Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4088
Gene name
LocationContig_373:4643..6163
Strand+
Gene length (bp)1520
Transcript length (bp)1380
Coding sequence length (bp)1380
Protein length (aa) 460

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10516 SHNi-TPR SHNi-TPR 4.3E-11 231 268

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USQ4|SIM3_SCHPO NASP-related protein sim3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sim3 PE=1 SV=1 15 420 2.0E-22
sp|P06180|HIBN_XENLA Histone-binding protein N1/N2 OS=Xenopus laevis PE=1 SV=3 181 443 5.0E-08
sp|P49321|NASP_HUMAN Nuclear autoantigenic sperm protein OS=Homo sapiens GN=NASP PE=1 SV=2 100 453 5.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1508
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7944
Ophiocordyceps australis map64 (Brazil) OphauB2|7581
Ophiocordyceps camponoti-floridani Ophcf2|00911
Ophiocordyceps camponoti-rufipedis Ophun1|4088 (this protein)
Ophiocordyceps kimflemingae Ophio5|5536
Ophiocordyceps subramaniannii Hirsu2|11163

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4088
MTTDGDDIKSKRVTLADLSAKGTALYAQKSYEAAADIFSTASTLQASINGETAPENAEILFHYGRSLFRVGQSKS
DVLGGPATAAAAAVDAAVGSESKKSKASAGDDAKQPADDAKPAESESAKKKESSVKDDASKKGAVPDAKKPLFQF
TGDDNFDQDDDDDDDDQEVEDEANEAEDDELAMAFEILDLARVCYLKQLEQLEKDHPPGKGKDAAPAEDPPSVRH
VKERLAETHDCLAEISLENERYPDAIEDGRVSLKYKMDLYPEESEIIAEAHYKLSLALEFASVTTPAPKEDDSKS
TTTQDTSNTAKKPATMDTALRNEAIHEMELAIKSFRLKMQNEEVELATMASPEDNDAARKAIAEMKDIVADMETR
LVDLRKGPVDADALIASAMAGKQPSKSSDEAIHKATDLTALVRKKTRAADEGKRKAEEEPAGAENGNASPKKARI
EEDDAAAAS*
Coding >Ophun1|4088
ATGACGACCGACGGCGACGACATCAAATCCAAGCGCGTCACGCTGGCCGACCTCAGCGCAAAGGGAACCGCGCTG
TACGCGCAAAAGAGCTACGAGGCCGCAGCCGACATCTTCTCGACTGCCAGCACCCTGCAGGCCAGCATCAACGGC
GAGACAGCGCCCGAGAACGCCGAGATCCTCTTCCACTACGGCCGCAGCCTCTTCAGGGTCGGTCAGAGTAAGAGC
GACGTTCTCGGCGGTCCTGCTACCGCCGCTGCCGCTGCCGTCGATGCTGCTGTCGGCTCCGAGTCCAAGAAGTCC
AAGGCGTCTGCTGGCGATGACGCGAAGCAACCCGCCGACGACGCAAAGCCGGCTGAATCCGAGAGCGCCAAAAAG
AAAGAATCCTCCGTCAAGGACGATGCCTCCAAAAAAGGCGCCGTCCCCGATGCCAAAAAGCCTCTCTTTCAATTC
ACCGGCGACGACAACTTTGACCAGGACGACGATGACGACGACGACGATCAAGAGGTCGAAGACGAGGCCAACGAG
GCCGAAGACGACGAGTTGGCCATGGCATTCGAGATTCTCGACCTCGCCCGCGTCTGCTACCTAAAGCAGCTCGAA
CAGCTCGAAAAGGACCACCCGCCAGGCAAAGGCAAGGACGCGGCCCCAGCCGAAGACCCCCCTTCAGTCCGACAC
GTCAAGGAGCGTCTGGCCGAAACGCACGATTGCCTCGCCGAGATTTCCCTGGAGAACGAACGATACCCCGACGCC
ATCGAAGACGGCCGCGTCTCCCTCAAGTACAAAATGGACCTCTACCCCGAAGAGTCAGAAATCATCGCAGAAGCC
CACTACAAGCTTTCCCTCGCCCTCGAATTCGCCTCCGTCACCACCCCAGCTCCCAAGGAAGACGACTCAAAATCA
ACGACGACGCAAGATACCAGCAACACAGCCAAGAAACCCGCCACCATGGACACGGCCCTCCGCAACGAAGCCATC
CACGAAATGGAACTCGCCATCAAAAGCTTCCGTCTCAAGATGCAAAACGAAGAGGTCGAGCTCGCAACCATGGCC
TCGCCAGAGGACAACGACGCTGCCCGCAAAGCCATCGCCGAAATGAAGGACATCGTCGCCGATATGGAAACCCGG
CTCGTCGACCTCCGCAAGGGTCCCGTCGACGCAGACGCCCTCATCGCCTCCGCAATGGCAGGCAAGCAGCCGTCC
AAGTCGTCCGACGAGGCGATCCACAAGGCCACAGACCTCACCGCCCTCGTCAGGAAGAAGACGCGCGCCGCCGAC
GAGGGGAAGCGGAAGGCTGAGGAGGAACCTGCTGGGGCTGAGAACGGCAACGCGTCGCCCAAGAAGGCTAGGATC
GAGGAGGATGATGCTGCTGCTGCTTCCTAG
Transcript >Ophun1|4088
ATGACGACCGACGGCGACGACATCAAATCCAAGCGCGTCACGCTGGCCGACCTCAGCGCAAAGGGAACCGCGCTG
TACGCGCAAAAGAGCTACGAGGCCGCAGCCGACATCTTCTCGACTGCCAGCACCCTGCAGGCCAGCATCAACGGC
GAGACAGCGCCCGAGAACGCCGAGATCCTCTTCCACTACGGCCGCAGCCTCTTCAGGGTCGGTCAGAGTAAGAGC
GACGTTCTCGGCGGTCCTGCTACCGCCGCTGCCGCTGCCGTCGATGCTGCTGTCGGCTCCGAGTCCAAGAAGTCC
AAGGCGTCTGCTGGCGATGACGCGAAGCAACCCGCCGACGACGCAAAGCCGGCTGAATCCGAGAGCGCCAAAAAG
AAAGAATCCTCCGTCAAGGACGATGCCTCCAAAAAAGGCGCCGTCCCCGATGCCAAAAAGCCTCTCTTTCAATTC
ACCGGCGACGACAACTTTGACCAGGACGACGATGACGACGACGACGATCAAGAGGTCGAAGACGAGGCCAACGAG
GCCGAAGACGACGAGTTGGCCATGGCATTCGAGATTCTCGACCTCGCCCGCGTCTGCTACCTAAAGCAGCTCGAA
CAGCTCGAAAAGGACCACCCGCCAGGCAAAGGCAAGGACGCGGCCCCAGCCGAAGACCCCCCTTCAGTCCGACAC
GTCAAGGAGCGTCTGGCCGAAACGCACGATTGCCTCGCCGAGATTTCCCTGGAGAACGAACGATACCCCGACGCC
ATCGAAGACGGCCGCGTCTCCCTCAAGTACAAAATGGACCTCTACCCCGAAGAGTCAGAAATCATCGCAGAAGCC
CACTACAAGCTTTCCCTCGCCCTCGAATTCGCCTCCGTCACCACCCCAGCTCCCAAGGAAGACGACTCAAAATCA
ACGACGACGCAAGATACCAGCAACACAGCCAAGAAACCCGCCACCATGGACACGGCCCTCCGCAACGAAGCCATC
CACGAAATGGAACTCGCCATCAAAAGCTTCCGTCTCAAGATGCAAAACGAAGAGGTCGAGCTCGCAACCATGGCC
TCGCCAGAGGACAACGACGCTGCCCGCAAAGCCATCGCCGAAATGAAGGACATCGTCGCCGATATGGAAACCCGG
CTCGTCGACCTCCGCAAGGGTCCCGTCGACGCAGACGCCCTCATCGCCTCCGCAATGGCAGGCAAGCAGCCGTCC
AAGTCGTCCGACGAGGCGATCCACAAGGCCACAGACCTCACCGCCCTCGTCAGGAAGAAGACGCGCGCCGCCGAC
GAGGGGAAGCGGAAGGCTGAGGAGGAACCTGCTGGGGCTGAGAACGGCAACGCGTCGCCCAAGAAGGCTAGGATC
GAGGAGGATGATGCTGCTGCTGCTTCCTAG
Gene >Ophun1|4088
ATGACGACCGACGGCGACGACATCAAATCCAAGCGCGTCACGCTGGCCGACCTCAGCGCAAAGGGAACCGCGCTG
TACGCGCAAAAGAGCTACGAGGCCGCAGCCGACATCTTCTCGACTGCCAGCACCCTGCAGGCCAGCATCAACGGC
GAGACAGCGCCCGAGAACGCCGAGATCCTCTTCCACTACGGCCGCAGCCTCTTCAGGGTCGGTCAGAGTAAGAGC
GACGTTCTCGGCGGTCCTGCTACCGCCGCTGCCGCTGCCGTCGATGCTGCTGTCGGCTCCGAGTCCAAGAAGTCC
AAGGCGTCTGCTGGCGATGACGCGAAGCAACCCGCCGACGACGCAAAGCCGGCTGAATCCGAGAGCGCCAAAAAG
AAAGAATCCTCCGTCAAGGACGATGCCTCCAAAAAAGGCGCCGTCCCCGATGCCAAAAAGCCTCTCTTTCAATTC
ACCGGCGACGACAACTTTGACCAGGACGACGATGACGACGACGACGATCAAGTCAGTAAATCCCTTCACGATCCC
CCCCATTCTCACCCCCCTCCTGCTCACCTGGCCCCCATTAGGAGGTCGAAGACGAGGCCAACGAGGCCGAAGACG
ACGAGTTGGCCATGGCATTCGAGATTCTCGACCTCGCCCGCGTCTGCTACCTAAAGCAGCTCGAACAGCTCGAAA
AGGACCACCCGCCAGGCAAAGGCAAGGACGCGGCCCCAGCCGAAGACCCCCCTTCAGTCCGACACGTCAAGGAGC
GTCTGGCCGAAACGCACGATTGCCTCGCCGAGATTTCCCTGGAGAACGAACGGTGAGCCAACCCCCCCCCCCCTT
TTTCCTTCAACCTCTCCATCCCCAAAGCTCTAACACGCGTCAAAACTTCAAGATACCCCGACGCCATCGAAGACG
GCCGCGTCTCCCTCAAGTACAAAATGGACCTCTACCCCGAAGAGTCAGAAATCATCGCAGAAGCCCACTACAAGC
TTTCCCTCGCCCTCGAATTCGCCTCCGTCACCACCCCAGCTCCCAAGGAAGACGACTCAAAATCAACGACGACGC
AAGATACCAGCAACACAGCCAAGAAACCCGCCACCATGGACACGGCCCTCCGCAACGAAGCCATCCACGAAATGG
AACTCGCCATCAAAAGCTTCCGTCTCAAGATGCAAAACGAAGAGGTCGAGCTCGCAACCATGGCCTCGCCAGAGG
ACAACGACGCTGCCCGCAAAGCCATCGCCGAAATGAAGGACATCGTCGCCGATATGGAAACCCGGCTCGTCGACC
TCCGCAAGGGTCCCGTCGACGCAGACGCCCTCATCGCCTCCGCAATGGCAGGCAAGCAGCCGTCCAAGTCGTCCG
ACGAGGCGATCCACAAGGCCACAGACCTCACCGCCCTCGTCAGGAAGAAGACGCGCGCCGCCGACGAGGGGAAGC
GGAAGGCTGAGGAGGAACCTGCTGGGGCTGAGAACGGCAACGCGTCGCCCAAGAAGGCTAGGATCGAGGAGGATG
ATGCTGCTGCTGCTTCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail