Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4094
Gene name
LocationContig_375:4879..5403
Strand+
Gene length (bp)524
Transcript length (bp)468
Coding sequence length (bp)468
Protein length (aa) 156

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01284 MARVEL Membrane-associating domain 1.7E-14 8 132

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 44 63 19
3 75 97 22
4 117 139 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4094
MGRTTVLSLRIFQFFLAAVNLGLSAYIVNWYQVTTIRGSPPSVSLLVFAAILSLLSIGCLELAPRLFPRANRPGV
ILGVEAVNAVFYFVAFISHAVFLGSLAMCHGVVCSVSRVDSVVAAAGFCAWVASTILTTRDMFLAGLVRPNDKPE
GMDEP*
Coding >Ophun1|4094
ATGGGCCGAACCACCGTCCTCTCGCTGCGCATCTTCCAGTTCTTCTTGGCCGCCGTCAACCTCGGCCTCTCGGCT
TACATCGTCAACTGGTATCAGGTGACGACAATCCGCGGCTCGCCCCCCTCGGTCAGCCTCCTGGTTTTCGCCGCC
ATCTTGTCTCTCCTGTCCATCGGCTGCCTCGAGCTCGCACCGCGGCTGTTCCCTCGCGCCAACCGACCGGGCGTC
ATCCTGGGCGTCGAGGCCGTCAACGCCGTCTTCTACTTCGTCGCCTTCATCAGCCATGCCGTCTTCCTCGGCAGC
CTGGCCATGTGCCACGGCGTCGTCTGCTCCGTCAGCCGCGTCGATTCCGTCGTGGCAGCCGCTGGTTTTTGCGCG
TGGGTCGCGTCGACGATCCTGACGACCAGGGACATGTTCCTCGCTGGGCTTGTGAGGCCAAACGACAAGCCCGAG
GGTATGGACGAGCCGTGA
Transcript >Ophun1|4094
ATGGGCCGAACCACCGTCCTCTCGCTGCGCATCTTCCAGTTCTTCTTGGCCGCCGTCAACCTCGGCCTCTCGGCT
TACATCGTCAACTGGTATCAGGTGACGACAATCCGCGGCTCGCCCCCCTCGGTCAGCCTCCTGGTTTTCGCCGCC
ATCTTGTCTCTCCTGTCCATCGGCTGCCTCGAGCTCGCACCGCGGCTGTTCCCTCGCGCCAACCGACCGGGCGTC
ATCCTGGGCGTCGAGGCCGTCAACGCCGTCTTCTACTTCGTCGCCTTCATCAGCCATGCCGTCTTCCTCGGCAGC
CTGGCCATGTGCCACGGCGTCGTCTGCTCCGTCAGCCGCGTCGATTCCGTCGTGGCAGCCGCTGGTTTTTGCGCG
TGGGTCGCGTCGACGATCCTGACGACCAGGGACATGTTCCTCGCTGGGCTTGTGAGGCCAAACGACAAGCCCGAG
GGTATGGACGAGCCGTGA
Gene >Ophun1|4094
ATGGGCCGAACCACCGTCCTCTCGCTGCGCATCTTCCAGTTCTTCTTGGCCGCCGTCAACCTCGGCCTCTCGGCT
TACAGTTCGTCGTCATCCAATCCGTCCTTTCTGCTACGAGACGCTGACTTGGAATTGCAGTCGTCAACTGGTATC
AGGTGACGACAATCCGCGGCTCGCCCCCCTCGGTCAGCCTCCTGGTTTTCGCCGCCATCTTGTCTCTCCTGTCCA
TCGGCTGCCTCGAGCTCGCACCGCGGCTGTTCCCTCGCGCCAACCGACCGGGCGTCATCCTGGGCGTCGAGGCCG
TCAACGCCGTCTTCTACTTCGTCGCCTTCATCAGCCATGCCGTCTTCCTCGGCAGCCTGGCCATGTGCCACGGCG
TCGTCTGCTCCGTCAGCCGCGTCGATTCCGTCGTGGCAGCCGCTGGTTTTTGCGCGTGGGTCGCGTCGACGATCC
TGACGACCAGGGACATGTTCCTCGCTGGGCTTGTGAGGCCAAACGACAAGCCCGAGGGTATGGACGAGCCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail