGGGGTTCCGGCAACAACCCTTACGGCCCAGGAGGCTCCTCTGGGAATCCTGGATCTGGAGGTCCCGGTAGCC
GGCCTGGCAACTCTGGGAACAACGGTCCCAGCAATCCAGGATACGGAGGCGGCAACCCCAACGGCCCGGGAGGCC
CTTCAAAAAACCCGGGATCTTCTGGAAATGGCAACTCGCCAAGCAACCCAGGATACGGCAATGGACCTGGTAACT
CTGGAACAGACGGACCTAACAGCTCGCCCGACGGCCCGTGGTACGGAGGCGGATCTGACGGCTCATCTGACAGCC
CGTGGTACGGCGGCGGATCTGACGGCTCGCCTGATAGCTCGTGGGATGGAGGCGGATCTGACGGCTCCCCCGATG
GCCCGTGGTTTGGAGATGGATCCGACGGCTCCCCTGATGGCCCGGGATATGGCGGCGGACCTGGCAGCCCGGGAT
ACGGTGACGGATCGGACAACTCGCCTGGAAACCCGGGATACGGCAACGGACCTGGCAGCCCAGGATACGGTGACG
GATCGGACAATCCAGGATACGGTGACGGATCGGACAATCCAGGATATGATGGGCCTGGTAGCCCTGGATATGGTG
ACGGATCTGACAACTCTCCTGGAAACCCGGAGCTCTGGGGAGAATCCCAATTCTGGATCTCCGGGCGGCGGCAAA
ACTCCAAGCAACCCAGGATACGGCAACGGGCCAAGCAACCCAACGAAAAACCCAGGTTACGGCGATGGACCTGGC
AGTCCGGGTTACGGCGATGGACCGGACAGTCCAGGATACGGTGACGGACCCGACAGTCCAGGATACGGCGATGGG
CCAGATAGTCCGGGATACGGTAACGGACCGGGCAGTTCAGGAGACGGACCTGGCAATCCGGGATACGGCGACGGA
CCAGACACCCCTCCGAATAACCCCGGTTACGGCGACGGACCGGACAATCCGGGATATGGCAACGGACCGGGCAAT
TCAGGAGACGATAACGGACCTGGCAGCCCGGGATACGGTAACGGGCCAGACAGTCCAGGATACGGCGAGGGGCCA
GATAGTCCGGGTTACGGCGATGGGCCAGACGGTCCGGGTTACGGTAACGGACCGGGCAGTCCAGGAGACGGTAAC
GGGCCAGACAGCCCGGGATACGGCGATGGACCGGGCAATCCGGGATACGATAACGGACCTGGCAGCCCGGGTTAC
GGCGACGGACCAGGCAGTCCGGGATACGGCGATGGACCTAATAATCCGGGTGACGGCAACGGAGCCGGGGGCCCA
CCTAGCAACCCAGGATACGGAGACGGGCCGGGTAACCCACCGAGTAATCCAGGATACGGAGACGGGCCAGGCAAT
CCGGGATACGGCGGCTCAAAACCTAGCTCCGGGCCCCCAGGCAGTGGAGGGCCCGGCAACCCGCCGAATAATCCG
GGATACGGAGACGGACCGAGCAACCCGGGATACGACAACTCTAACCCCGGCTCCGGGCCTCCGGGCAGCAAAGGT
CCTAGCAATCCAGGGTACGGCAACGGGCCTAGCAACCCTCCGAGCAACCCAGGATACGGTGACGGGCCTAGCAGC
CCGCCTAGCAATCCGGGGTACGGAGACGGACCTAGCAATCCTCCAAGCAACCCAGGATACGGTGACGGACCTGAC
AACTCGCCTAACAACCCCGGATACGGTGACGGACCTGGAAGTCCTCCAAGCAATCCGGGGTACGGCGACGGACCT
GACAACCCGCCTAACAACCCCGGATACGGCGACGGGCCTGGCAACCCTCCGAGCAACCCCCCGAGCAACCCGGGG
TACGGTGACGGACCTGATAACTCGCCTAACAACCCCGGATACGGTGACGGACCTGGCAATCCTCCAAGCAATCCA
GGTTACGGCGACGGGCCTGGCAATCCGCCTAGCAAGCCGCCCAAAAATCCAGGGTACGGCGACGGACCCAACAGC
CCGCCTAACAACCCAGGATATGGTAACGGACCTAGTAACCCTCCGAGCAACCCCCCGAGCAACCCGGGATACGGT
GACGGACCTGATAACTCGCCTGACAACCCCGGATACGGTAACGGACCTGGAAACCCTCCAAGCAATCCAGGTTAC
GGCGACGGGCCTGGTAGCCAACCTACCAACCCAGGATATGGTGACGGACCTGGCAACGTCCCGAGCAACCCCCCG
AGCAACCCAGGATACGGAGACGGACCTGGCAACCCCCCGAGCAACCCTCCGAGCAACCCAGGATACGGAGACGGA
CCTAGCAATCCTCCAAGCAACCCAGGATACGGAGACGGACCTGACAACCCCCCGAGCAACCCAGGCTACGGAGAC
GGACCTGGCAACCCTCCGAGCAACCCTCCAAATAACCCAGGTTACGGCGACCCAGGTTACGGCGACAGACCGGGC
AATCCAGGAGACGGTGACGGACCTGGCAGCCCGGGATACGGAGACGGGCCTGACAACTCGCCTAGTAACCCAGGA
TACGGTGACGGACCAGGCGATTCGCCTACCAACCCGGGATACGGAGACGGACCCGACAACTCGCCTACCAATCCA
GGGTACGGTGAATCCAACCCCGGCTACGGGGAGCCTGACTCTGGGTATCCCGACTCTGGATACCCTGACGGTTCC
GACAATGACGGCCCTCCTCAAAACCCAGGATATGGTGATTCCAACGGCTCAGGAGATTCCGGCGGTTACGGAGGC
GATGGGTCTGGGAGTTACGACGGTTCTGACACCGATCCTTTCAACCCTCCTGACGGTTCTCCTGACGGTTCGACT
GATTATCCAGCGTACGGAAATCCCAATGGCTCGTACGACAACGAAGGCTACGGGGGCGATAATGTTGCGGATTTT
GACGGATCTGACAACAATCCCTTCGGTCCTCCTAACGGTCCCCCCGACGGACCCCCTAATGGCCCTCCTAACGGT
CCGCCTGAGAATCCGGGATACGGAGATTCCAACGGTTCGGGGGGTTCGGACAGCTACGGAGGTAACGACTCTGGG
TCTCCCAACGGTCCTCCTGACGGTCCTCCCGACGGTCCCCCTAATGGCCCTCCTGACGGTCCGCCTGAGAATCCG
GGATACGGAGATTCTAGCGGTCCAGGGGGTTCGGACGGCTATGGAGGTAACGACTCTGGGTATCCTAACGGTCCT
CCTGACGGTCCCCCTAATGGCCCGCCTGACGGTCCGCCTGAGAATCCGGGATACGGAGATTCCAGCGGTTCAGGA
GACTCAAACGGCTACGGAGGTGACGACTCTGGGTCTCCTAACGGTCCTCCTGATGGTCCTCCTGATGGTCCTCCT
GACGGTCCTCCTGACGGTCCGCCTAGCAACCCAGGTTACGGAGATGCTAGCGGCCCAGGAGGTCCAGATGGTTAC
GGGGGCAACTCTGGTTCTCCCAACGGTCCTAATCCTTTCAACCCTCCTAACGGGCCCCCTAACGGGCCTCCTAGC
AACCCGCCTGACAACTCGGGATACGGAGACCCCAACGGCCCGGGAGGACCAGACGGCTACGGAGGAAGCGACAAT
GGCTCTCCCGACGATCCTAGCAACAATCCTTTCAGCTACAACAACCCCAACGGCCCGGCAGGCTCTAATGGGAAT
CCTGGATCTGGCGGACCTGGCAACTCGCCCAACAACCCAGGATATGGAGGGTCCAACGGCCCAACAGGACCAGGT
TACAACCCCAACGGTTCAGAAGGTCCTGGCTATGGTCCTGATGGCCCGACAAACCCGGGTTACAACCCCAACGGC
CCAGGAGGTAACAACGGCCCAGGAGGTCCAGGCTATGGTCCTGATGGCCCGACCAACCCGGGCTACAACCCCAAC
GGCCCAGGAGGTAACAACCCCGGCAACAACCCCAACGGCCCTGGAGGCCCAGGCTATGGTCCTGATGGCCCGACA
AACCCGGGTTACAATCCCAACGGTCCAGGAGGTGACAGCCCCGGCTACAACCCCAACGGCCCAGGGGGTCCCAAC
AGTCCAGGAGGTAACAACCCCGGCAACAACCCAGGCAACAACCCTTTCAGCTACAACAACCCCAACAACCCATCA
GACCCGAGTTACAACCCCAACGGCCCAGCAATCGATCCCGACAGCCTGGCAGACCCAGGCTACGGCAACCCCAGC
TACTCCAACCCCGGCACCACGCCCACGTCCAGCAACCCGATCAAGGACCTCCTCAACAAGGATCAATCCCTCACC
GGCAAGCTCTTCCCCGACGGCTCACCCCTCGCCCTGGGCGGCACCGTGGGCAGGACCCAAAACGGCGGGCTGGGC
TTCGACGTCAACGGCGGCATCGGCGTCCCTGGCCTGGGCATCAACCTCGGCCTCTCGGGCGGTGCCGACGGTAAG
AACGTGGGCCTGAACAACAACGTCGGCGTCACGCTGGGAGACAAGACGTACGGCTTCAACCTGAACAATGGACTC
AGCAACAACGGCGGCGGTATCACGCCCTACTCCACCGCTCAGGCCGGCTCGAACCCTCTCGACGCTGGCTCCATT
CTTGGCGCCTACGACCCTAACAAGCAGGGGGCCAAGGGCGGAGGCGTGGACTTTGTGGACCAGGTGAAGAACTTG
AAGGTGCCGGAGGGTGTTAGCAACCTGCTCGGCTTGTAA
Transcript >Ophun1|4097
ATGGTGGGCCGACAGCTATGGCTCTTTGCCCTCTGCGGCATAGACGCCGTCGTCGGCTTCTCGCAACTGGCCAGC
TTTTCACACACGCTGCAGCAGGCATTGGGCAACAGCTCGATACAGGCTGACAGCACACTTCAGAGGACAACAGAG
GCGCTGATGAGCAGCTCCATACAGCAAGTCTTGATGAACAGCTACGCCAACATCGAGTCTCTCAAGGCATCGACG
GCTGAGCACCTGATGGCCGGATATGACACGCTGTGGCAGTCGCATCCGTATATTCCCGCGGGACCCAACGACTCA
CGAGGCCCCTGTCCAACCCTCAACGCCCTGGCCAACCACGGCTACTTCAAACGCGACGGCAAGAACCTCCTTCTG
TCCGATATGCTCATCGGCCTCTTCCTCGGCGTCGGCCTCTCCCCCGAACTGGGCGCCATCATCTTGGCCTTTGCC
ATCCTATCAGCGGAAAAGCCGCTGACGGGCACTATAAGTCTCCGTGATCTGTCCACGCACGAGACGGGCATCGAA
CATGATTGCAGCATGTCTCGACAGGACCATGCCATCGGTGACGACGGCGTCTTCGACCCGGAGTTATGGGCTGTC
GCCTATGACGAGATGAAGAAGAGTAAAGTGTTGAATCCCATTCGCTTTGGCCAGGCCAAAGCCGCGCGTGTCAAG
GACGCCAGAAGACTGAATCCCAAGACCCTGTTCGGGCCCAAAGCTTGGTTCAACGGTTTCTCTGAATTGGGCCTC
ATTCTATCAGTCTTTGGCTTCTTTCCTGGTCTGGCTAAGCTGGATGTAGTCAACACTGTCTTCACGGAGGAGAGG
TTGCCGTATGATCTCGGCTGGCGGCCCTATCCCTTTGTTCCCAACACGCCTGTCGTTCTGGCTATTGGCGCCATT
TCCACCCTCGGTGATACCGGGGCCTTTGGAACTTATGGCAGCGTGATTAGCCAGGAACCAGCCGAAATCTTGCAA
GTCTTCTTGCCCCCTTCGCTCGACCACCTTCCCGAGCTCGAGAAGCTCATTAAAAACCTTGGCTTCAACAACGGT
CCCATGAAGCTCCTCAGCGGCGTCATGAGGGGCCTCTCCAAGCAGAAGAACCCGGTGGCCGAGGAGGAGAAACTC
ACGGGAGACAAGGGCTTCCACGGCTCTGGCGCCACGTCCTTCAACATCCCGCCCCCGGGCACCAGTCTTCAAGCC
CTGGGCGGCCAGAACTCGAAGATCAAGCCCCCTGCAGACGTCATTGGTACCCTCAAGCGTCTTCTCGGTATCAAG
GACAAGAAACCGAATGTGATCTCCGGAAACAGCAACTTGGCTAGCTTGATGTTTCCAGGTCTCGGTGGTGGTAGT
TCTGGCGGGTCAGGGGGCTCCAATCCTGGTTCTGGATTGTTTGGATCTCCCAACAACGGTAATGGCGTTGGTGAC
AATTCAGGAGGCTCTACTGGATTACCTAGTTACGGTAATGGCGGCTTTAATAATCCAAGCAACGGCAATGGCGGC
TTCAACAACCCAAGCAACGGTAATGGGGGCTTGAATTATCCAAACAACGGTAATAACGGCTTCAACAATCCAGGG
GGCTACAACAACAATGGTAATGGCGGCTACAACAACCCCGGGAGCTCTCGCCCTGGATCTGGATATCCCGGATAT
CCTAACAACGGTAACAACGGTAATAATGGCTACAACAACCTAGGAGGCTCTCGCCCTGGATATGGATCTCCCGGA
TATCCCAACAACGGTAACAATGGCTATAACAACAACGGTAATAATGGCTACAACAACCCCGGGGGCTATAACAAC
AACGGCAATAATGGCTACAACAACCCGGCAGGCTCTCGCCCTGGCTCTGGGTCTCCTGCATATGGCAGTTACAGT
TATCGTTACAGTAGCAACAACCCGGGAGGCACTAGTCCTAACCCTGGATCGCCCGGGTTCTCTTTCAGTTACAGC
AATGGCCGAGGGGGCTCTGGATCCTTCAATTACAACAACAACAACAACAATGGGGGAAATAACTACAACAACCTC
AGAGCCAGAGACCTCAGCTCCAGCATCCCCCAATACAGCGACATCTTTGATCCAGATGATTTCGACCCTGAGAAC
GATCCTGACCTGGACATTGGTGATTTGGACCCTGATAGAAATTCCATCCCTTGGTATCCTCACTACCCTCCCAGC
GATCCTTACAGCTACAACCCCAAGAGCCCGGGGAGATCACCTAGTAGGCCCGGGAACAACGGCCCGAGCAACTCG
GATTACGGCCCGGACCCCAACGGCCCAGGTGGTCCTGATGGCTACGGAGGATCGAGTAACTATCCTGGATCCTCG
GGAGGTTCTGGCAGCAAGCCCAAGGGTCCAGGTGGTTCGTCCGGTAGACCTGGGAACAACAGCCCCGGCAATTCA
GGATACGGCCCTGATCCAAACGGTCCAGGTGGTCCCGATGGCTACGGAGGATCGAGTAACTATCCTGGATCCTCG
GGAGGTTCTGGCAGCAAGCCCAAGGGTCCAGGTGGTTCATCCGGTAGACCTGGGAACAACAGCCCTGGCAATGGA
TACGGCCCCGATCCAAACGGTCCAGGTGGTCCCGATGGCTACGGAGGATCAAGCAACTACCCTGGATCCTCGGGA
GGTTCTGGCGGCAAGCCCAAGGGTCCAGGCAGACCTGGAAATAACAGCCCCAGCAATCCAGGGTACGGCCCAGAT
CCCAACGGCCCAGGAGGTATCGATGGCTACGGGGGTTCGAGTAACTACCCTGGGACTTCGGGGGGTTCTGGTAGC
AACCCCAACACTTATGGCAAGCCCAAGGGTCCAGGTGGTTCATCCGGTAGACCCGGGAATAATCGCCCCAGCAAT
CCAGGATATGGCCCTGACCCGAACGGTCCGGGAGGCCCCGATGGCTACGGAGGTTCAGGCAACAACCCCAATTAC
CCAGACCTGGAGGACCCGGCAGCTCACCTGGAAGCGGTGGCAATGGCCCTAGCAATCCGGGGTACGGCTCAAGTC
CATATGGTCCCGGCCGCAACCCCAATAGCCCAGGCTCTGGACCTAGAGGACCTGGCAACTCACCTGGCAACCCAG
GGTACGGAAACTCTGGAAGGCCTGGTACCTCACCCAACCCAGGTTATGGCAACTCTGGTCCCAATGGCCCAGGAG
GCTTCCCTGGAAACTCTGGAGGACCTGGTCGCTCGCCCAGCAACCCAGGGTATGGCAACCCAAGTTACGGTGGCT
CTAATCCCAACAACTACGGAAACCCAGGCTCTGGATCCCCAAGTGGCCCTGGCCGCAACCCTAACAACTCAGGCT
CTGGACCTAGAGGACCTGGCAGCTCACCTAGCAACCCAGGATACGGCAGCTCTGGTCCCCAAGGTCCGGGAGGCT
ACCCTGATTACTCTGGGTACTACGGCGACTCGGATTATGGCGACCCAGATGACGGCGACTATGATCCCGATGACA
TTTACGGAGACCCCGACTATGGATATCCAAACTCCGGCGGCAATCCCTACGGTCCAGGAGGTTCGAGACCTGGAG
GACCTGGCAGACAACCAAGCAACCCTGGATATGGCGGCCCCGGCAACCCTGGATACGGAAACTCGAACGGCCCAG
GGGGATCTGGACCCGGAGGACCTGGCAAACAACCTGGCAACCCGGGATACGGCAACTCGAATCCCAATGGCCCAG
GGGGTCCTGGCTATGGAGGATCTGGTAGCAATCCCAACGGCCCAGGAGGCTCTAGACCTGGAGGACCTGGCAGCA
AACCCAGTAACCCAGGATACGGCAACTCGAATCCCAATGGCCCAGGAGGTCCTGGCTACGGAGGATCTGGCAATT
CACCTAACAACCCTGGGTACAACAACCCCAGCAACCCAGGGTACGGAGACTCGAACGGTCCAGGAGGTCCCAACT
ACGGGGGTTCCGGCAACAACCCTTACGGCCCAGGAGGCTCCTCTGGGAATCCTGGATCTGGAGGTCCCGGTAGCC
GGCCTGGCAACTCTGGGAACAACGGTCCCAGCAATCCAGGATACGGAGGCGGCAACCCCAACGGCCCGGGAGGCC
CTTCAAAAAACCCGGGATCTTCTGGAAATGGCAACTCGCCAAGCAACCCAGGATACGGCAATGGACCTGGTAACT
CTGGAACAGACGGACCTAACAGCTCGCCCGACGGCCCGTGGTACGGAGGCGGATCTGACGGCTCATCTGACAGCC
CGTGGTACGGCGGCGGATCTGACGGCTCGCCTGATAGCTCGTGGGATGGAGGCGGATCTGACGGCTCCCCCGATG
GCCCGTGGTTTGGAGATGGATCCGACGGCTCCCCTGATGGCCCGGGATATGGCGGCGGACCTGGCAGCCCGGGAT
ACGGTGACGGATCGGACAACTCGCCTGGAAACCCGGGATACGGCAACGGACCTGGCAGCCCAGGATACGGTGACG
GATCGGACAATCCAGGATACGGTGACGGATCGGACAATCCAGGATATGATGGGCCTGGTAGCCCTGGATATGGTG
ACGGATCTGACAACTCTCCTGGAAACCCGGAGCTCTGGGGAGAATCCCAATTCTGGATCTCCGGGCGGCGGCAAA
ACTCCAAGCAACCCAGGATACGGCAACGGGCCAAGCAACCCAACGAAAAACCCAGGTTACGGCGATGGACCTGGC
AGTCCGGGTTACGGCGATGGACCGGACAGTCCAGGATACGGTGACGGACCCGACAGTCCAGGATACGGCGATGGG
CCAGATAGTCCGGGATACGGTAACGGACCGGGCAGTTCAGGAGACGGACCTGGCAATCCGGGATACGGCGACGGA
CCAGACACCCCTCCGAATAACCCCGGTTACGGCGACGGACCGGACAATCCGGGATATGGCAACGGACCGGGCAAT
TCAGGAGACGATAACGGACCTGGCAGCCCGGGATACGGTAACGGGCCAGACAGTCCAGGATACGGCGAGGGGCCA
GATAGTCCGGGTTACGGCGATGGGCCAGACGGTCCGGGTTACGGTAACGGACCGGGCAGTCCAGGAGACGGTAAC
GGGCCAGACAGCCCGGGATACGGCGATGGACCGGGCAATCCGGGATACGATAACGGACCTGGCAGCCCGGGTTAC
GGCGACGGACCAGGCAGTCCGGGATACGGCGATGGACCTAATAATCCGGGTGACGGCAACGGAGCCGGGGGCCCA
CCTAGCAACCCAGGATACGGAGACGGGCCGGGTAACCCACCGAGTAATCCAGGATACGGAGACGGGCCAGGCAAT
CCGGGATACGGCGGCTCAAAACCTAGCTCCGGGCCCCCAGGCAGTGGAGGGCCCGGCAACCCGCCGAATAATCCG
GGATACGGAGACGGACCGAGCAACCCGGGATACGACAACTCTAACCCCGGCTCCGGGCCTCCGGGCAGCAAAGGT
CCTAGCAATCCAGGGTACGGCAACGGGCCTAGCAACCCTCCGAGCAACCCAGGATACGGTGACGGGCCTAGCAGC
CCGCCTAGCAATCCGGGGTACGGAGACGGACCTAGCAATCCTCCAAGCAACCCAGGATACGGTGACGGACCTGAC
AACTCGCCTAACAACCCCGGATACGGTGACGGACCTGGAAGTCCTCCAAGCAATCCGGGGTACGGCGACGGACCT
GACAACCCGCCTAACAACCCCGGATACGGCGACGGGCCTGGCAACCCTCCGAGCAACCCCCCGAGCAACCCGGGG
TACGGTGACGGACCTGATAACTCGCCTAACAACCCCGGATACGGTGACGGACCTGGCAATCCTCCAAGCAATCCA
GGTTACGGCGACGGGCCTGGCAATCCGCCTAGCAAGCCGCCCAAAAATCCAGGGTACGGCGACGGACCCAACAGC
CCGCCTAACAACCCAGGATATGGTAACGGACCTAGTAACCCTCCGAGCAACCCCCCGAGCAACCCGGGATACGGT
GACGGACCTGATAACTCGCCTGACAACCCCGGATACGGTAACGGACCTGGAAACCCTCCAAGCAATCCAGGTTAC
GGCGACGGGCCTGGTAGCCAACCTACCAACCCAGGATATGGTGACGGACCTGGCAACGTCCCGAGCAACCCCCCG
AGCAACCCAGGATACGGAGACGGACCTGGCAACCCCCCGAGCAACCCTCCGAGCAACCCAGGATACGGAGACGGA
CCTAGCAATCCTCCAAGCAACCCAGGATACGGAGACGGACCTGACAACCCCCCGAGCAACCCAGGCTACGGAGAC
GGACCTGGCAACCCTCCGAGCAACCCTCCAAATAACCCAGGTTACGGCGACCCAGGTTACGGCGACAGACCGGGC
AATCCAGGAGACGGTGACGGACCTGGCAGCCCGGGATACGGAGACGGGCCTGACAACTCGCCTAGTAACCCAGGA
TACGGTGACGGACCAGGCGATTCGCCTACCAACCCGGGATACGGAGACGGACCCGACAACTCGCCTACCAATCCA
GGGTACGGTGAATCCAACCCCGGCTACGGGGAGCCTGACTCTGGGTATCCCGACTCTGGATACCCTGACGGTTCC
GACAATGACGGCCCTCCTCAAAACCCAGGATATGGTGATTCCAACGGCTCAGGAGATTCCGGCGGTTACGGAGGC
GATGGGTCTGGGAGTTACGACGGTTCTGACACCGATCCTTTCAACCCTCCTGACGGTTCTCCTGACGGTTCGACT
GATTATCCAGCGTACGGAAATCCCAATGGCTCGTACGACAACGAAGGCTACGGGGGCGATAATGTTGCGGATTTT
GACGGATCTGACAACAATCCCTTCGGTCCTCCTAACGGTCCCCCCGACGGACCCCCTAATGGCCCTCCTAACGGT
CCGCCTGAGAATCCGGGATACGGAGATTCCAACGGTTCGGGGGGTTCGGACAGCTACGGAGGTAACGACTCTGGG
TCTCCCAACGGTCCTCCTGACGGTCCTCCCGACGGTCCCCCTAATGGCCCTCCTGACGGTCCGCCTGAGAATCCG
GGATACGGAGATTCTAGCGGTCCAGGGGGTTCGGACGGCTATGGAGGTAACGACTCTGGGTATCCTAACGGTCCT
CCTGACGGTCCCCCTAATGGCCCGCCTGACGGTCCGCCTGAGAATCCGGGATACGGAGATTCCAGCGGTTCAGGA
GACTCAAACGGCTACGGAGGTGACGACTCTGGGTCTCCTAACGGTCCTCCTGATGGTCCTCCTGATGGTCCTCCT
GACGGTCCTCCTGACGGTCCGCCTAGCAACCCAGGTTACGGAGATGCTAGCGGCCCAGGAGGTCCAGATGGTTAC
GGGGGCAACTCTGGTTCTCCCAACGGTCCTAATCCTTTCAACCCTCCTAACGGGCCCCCTAACGGGCCTCCTAGC
AACCCGCCTGACAACTCGGGATACGGAGACCCCAACGGCCCGGGAGGACCAGACGGCTACGGAGGAAGCGACAAT
GGCTCTCCCGACGATCCTAGCAACAATCCTTTCAGCTACAACAACCCCAACGGCCCGGCAGGCTCTAATGGGAAT
CCTGGATCTGGCGGACCTGGCAACTCGCCCAACAACCCAGGATATGGAGGGTCCAACGGCCCAACAGGACCAGGT
TACAACCCCAACGGTTCAGAAGGTCCTGGCTATGGTCCTGATGGCCCGACAAACCCGGGTTACAACCCCAACGGC
CCAGGAGGTAACAACGGCCCAGGAGGTCCAGGCTATGGTCCTGATGGCCCGACCAACCCGGGCTACAACCCCAAC
GGCCCAGGAGGTAACAACCCCGGCAACAACCCCAACGGCCCTGGAGGCCCAGGCTATGGTCCTGATGGCCCGACA
AACCCGGGTTACAATCCCAACGGTCCAGGAGGTGACAGCCCCGGCTACAACCCCAACGGCCCAGGGGGTCCCAAC
AGTCCAGGAGGTAACAACCCCGGCAACAACCCAGGCAACAACCCTTTCAGCTACAACAACCCCAACAACCCATCA
GACCCGAGTTACAACCCCAACGGCCCAGCAATCGATCCCGACAGCCTGGCAGACCCAGGCTACGGCAACCCCAGC
TACTCCAACCCCGGCACCACGCCCACGTCCAGCAACCCGATCAAGGACCTCCTCAACAAGGATCAATCCCTCACC
GGCAAGCTCTTCCCCGACGGCTCACCCCTCGCCCTGGGCGGCACCGTGGGCAGGACCCAAAACGGCGGGCTGGGC
TTCGACGTCAACGGCGGCATCGGCGTCCCTGGCCTGGGCATCAACCTCGGCCTCTCGGGCGGTGCCGACGGTAAG
AACGTGGGCCTGAACAACAACGTCGGCGTCACGCTGGGAGACAAGACGTACGGCTTCAACCTGAACAATGGACTC
AGCAACAACGGCGGCGGTATCACGCCCTACTCCACCGCTCAGGCCGGCTCGAACCCTCTCGACGCTGGCTCCATT
CTTGGCGCCTACGACCCTAACAAGCAGGGGGCCAAGGGCGGAGGCGTGGACTTTGTGGACCAGGTGAAGAACTTG
AAGGTGCCGGAGGGTGTTAGCAACCTGCTCGGCTTGTAA
Gene >Ophun1|4097
ATGGTGGGCCGACAGCTATGGCTCTTTGCCCTCTGCGGCATAGACGCCGTCGTCGGCTTCTCGCAACTGGCCAGC
TTTTCACACACGCTGCAGCAGGCATTGGGCAACAGCTCGATACAGGCTGACAGCACACTTCAGAGGACAACAGAG
GCGCTGATGAGCAGCTCCATACAGCAAGTCTTGATGAACAGCTACGCCAACATCGAGTCTCTCAAGGCATCGACG
GCTGAGCACCTGATGGCCGGATATGACACGCTGTGGCAGTCGCATCCGTATATTCCCGCGGGACCCAACGACTGT
CAGCTAGACCATGCCCGAGCACGTAGCAACAAGAGGGATATAGCAGCTGACTGAAACAACGAACAGCACGAGGCC
CCTGTCCAACCCTCAACGCCCTGGCCAACCACGGCTACTTCAAACGCGACGGCAAGAACCTCCTTCTGTCCGATA
TGCTCATCGGCCTCTTCCTCGGCGTCGGCCTCTCCCCCGAACTGGGCGCCATCATCTTGGCCTTTGCCATCCTAT
CAGCGGAAAAGCCGCTGACGGGCACTATAAGTCTCCGTGATCTGTCCACGCACGAGACGGGCATCGAACATGATT
GCAGCATGTCTCGACAGGACCATGCCATCGGTGACGACGGCGTCTTCGACCCGGAGTTATGGGCTGTCGCCTATG
ACGAGATGAAGAAGAGTAAAGTGTTGAATCCCATTCGCTTTGGCCAGGCCAAAGCCGCGCGTGTCAAGGACGCCA
GAAGACTGAATCCCAAGACCCTGTTCGGGCCCAAAGCTTGGTTCAACGGTTTCTCTGAATTGGGCCTCATTCTAT
CAGTCTTTGGCTTCTTTCCTGGTCTGGCTAAGCTGGATGTAGTCAACACTGTCTTCACGGAGGAGAGGTTGCCGT
ATGATCTCGGCTGGCGGCCCTATCCCTTTGTTCCCAACACGCCTGTCGTTCTGGCTATTGGCGCCATTTCCACCC
TCGGTGATACCGGGGCCTTTGGAACTTATGGCAGCGTGATTAGCCAGGAACCAGCCGTAAGTCTTCCCCTTTGGA
GCCTTTGGAAACATAGACAATGCTGACATTTTGCCTTGAAGGAAATCTTGCAAGTCTTCTTGCCCCCTTCGCTCG
ACCACCTTCCCGAGCTCGAGAAGCTCATTAAAAACCTTGGCTTCAACAACGGTCCCATGAAGCTCCTCAGCGGCG
TCATGAGGGGCCTCTCCAAGCAGAAGAACCCGGTGGCCGAGGAGGAGAAACTCACGGGAGACAAGGGCTTCCACG
GCTCTGGCGCCACGTCCTTCAACATCCCGCCCCCGGGCACCAGTCTTCAAGCCCTGGGCGGCCAGAACTCGAAGA
TCAAGCCCCCTGCAGACGTCATTGGTACCCTCAAGCGTCTTCTCGGTATCAAGGACAAGAAACCGAATGTGATCT
CCGGAAACAGCAACTTGGCTAGCTTGATGTTTCCAGGTCTCGGTGGTGGTAGTTCTGGCGGGTCAGGGGGCTCCA
ATCCTGGTTCTGGATTGTTTGGATCTCCCAACAACGGTAATGGCGTTGGTGACAATTCAGGAGGCTCTACTGGAT
TACCTAGTTACGGTAATGGCGGCTTTAATAATCCAAGCAACGGCAATGGCGGCTTCAACAACCCAAGCAACGGTA
ATGGGGGCTTGAATTATCCAAACAACGGTAATAACGGCTTCAACAATCCAGGGGGCTACAACAACAATGGTAATG
GCGGCTACAACAACCCCGGGAGCTCTCGCCCTGGATCTGGATATCCCGGATATCCTAACAACGGTAACAACGGTA
ATAATGGCTACAACAACCTAGGAGGCTCTCGCCCTGGATATGGATCTCCCGGATATCCCAACAACGGTAACAATG
GCTATAACAACAACGGTAATAATGGCTACAACAACCCCGGGGGCTATAACAACAACGGCAATAATGGCTACAACA
ACCCGGCAGGCTCTCGCCCTGGCTCTGGGTCTCCTGCATATGGCAGTTACAGTTATCGTTACAGTAGCAACAACC
CGGGAGGCACTAGTCCTAACCCTGGATCGCCCGGGTTCTCTTTCAGTTACAGCAATGGCCGAGGGGGCTCTGGAT
CCTTCAATTACAACAACAACAACAACAATGGGGGAAATAACTACAACAACCTCAGAGCCAGAGACCTCAGCTCCA
GCATCCCCCAATACAGCGACATCTTTGATCCAGATGATTTCGACCCTGAGAACGATCCTGACCTGGACATTGGTG
ATTTGGACCCTGATAGAAATTCCATCCCTTGGTATCCTCACTACCCTCCCAGCGATCCTTACAGCTACAACCCCA
AGAGCCCGGGGAGATCACCTAGTAGGCCCGGGAACAACGGCCCGAGCAACTCGGATTACGGCCCGGACCCCAACG
GCCCAGGTGGTCCTGATGGCTACGGAGGATCGAGTAACTATCCTGGATCCTCGGGAGGTTCTGGCAGCAAGCCCA
AGGGTCCAGGTGGTTCGTCCGGTAGACCTGGGAACAACAGCCCCGGCAATTCAGGATACGGCCCTGATCCAAACG
GTCCAGGTGGTCCCGATGGCTACGGAGGATCGAGTAACTATCCTGGATCCTCGGGAGGTTCTGGCAGCAAGCCCA
AGGGTCCAGGTGGTTCATCCGGTAGACCTGGGAACAACAGCCCTGGCAATGGATACGGCCCCGATCCAAACGGTC
CAGGTGGTCCCGATGGCTACGGAGGATCAAGCAACTACCCTGGATCCTCGGGAGGTTCTGGCGGCAAGCCCAAGG
GTCCAGGCAGACCTGGAAATAACAGCCCCAGCAATCCAGGGTACGGCCCAGATCCCAACGGCCCAGGAGGTATCG
ATGGCTACGGGGGTTCGAGTAACTACCCTGGGACTTCGGGGGGTTCTGGTAGCAACCCCAACACTTATGGCAAGC
CCAAGGGTCCAGGTGGTTCATCCGGTAGACCCGGGAATAATCGCCCCAGCAATCCAGGATATGGCCCTGACCCGA
ACGGTCCGGGAGGCCCCGATGGCTACGGAGGTTCAGGCAACAACCCCAATTACCCAGGTAGCTCTGGCGGAAACC
CCAAGGGTCCGGGGAGCTCCCCGGGCAAGCCCAGACCTGGAGGACCCGGCAGCTCACCTGGAAGCGGTGGCAATG
GCCCTAGCAATCCGGGGTACGGCTCAAGTCCATATGGTCCCGGCCGCAACCCCAATAGCCCAGGCTCTGGACCTA
GAGGACCTGGCAACTCACCTGGCAACCCAGGGTACGGAAACTCTGGAAGGCCTGGTACCTCACCCAACCCAGGTT
ATGGCAACTCTGGTCCCAATGGCCCAGGAGGCTTCCCTGGAAACTCTGGAGGACCTGGTCGCTCGCCCAGCAACC
CAGGGTATGGCAACCCAAGTTACGGTGGCTCTAATCCCAACAACTACGGAAACCCAGGCTCTGGATCCCCAAGTG
GCCCTGGCCGCAACCCTAACAACTCAGGCTCTGGACCTAGAGGACCTGGCAGCTCACCTAGCAACCCAGGATACG
GCAGCTCTGGTCCCCAAGGTCCGGGAGGCTACCCTGATTACTCTGGGTACTACGGCGACTCGGATTATGGCGACC
CAGATGACGGCGACTATGATCCCGATGACATTTACGGAGACCCCGACTATGGATATCCAAACTCCGGCGGCAATC
CCTACGGTCCAGGAGGTTCGAGACCTGGAGGACCTGGCAGACAACCAAGCAACCCTGGATATGGCGGCCCCGGCA
ACCCTGGATACGGAAACTCGAACGGCCCAGGGGGATCTGGACCCGGAGGACCTGGCAAACAACCTGGCAACCCGG
GATACGGCAACTCGAATCCCAATGGCCCAGGGGGTCCTGGCTATGGAGGATCTGGTAGCAATCCCAACGGCCCAG
GAGGCTCTAGACCTGGAGGACCTGGCAGCAAACCCAGTAACCCAGGATACGGCAACTCGAATCCCAATGGCCCAG
GAGGTCCTGGCTACGGAGGATCTGGCAATTCACCTAACAACCCTGGGTACAACAACCCCAGCAACCCAGGGTACG
GAGACTCGAACGGTCCAGGAGGTCCCAACTACGGGGGTTCCGGCAACAACCCTTACGGCCCAGGAGGCTCCTCTG
GGAATCCTGGATCTGGAGGTCCCGGTAGCCGGCCTGGCAACTCTGGGAACAACGGTCCCAGCAATCCAGGATACG
GAGGCGGCAACCCCAACGGCCCGGGAGGCCCTTCAAAAAACCCGGGATCTTCTGGAAATGGCAACTCGCCAAGCA
ACCCAGGATACGGCAATGGACCTGGTAACTCTGGAACAGACGGACCTAACAGCTCGCCCGACGGCCCGTGGTACG
GAGGCGGATCTGACGGCTCATCTGACAGCCCGTGGTACGGCGGCGGATCTGACGGCTCGCCTGATAGCTCGTGGG
ATGGAGGCGGATCTGACGGCTCCCCCGATGGCCCGTGGTTTGGAGATGGATCCGACGGCTCCCCTGATGGCCCGG
GATATGGCGGCGGACCTGGCAGCCCGGGATACGGTGACGGATCGGACAACTCGCCTGGAAACCCGGGATACGGCA
ACGGACCTGGCAGCCCAGGATACGGTGACGGATCGGACAATCCAGGATACGGTGACGGATCGGACAATCCAGGAT
ATGATGGGCCTGGTAGCCCTGGATATGGTGACGGATCTGACAACTCTCCTGGAAACCCGGAGTACGGAGATGGGT
TTGACAACCCGGGATACAGTGGCGGGCCTGGCAGTCCTGGATATGGCGACAGCTCGCCTAACAACCCGGGATACG
GTAACGGGCCTGGTAGCCCAGGATATGGTGATGGGCCTGGATCTCCGCCAAGCAACCCGGGATACGGGAACTCCG
GCCCAGGCTCTGGGGAGAATCCCAATTCTGGATCTCCGGGCGGCGGCAAAACTCCAAGCAACCCAGGATACGGCA
ACGGGCCAAGCAACCCAACGAAAAACCCAGGTTACGGCGATGGACCTGGCAGTCCGGGTTACGGCGATGGACCGG
ACAGTCCAGGATACGGTGACGGACCCGACAGTCCAGGATACGGCGATGGGCCAGATAGTCCGGGATACGGTAACG
GACCGGGCAGTTCAGGAGACGGACCTGGCAATCCGGGATACGGCGACGGACCAGACACCCCTCCGAATAACCCCG
GTTACGGCGACGGACCGGACAATCCGGGATATGGCAACGGACCGGGCAATTCAGGAGACGATAACGGACCTGGCA
GCCCGGGATACGGTAACGGGCCAGACAGTCCAGGATACGGCGAGGGGCCAGATAGTCCGGGTTACGGCGATGGGC
CAGACGGTCCGGGTTACGGTAACGGACCGGGCAGTCCAGGAGACGGTAACGGGCCAGACAGCCCGGGATACGGCG
ATGGACCGGGCAATCCGGGATACGATAACGGACCTGGCAGCCCGGGTTACGGCGACGGACCAGGCAGTCCGGGAT
ACGGCGATGGACCTAATAATCCGGGTGACGGCAACGGAGCCGGGGGCCCACCTAGCAACCCAGGATACGGAGACG
GGCCGGGTAACCCACCGAGTAATCCAGGATACGGAGACGGGCCAGGCAATCCGGGATACGGCGGCTCAAAACCTA
GCTCCGGGCCCCCAGGCAGTGGAGGGCCCGGCAACCCGCCGAATAATCCGGGATACGGAGACGGACCGAGCAACC
CGGGATACGACAACTCTAACCCCGGCTCCGGGCCTCCGGGCAGCAAAGGTCCTAGCAATCCAGGGTACGGCAACG
GGCCTAGCAACCCTCCGAGCAACCCAGGATACGGTGACGGGCCTAGCAGCCCGCCTAGCAATCCGGGGTACGGAG
ACGGACCTAGCAATCCTCCAAGCAACCCAGGATACGGTGACGGACCTGACAACTCGCCTAACAACCCCGGATACG
GTGACGGACCTGGAAGTCCTCCAAGCAATCCGGGGTACGGCGACGGACCTGACAACCCGCCTAACAACCCCGGAT
ACGGCGACGGGCCTGGCAACCCTCCGAGCAACCCCCCGAGCAACCCGGGGTACGGTGACGGACCTGATAACTCGC
CTAACAACCCCGGATACGGTGACGGACCTGGCAATCCTCCAAGCAATCCAGGTTACGGCGACGGGCCTGGCAATC
CGCCTAGCAAGCCGCCCAAAAATCCAGGGTACGGCGACGGACCCAACAGCCCGCCTAACAACCCAGGATATGGTA
ACGGACCTAGTAACCCTCCGAGCAACCCCCCGAGCAACCCGGGATACGGTGACGGACCTGATAACTCGCCTGACA
ACCCCGGATACGGTAACGGACCTGGAAACCCTCCAAGCAATCCAGGTTACGGCGACGGGCCTGGTAGCCAACCTA
CCAACCCAGGATATGGTGACGGACCTGGCAACGTCCCGAGCAACCCCCCGAGCAACCCAGGATACGGAGACGGAC
CTGGCAACCCCCCGAGCAACCCTCCGAGCAACCCAGGATACGGAGACGGACCTAGCAATCCTCCAAGCAACCCAG
GATACGGAGACGGACCTGACAACCCCCCGAGCAACCCAGGCTACGGAGACGGACCTGGCAACCCTCCGAGCAACC
CTCCAAATAACCCAGGTTACGGCGACCCAGGTTACGGCGACAGACCGGGCAATCCAGGAGACGGTGACGGACCTG
GCAGCCCGGGATACGGAGACGGGCCTGACAACTCGCCTAGTAACCCAGGATACGGTGACGGACCAGGCGATTCGC
CTACCAACCCGGGATACGGAGACGGACCCGACAACTCGCCTACCAATCCAGGGTACGGTGAATCCAACCCCGGCT
ACGGGGAGCCTGACTCTGGGTATCCCGACTCTGGATACCCTGACGGTTCCGACAATGACGGCCCTCCTCAAAACC
CAGGATATGGTGATTCCAACGGCTCAGGAGATTCCGGCGGTTACGGAGGCGATGGGTCTGGGAGTTACGACGGTT
CTGACACCGATCCTTTCAACCCTCCTGACGGTTCTCCTGACGGTTCGACTGATTATCCAGCGTACGGAAATCCCA
ATGGCTCGTACGACAACGAAGGCTACGGGGGCGATAATGTTGCGGATTTTGACGGATCTGACAACAATCCCTTCG
GTCCTCCTAACGGTCCCCCCGACGGACCCCCTAATGGCCCTCCTAACGGTCCGCCTGAGAATCCGGGATACGGAG
ATTCCAACGGTTCGGGGGGTTCGGACAGCTACGGAGGTAACGACTCTGGGTCTCCCAACGGTCCTCCTGACGGTC
CTCCCGACGGTCCCCCTAATGGCCCTCCTGACGGTCCGCCTGAGAATCCGGGATACGGAGATTCTAGCGGTCCAG
GGGGTTCGGACGGCTATGGAGGTAACGACTCTGGGTATCCTAACGGTCCTCCTGACGGTCCCCCTAATGGCCCGC
CTGACGGTCCGCCTGAGAATCCGGGATACGGAGATTCCAGCGGTTCAGGAGACTCAAACGGCTACGGAGGTGACG
ACTCTGGGTCTCCTAACGGTCCTCCTGATGGTCCTCCTGATGGTCCTCCTGACGGTCCTCCTGACGGTCCGCCTA
GCAACCCAGGTTACGGAGATGCTAGCGGCCCAGGAGGTCCAGATGGTTACGGGGGCAACTCTGGTTCTCCCAACG
GTCCTAATCCTTTCAACCCTCCTAACGGGCCCCCTAACGGGCCTCCTAGCAACCCGCCTGACAACTCGGGATACG
GAGACCCCAACGGCCCGGGAGGACCAGACGGCTACGGAGGAAGCGACAATGGCTCTCCCGACGATCCTAGCAACA
ATCCTTTCAGCTACAACAACCCCAACGGCCCGGCAGGCTCTAATGGGAATCCTGGATCTGGCGGACCTGGCAACT
CGCCCAACAACCCAGGATATGGAGGGTCCAACGGCCCAACAGGACCAGGTTACAACCCCAACGGTTCAGAAGGTC
CTGGCTATGGTCCTGATGGCCCGACAAACCCGGGTTACAACCCCAACGGCCCAGGAGGTAACAACGGCCCAGGAG
GTCCAGGCTATGGTCCTGATGGCCCGACCAACCCGGGCTACAACCCCAACGGCCCAGGAGGTAACAACCCCGGCA
ACAACCCCAACGGCCCTGGAGGCCCAGGCTATGGTCCTGATGGCCCGACAAACCCGGGTTACAATCCCAACGGTC
CAGGAGGTGACAGCCCCGGCTACAACCCCAACGGCCCAGGGGGTCCCAACAGTCCAGGAGGTAACAACCCCGGCA
ACAACCCAGGCAACAACCCTTTCAGCTACAACAACCCCAACAACCCATCAGACCCGAGTTACAACCCCAACGGCC
CAGCAATCGATCCCGACAGCCTGGCAGACCCAGGCTACGGCAACCCCAGCTACTCCAACCCCGGCACCACGCCCA
CGTCCAGCAACCCGATCAAGGACCTCCTCAACAAGGATCAATCCCTCACCGGCAAGCTCTTCCCCGACGGCTCAC
CCCTCGCCCTGGGCGGCACCGTGGGCAGGACCCAAAACGGCGGGCTGGGCTTCGACGTCAACGGCGGCATCGGCG
TCCCTGGCCTGGGCATCAACCTCGGCCTCTCGGGCGGTGCCGACGGTAAGAACGTGGGCCTGAACAACAACGTCG
GCGTCACGCTGGGAGACAAGACGTACGGCTTCAACCTGAACAATGGACTCAGCAACAACGGCGGCGGTATCACGC
CCTACTCCACCGCTCAGGCCGGCTCGAACCCTCTCGACGCTGGCTCCATTCTTGGCGCCTACGACCCTAACAAGC
AGGGGGCCAAGGGCGGAGGCGTGGACTTTGTGGACCAGGTGAAGAACTTGAAGGTGCCGGAGGGTGTTAGCAACC
TGCTCGGCTTGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail