Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4090
Gene name
LocationContig_373:8910..10860
Strand-
Gene length (bp)1950
Transcript length (bp)1950
Coding sequence length (bp)1950
Protein length (aa) 650

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.7E-07 185 237
PF13445 zf-RING_UBOX RING-type zinc-finger 3.6E-07 185 224

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94271|YORN_SCHPO Uncharacterized RING finger protein P8B7.23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.23 PE=3 SV=1 12 571 5.0E-91
sp|Q06436|MAG2_YEAST RING-finger protein MAG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAG2 PE=1 SV=1 4 587 2.0E-45
sp|Q08E13|RNF10_BOVIN RING finger protein 10 OS=Bos taurus GN=RNF10 PE=2 SV=1 78 368 1.0E-27
sp|Q8N5U6|RNF10_HUMAN RING finger protein 10 OS=Homo sapiens GN=RNF10 PE=1 SV=2 78 364 1.0E-27
sp|Q3UIW5|RNF10_MOUSE RING finger protein 10 OS=Mus musculus GN=Rnf10 PE=2 SV=2 78 358 3.0E-27
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94271|YORN_SCHPO Uncharacterized RING finger protein P8B7.23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBP8B7.23 PE=3 SV=1 12 571 5.0E-91
sp|Q06436|MAG2_YEAST RING-finger protein MAG2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAG2 PE=1 SV=1 4 587 2.0E-45
sp|Q08E13|RNF10_BOVIN RING finger protein 10 OS=Bos taurus GN=RNF10 PE=2 SV=1 78 368 1.0E-27
sp|Q8N5U6|RNF10_HUMAN RING finger protein 10 OS=Homo sapiens GN=RNF10 PE=1 SV=2 78 364 1.0E-27
sp|Q3UIW5|RNF10_MOUSE RING finger protein 10 OS=Mus musculus GN=Rnf10 PE=2 SV=2 78 358 3.0E-27
sp|Q5XI59|RNF10_RAT RING finger protein 10 OS=Rattus norvegicus GN=Rnf10 PE=2 SV=1 78 364 9.0E-27
sp|Q32NQ8|RNF10_XENLA RING finger protein 10 OS=Xenopus laevis GN=rnf10 PE=2 SV=1 96 379 7.0E-25
sp|Q08E13|RNF10_BOVIN RING finger protein 10 OS=Bos taurus GN=RNF10 PE=2 SV=1 386 486 5.0E-13
sp|Q3UIW5|RNF10_MOUSE RING finger protein 10 OS=Mus musculus GN=Rnf10 PE=2 SV=2 363 486 6.0E-13
sp|Q5XI59|RNF10_RAT RING finger protein 10 OS=Rattus norvegicus GN=Rnf10 PE=2 SV=1 386 486 8.0E-13
sp|Q8N5U6|RNF10_HUMAN RING finger protein 10 OS=Homo sapiens GN=RNF10 PE=1 SV=2 386 486 2.0E-12
sp|Q32NQ8|RNF10_XENLA RING finger protein 10 OS=Xenopus laevis GN=rnf10 PE=2 SV=1 360 491 5.0E-11
sp|P40072|SLX8_YEAST E3 ubiquitin-protein ligase complex SLX5-SLX8 subunit SLX8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLX8 PE=1 SV=1 185 249 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4090
MNPSGAVVGKSLPASSSHPAAAQAGPSTSSFDSVRRPNQSGLGTSQPAPRKGQGARKQHKNQRRPGTGPGPNSHL
DEDDAMAEMRALRNPSSRRGQTSITHLLSYTSPRPFLAHGHHLHSRSYRRHPTWGPGYAADKSRYVHANYRFIVS
PDATYSNHAADADVFLDWLNVMQIIVSTKSQAASCPICLSEPVAPRMAKCGHIFCLPCLIRFMHSSSGSDEHTKS
VRGARWKKCPICEDSVYLHEVRPVRFYDGQESALPRVGDDVVLRLMARNANSTLALPWEGGAEVLNSGEDVPWHF
AANVMDYARIMKGTAEYMDGQYDEEIVALQEQEKADEMFGEDGEWTQRAVKAIKIAKERSEGVAPATGTNVPAPK
PSKKQPAPADFYFYSSPPHLYLSPLDIRILKTKYGAFSSFPSTLLPRVEHISTGHVMDDALRKRAKYLGHLPHGC
VISFLECDWTDIVPAETLESFSDDIERRRKRNRDKAAEEERERLQSERLESAMLRGSLGMRRAPAPVEEEEAGPV
MDLSEFQPLSGQSGTTPPDPRPGFATLASMSTSPSTQRTVWGTRAIPASPEMEPTQSSEMIDDGWLKDEELLGTA
ELAMQMEAMEMTDSGPAGGESTGSGPGGKKGKKKKQKITLMSTGGRRGN*
Coding >Ophun1|4090
ATGAACCCGTCCGGCGCTGTTGTGGGCAAGTCCCTGCCGGCGTCATCGAGCCATCCGGCGGCTGCCCAGGCGGGG
CCTTCGACGTCGAGCTTCGACTCGGTCCGTCGCCCGAATCAGTCCGGACTCGGGACTTCGCAGCCGGCGCCGAGA
AAGGGTCAGGGTGCGCGGAAGCAGCACAAGAATCAGCGGCGGCCGGGGACCGGTCCGGGGCCCAACAGCCATCTG
GACGAGGACGACGCCATGGCGGAGATGCGGGCTTTGAGGAACCCATCTAGCCGACGGGGCCAGACGTCGATTACC
CATCTTTTAAGCTACACGTCGCCCAGGCCGTTTCTGGCTCACGGCCACCACCTTCACTCGCGGTCTTATCGTCGC
CACCCTACCTGGGGTCCTGGTTACGCGGCCGACAAGTCGAGATACGTGCATGCCAACTATCGCTTTATCGTCTCC
CCCGATGCCACGTATTCGAACCACGCGGCCGACGCCGACGTTTTTTTGGACTGGCTCAACGTGATGCAGATTATC
GTCTCAACCAAATCGCAGGCGGCGTCGTGCCCCATCTGTCTTTCGGAGCCGGTGGCGCCCCGCATGGCAAAGTGC
GGCCACATCTTCTGCCTGCCCTGCCTCATCAGATTCATGCACTCCAGCTCGGGCTCCGACGAGCACACCAAATCG
GTCAGAGGCGCCAGATGGAAGAAGTGCCCCATCTGCGAGGACAGCGTGTACCTGCACGAGGTGCGACCAGTGCGC
TTTTACGACGGGCAGGAGAGCGCCCTGCCCCGTGTCGGCGATGACGTCGTCCTCCGCCTCATGGCCAGGAACGCC
AACTCGACGCTCGCGCTGCCCTGGGAAGGGGGCGCCGAGGTGCTCAATTCGGGCGAGGATGTGCCGTGGCATTTT
GCGGCCAACGTCATGGACTACGCTCGTATCATGAAGGGCACCGCTGAGTATATGGATGGCCAGTACGACGAGGAA
ATAGTCGCCCTGCAGGAGCAGGAAAAGGCCGACGAGATGTTTGGCGAGGATGGTGAGTGGACACAGAGGGCCGTA
AAGGCCATCAAGATCGCCAAGGAGAGGTCCGAGGGCGTCGCCCCGGCCACCGGCACGAATGTCCCGGCGCCGAAG
CCGTCGAAGAAGCAACCGGCACCGGCCGACTTTTACTTTTACAGCTCGCCACCGCATTTGTACCTCTCTCCGCTC
GACATACGGATCCTCAAGACCAAGTACGGCGCCTTTTCCAGCTTCCCCTCGACGCTGTTGCCTCGCGTTGAGCAC
ATCTCGACAGGTCATGTGATGGACGACGCGCTTCGCAAGCGGGCCAAGTATCTCGGCCACCTGCCTCACGGGTGC
GTCATCAGTTTCCTGGAGTGCGATTGGACGGACATTGTGCCGGCTGAGACGCTGGAGTCCTTCTCGGACGATATC
GAGAGGCGCCGGAAGCGCAATCGCGATAAAGCTGCCGAGGAGGAGCGTGAGAGGCTGCAGTCGGAACGGCTCGAA
TCTGCCATGCTCCGGGGCTCGCTTGGTATGAGGAGGGCGCCCGCCCCTGTTGAGGAGGAGGAGGCCGGGCCGGTC
ATGGACTTGTCAGAGTTCCAGCCGCTAAGCGGGCAGTCTGGCACAACGCCGCCCGACCCGCGGCCTGGGTTCGCC
ACGCTGGCGTCCATGTCGACGAGCCCGTCAACGCAGCGGACGGTATGGGGCACCCGGGCCATACCGGCTTCCCCC
GAGATGGAGCCGACGCAATCGAGCGAGATGATCGATGACGGATGGCTAAAGGATGAGGAGCTTCTAGGCACGGCC
GAGCTGGCGATGCAGATGGAGGCAATGGAGATGACCGACAGCGGACCCGCGGGCGGGGAGTCCACGGGAAGCGGA
CCTGGCGGCAAGAAGGGCAAGAAGAAGAAGCAGAAGATAACGCTGATGAGCACCGGGGGAAGGAGAGGCAATTGA
Transcript >Ophun1|4090
ATGAACCCGTCCGGCGCTGTTGTGGGCAAGTCCCTGCCGGCGTCATCGAGCCATCCGGCGGCTGCCCAGGCGGGG
CCTTCGACGTCGAGCTTCGACTCGGTCCGTCGCCCGAATCAGTCCGGACTCGGGACTTCGCAGCCGGCGCCGAGA
AAGGGTCAGGGTGCGCGGAAGCAGCACAAGAATCAGCGGCGGCCGGGGACCGGTCCGGGGCCCAACAGCCATCTG
GACGAGGACGACGCCATGGCGGAGATGCGGGCTTTGAGGAACCCATCTAGCCGACGGGGCCAGACGTCGATTACC
CATCTTTTAAGCTACACGTCGCCCAGGCCGTTTCTGGCTCACGGCCACCACCTTCACTCGCGGTCTTATCGTCGC
CACCCTACCTGGGGTCCTGGTTACGCGGCCGACAAGTCGAGATACGTGCATGCCAACTATCGCTTTATCGTCTCC
CCCGATGCCACGTATTCGAACCACGCGGCCGACGCCGACGTTTTTTTGGACTGGCTCAACGTGATGCAGATTATC
GTCTCAACCAAATCGCAGGCGGCGTCGTGCCCCATCTGTCTTTCGGAGCCGGTGGCGCCCCGCATGGCAAAGTGC
GGCCACATCTTCTGCCTGCCCTGCCTCATCAGATTCATGCACTCCAGCTCGGGCTCCGACGAGCACACCAAATCG
GTCAGAGGCGCCAGATGGAAGAAGTGCCCCATCTGCGAGGACAGCGTGTACCTGCACGAGGTGCGACCAGTGCGC
TTTTACGACGGGCAGGAGAGCGCCCTGCCCCGTGTCGGCGATGACGTCGTCCTCCGCCTCATGGCCAGGAACGCC
AACTCGACGCTCGCGCTGCCCTGGGAAGGGGGCGCCGAGGTGCTCAATTCGGGCGAGGATGTGCCGTGGCATTTT
GCGGCCAACGTCATGGACTACGCTCGTATCATGAAGGGCACCGCTGAGTATATGGATGGCCAGTACGACGAGGAA
ATAGTCGCCCTGCAGGAGCAGGAAAAGGCCGACGAGATGTTTGGCGAGGATGGTGAGTGGACACAGAGGGCCGTA
AAGGCCATCAAGATCGCCAAGGAGAGGTCCGAGGGCGTCGCCCCGGCCACCGGCACGAATGTCCCGGCGCCGAAG
CCGTCGAAGAAGCAACCGGCACCGGCCGACTTTTACTTTTACAGCTCGCCACCGCATTTGTACCTCTCTCCGCTC
GACATACGGATCCTCAAGACCAAGTACGGCGCCTTTTCCAGCTTCCCCTCGACGCTGTTGCCTCGCGTTGAGCAC
ATCTCGACAGGTCATGTGATGGACGACGCGCTTCGCAAGCGGGCCAAGTATCTCGGCCACCTGCCTCACGGGTGC
GTCATCAGTTTCCTGGAGTGCGATTGGACGGACATTGTGCCGGCTGAGACGCTGGAGTCCTTCTCGGACGATATC
GAGAGGCGCCGGAAGCGCAATCGCGATAAAGCTGCCGAGGAGGAGCGTGAGAGGCTGCAGTCGGAACGGCTCGAA
TCTGCCATGCTCCGGGGCTCGCTTGGTATGAGGAGGGCGCCCGCCCCTGTTGAGGAGGAGGAGGCCGGGCCGGTC
ATGGACTTGTCAGAGTTCCAGCCGCTAAGCGGGCAGTCTGGCACAACGCCGCCCGACCCGCGGCCTGGGTTCGCC
ACGCTGGCGTCCATGTCGACGAGCCCGTCAACGCAGCGGACGGTATGGGGCACCCGGGCCATACCGGCTTCCCCC
GAGATGGAGCCGACGCAATCGAGCGAGATGATCGATGACGGATGGCTAAAGGATGAGGAGCTTCTAGGCACGGCC
GAGCTGGCGATGCAGATGGAGGCAATGGAGATGACCGACAGCGGACCCGCGGGCGGGGAGTCCACGGGAAGCGGA
CCTGGCGGCAAGAAGGGCAAGAAGAAGAAGCAGAAGATAACGCTGATGAGCACCGGGGGAAGGAGAGGCAATTGA
Gene >Ophun1|4090
ATGAACCCGTCCGGCGCTGTTGTGGGCAAGTCCCTGCCGGCGTCATCGAGCCATCCGGCGGCTGCCCAGGCGGGG
CCTTCGACGTCGAGCTTCGACTCGGTCCGTCGCCCGAATCAGTCCGGACTCGGGACTTCGCAGCCGGCGCCGAGA
AAGGGTCAGGGTGCGCGGAAGCAGCACAAGAATCAGCGGCGGCCGGGGACCGGTCCGGGGCCCAACAGCCATCTG
GACGAGGACGACGCCATGGCGGAGATGCGGGCTTTGAGGAACCCATCTAGCCGACGGGGCCAGACGTCGATTACC
CATCTTTTAAGCTACACGTCGCCCAGGCCGTTTCTGGCTCACGGCCACCACCTTCACTCGCGGTCTTATCGTCGC
CACCCTACCTGGGGTCCTGGTTACGCGGCCGACAAGTCGAGATACGTGCATGCCAACTATCGCTTTATCGTCTCC
CCCGATGCCACGTATTCGAACCACGCGGCCGACGCCGACGTTTTTTTGGACTGGCTCAACGTGATGCAGATTATC
GTCTCAACCAAATCGCAGGCGGCGTCGTGCCCCATCTGTCTTTCGGAGCCGGTGGCGCCCCGCATGGCAAAGTGC
GGCCACATCTTCTGCCTGCCCTGCCTCATCAGATTCATGCACTCCAGCTCGGGCTCCGACGAGCACACCAAATCG
GTCAGAGGCGCCAGATGGAAGAAGTGCCCCATCTGCGAGGACAGCGTGTACCTGCACGAGGTGCGACCAGTGCGC
TTTTACGACGGGCAGGAGAGCGCCCTGCCCCGTGTCGGCGATGACGTCGTCCTCCGCCTCATGGCCAGGAACGCC
AACTCGACGCTCGCGCTGCCCTGGGAAGGGGGCGCCGAGGTGCTCAATTCGGGCGAGGATGTGCCGTGGCATTTT
GCGGCCAACGTCATGGACTACGCTCGTATCATGAAGGGCACCGCTGAGTATATGGATGGCCAGTACGACGAGGAA
ATAGTCGCCCTGCAGGAGCAGGAAAAGGCCGACGAGATGTTTGGCGAGGATGGTGAGTGGACACAGAGGGCCGTA
AAGGCCATCAAGATCGCCAAGGAGAGGTCCGAGGGCGTCGCCCCGGCCACCGGCACGAATGTCCCGGCGCCGAAG
CCGTCGAAGAAGCAACCGGCACCGGCCGACTTTTACTTTTACAGCTCGCCACCGCATTTGTACCTCTCTCCGCTC
GACATACGGATCCTCAAGACCAAGTACGGCGCCTTTTCCAGCTTCCCCTCGACGCTGTTGCCTCGCGTTGAGCAC
ATCTCGACAGGTCATGTGATGGACGACGCGCTTCGCAAGCGGGCCAAGTATCTCGGCCACCTGCCTCACGGGTGC
GTCATCAGTTTCCTGGAGTGCGATTGGACGGACATTGTGCCGGCTGAGACGCTGGAGTCCTTCTCGGACGATATC
GAGAGGCGCCGGAAGCGCAATCGCGATAAAGCTGCCGAGGAGGAGCGTGAGAGGCTGCAGTCGGAACGGCTCGAA
TCTGCCATGCTCCGGGGCTCGCTTGGTATGAGGAGGGCGCCCGCCCCTGTTGAGGAGGAGGAGGCCGGGCCGGTC
ATGGACTTGTCAGAGTTCCAGCCGCTAAGCGGGCAGTCTGGCACAACGCCGCCCGACCCGCGGCCTGGGTTCGCC
ACGCTGGCGTCCATGTCGACGAGCCCGTCAACGCAGCGGACGGTATGGGGCACCCGGGCCATACCGGCTTCCCCC
GAGATGGAGCCGACGCAATCGAGCGAGATGATCGATGACGGATGGCTAAAGGATGAGGAGCTTCTAGGCACGGCC
GAGCTGGCGATGCAGATGGAGGCAATGGAGATGACCGACAGCGGACCCGCGGGCGGGGAGTCCACGGGAAGCGGA
CCTGGCGGCAAGAAGGGCAAGAAGAAGAAGCAGAAGATAACGCTGATGAGCACCGGGGGAAGGAGAGGCAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail