Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4086
Gene name
LocationContig_373:1430..2949
Strand+
Gene length (bp)1519
Transcript length (bp)1458
Coding sequence length (bp)1458
Protein length (aa) 486

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.6E-21 5 376
PF00083 Sugar_tr Sugar (and other) transporter 3.7E-07 25 133

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 8 365 8.0E-15
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 52 438 3.0E-14
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 8 286 3.0E-11
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 52 392 2.0E-10
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 52 392 2.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q00357|TOXA_COCCA Putative HC-toxin efflux carrier TOXA OS=Cochliobolus carbonum GN=TOXA PE=3 SV=1 8 365 8.0E-15
sp|P96712|BMR3_BACSU Multidrug resistance protein 3 OS=Bacillus subtilis (strain 168) GN=bmr3 PE=1 SV=1 52 438 3.0E-14
sp|Q04301|VBA1_YEAST Vacuolar basic amino acid transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA1 PE=1 SV=1 8 286 3.0E-11
sp|P9WG85|Y1877_MYCTU Uncharacterized MFS-type transporter Rv1877 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1877 PE=3 SV=1 52 392 2.0E-10
sp|P9WG84|Y1877_MYCTO Uncharacterized MFS-type transporter MT1926 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1926 PE=3 SV=1 52 392 2.0E-10
sp|O59726|FNX2_SCHPO Vacuolar membrane amino acid uptake transporter fnx2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx2 PE=3 SV=1 73 273 2.0E-09
sp|P54585|YHCA_BACSU Uncharacterized MFS-type transporter YhcA OS=Bacillus subtilis (strain 168) GN=yhcA PE=3 SV=2 22 273 2.0E-09
sp|P33335|SGE1_YEAST Protein SGE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SGE1 PE=1 SV=1 11 157 5.0E-09
sp|P50080|AZR1_YEAST Azole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AZR1 PE=1 SV=1 22 120 5.0E-09
sp|P9WG88|EMRB_MYCTO Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=emrB PE=3 SV=1 1 379 5.0E-08
sp|P9WG89|EMRB_MYCTU Multidrug resistance protein B homolog OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=emrB PE=3 SV=1 1 292 1.0E-07
sp|P94422|YCNB_BACSU Uncharacterized MFS-type transporter YcnB OS=Bacillus subtilis (strain 168) GN=ycnB PE=3 SV=1 6 142 5.0E-07
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 1 126 7.0E-07
sp|P38358|VBA2_YEAST Vacuolar basic amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA2 PE=1 SV=1 73 443 7.0E-07
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 1 126 7.0E-07
sp|Q09752|FNX1_SCHPO Multidrug resistance protein fnx1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fnx1 PE=2 SV=2 8 456 2.0E-06
sp|P9WG87|Y1250_MYCTU Uncharacterized MFS-type transporter Rv1250 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1250 PE=3 SV=1 21 236 6.0E-06
sp|P9WG86|Y1250_MYCTO Uncharacterized MFS-type transporter MT1289 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1289 PE=3 SV=1 21 236 6.0E-06
sp|P36172|VBA5_YEAST Vacuolar basic amino acid transporter 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VBA5 PE=3 SV=1 9 381 6.0E-06
sp|O32182|YUSP_BACSU Uncharacterized MFS-type transporter YusP OS=Bacillus subtilis (strain 168) GN=yusP PE=3 SV=1 4 273 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 24 46 22
2 53 75 22
3 85 107 22
4 114 136 22
5 167 189 22
6 196 217 21
7 242 261 19
8 268 290 22
9 295 317 22
10 324 346 22
11 366 388 22
12 444 466 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4086
MALSSLVPIVGRLAAAGAAMPRSLVLPAATIFCAGALLAASASSAAVFIGGRVLAGAGGGAFLALAFVFVLALVP
EPRRGVGLGVVNAAITVGVSLGAVVYGGLLSAVGWRPLFWMQAPVAFVAALAVFLCTPSSIQSDQKNREPSSLSQ
RLIRIDYLGVVLLVSPLASTQLPGLTIQCLTVVLFLYGLASTVQPLILGLSIVSLVAFIACEYLVAVDPVLPLTL
LSSRGVLLSCLSQLGLMAARWSLLFFAPIFILAVHGAPRAAAGSVLVPTNLGFALGGIVVGSLHIRRAGSFWLSC
LIALAIFSASLLGLAIVAAPRAALTPLITLVFINGFATGAALNYTMAHLLHLCHPDTAYIAASLLTTFRGFGGSF
GTSIGGGMFYRFLRRSLTRGFLALDGGQHLSPAHNALIPRLLGMPELVLHGGLSGEEQKVALNGYAGAIGFVWMA
AAIMMLLVMAAQAATGWTAPEPLTAADGEAGGHDE*
Coding >Ophun1|4086
ATGGCCCTCTCTTCCTTGGTCCCGATCGTCGGCCGCCTCGCCGCCGCCGGAGCCGCCATGCCGCGGAGCCTCGTG
CTACCAGCCGCGACCATCTTCTGCGCCGGAGCACTTCTCGCGGCCTCGGCTTCGTCAGCGGCCGTCTTCATCGGC
GGACGGGTTCTCGCCGGTGCCGGAGGAGGTGCCTTTTTGGCCCTCGCCTTTGTCTTTGTGCTTGCGTTGGTGCCG
GAGCCTCGGAGGGGGGTCGGGCTGGGCGTCGTCAATGCAGCCATCACTGTCGGTGTCTCGCTGGGGGCTGTTGTC
TATGGAGGCTTGCTTTCGGCCGTGGGATGGCGACCCCTATTCTGGATGCAGGCTCCCGTCGCCTTTGTTGCCGCT
CTCGCCGTCTTTCTCTGTACACCGTCGTCGATACAGTCTGACCAGAAGAACCGAGAGCCGTCGTCACTGTCACAG
CGGTTGATCCGCATCGATTATCTCGGGGTTGTCCTCCTTGTAAGTCCCCTCGCGTCTACTCAGCTGCCCGGACTC
ACCATTCAGTGCCTCACGGTAGTTCTCTTCCTCTACGGCCTCGCCAGCACCGTCCAGCCTCTCATCCTCGGCCTG
TCCATCGTATCTCTCGTGGCCTTTATCGCGTGCGAGTATCTCGTCGCCGTTGATCCCGTCTTACCCCTGACTCTC
CTCTCCTCCCGCGGCGTCCTCCTCTCGTGTCTCTCCCAGCTTGGTCTCATGGCCGCCCGCTGGAGCCTACTCTTC
TTCGCACCCATCTTCATCCTGGCCGTTCACGGTGCTCCCCGTGCCGCAGCGGGTTCCGTCCTGGTGCCTACCAAC
CTCGGCTTCGCTCTAGGGGGCATCGTCGTCGGCTCGCTGCACATTCGTCGTGCCGGTTCCTTCTGGCTATCATGT
CTCATCGCCCTGGCCATCTTTTCCGCCTCTCTGCTCGGTCTCGCTATCGTAGCAGCCCCCCGAGCCGCTCTGACG
CCCCTGATTACCCTCGTCTTCATCAATGGCTTCGCAACGGGAGCTGCCCTCAACTACACCATGGCTCATCTGCTT
CATCTCTGCCATCCAGATACCGCGTACATCGCCGCCAGTCTCCTCACCACGTTCCGCGGCTTCGGCGGCAGCTTC
GGGACCTCCATCGGCGGCGGCATGTTCTATCGCTTCCTGAGACGCAGCCTCACCCGTGGCTTCTTGGCCCTCGAC
GGCGGCCAGCACCTCAGCCCGGCTCATAATGCGCTGATACCACGCCTCCTGGGCATGCCGGAGCTGGTATTGCAC
GGTGGCCTTTCCGGCGAAGAGCAGAAAGTTGCCTTGAACGGCTATGCGGGTGCCATCGGCTTCGTCTGGATGGCC
GCTGCAATTATGATGCTCTTGGTGATGGCGGCACAGGCGGCGACGGGATGGACAGCGCCCGAGCCATTAACAGCA
GCAGATGGAGAGGCCGGCGGACACGATGAATGA
Transcript >Ophun1|4086
ATGGCCCTCTCTTCCTTGGTCCCGATCGTCGGCCGCCTCGCCGCCGCCGGAGCCGCCATGCCGCGGAGCCTCGTG
CTACCAGCCGCGACCATCTTCTGCGCCGGAGCACTTCTCGCGGCCTCGGCTTCGTCAGCGGCCGTCTTCATCGGC
GGACGGGTTCTCGCCGGTGCCGGAGGAGGTGCCTTTTTGGCCCTCGCCTTTGTCTTTGTGCTTGCGTTGGTGCCG
GAGCCTCGGAGGGGGGTCGGGCTGGGCGTCGTCAATGCAGCCATCACTGTCGGTGTCTCGCTGGGGGCTGTTGTC
TATGGAGGCTTGCTTTCGGCCGTGGGATGGCGACCCCTATTCTGGATGCAGGCTCCCGTCGCCTTTGTTGCCGCT
CTCGCCGTCTTTCTCTGTACACCGTCGTCGATACAGTCTGACCAGAAGAACCGAGAGCCGTCGTCACTGTCACAG
CGGTTGATCCGCATCGATTATCTCGGGGTTGTCCTCCTTGTAAGTCCCCTCGCGTCTACTCAGCTGCCCGGACTC
ACCATTCAGTGCCTCACGGTAGTTCTCTTCCTCTACGGCCTCGCCAGCACCGTCCAGCCTCTCATCCTCGGCCTG
TCCATCGTATCTCTCGTGGCCTTTATCGCGTGCGAGTATCTCGTCGCCGTTGATCCCGTCTTACCCCTGACTCTC
CTCTCCTCCCGCGGCGTCCTCCTCTCGTGTCTCTCCCAGCTTGGTCTCATGGCCGCCCGCTGGAGCCTACTCTTC
TTCGCACCCATCTTCATCCTGGCCGTTCACGGTGCTCCCCGTGCCGCAGCGGGTTCCGTCCTGGTGCCTACCAAC
CTCGGCTTCGCTCTAGGGGGCATCGTCGTCGGCTCGCTGCACATTCGTCGTGCCGGTTCCTTCTGGCTATCATGT
CTCATCGCCCTGGCCATCTTTTCCGCCTCTCTGCTCGGTCTCGCTATCGTAGCAGCCCCCCGAGCCGCTCTGACG
CCCCTGATTACCCTCGTCTTCATCAATGGCTTCGCAACGGGAGCTGCCCTCAACTACACCATGGCTCATCTGCTT
CATCTCTGCCATCCAGATACCGCGTACATCGCCGCCAGTCTCCTCACCACGTTCCGCGGCTTCGGCGGCAGCTTC
GGGACCTCCATCGGCGGCGGCATGTTCTATCGCTTCCTGAGACGCAGCCTCACCCGTGGCTTCTTGGCCCTCGAC
GGCGGCCAGCACCTCAGCCCGGCTCATAATGCGCTGATACCACGCCTCCTGGGCATGCCGGAGCTGGTATTGCAC
GGTGGCCTTTCCGGCGAAGAGCAGAAAGTTGCCTTGAACGGCTATGCGGGTGCCATCGGCTTCGTCTGGATGGCC
GCTGCAATTATGATGCTCTTGGTGATGGCGGCACAGGCGGCGACGGGATGGACAGCGCCCGAGCCATTAACAGCA
GCAGATGGAGAGGCCGGCGGACACGATGAATGA
Gene >Ophun1|4086
ATGGCCCTCTCTTCCTTGGTCCCGATCGTCGGCCGCCTCGCCGCCGCCGGAGCCGCCATGCCGCGGAGCCTCGTG
CTACCAGCCGCGACCATCTTCTGCGCCGGAGCACTTCTCGCGGCCTCGGCTTCGTCAGCGGCCGTCTTCATCGGC
GGACGGGTTCTCGCCGGTGCCGGAGGAGGTGCCTTTTTGGCCCTCGCCTTTGTCTTTGTGCTTGCGTTGGTGCCG
GAGCCTCGGAGGGGGGTCGGGCTGGGCGTCGTCAATGCAGCCATCACTGTCGGTGTCTCGCTGGGGGCTGTTGTC
TATGGAGGCTTGCTTTCGGCCGTGGGATGGGTGAGTAACAGTCATTGTATCAAGTATGCTCTGTCTTTGATCTTA
CCAGCGAGAGAGACAGCGACCCCTATTCTGGATGCAGGCTCCCGTCGCCTTTGTTGCCGCTCTCGCCGTCTTTCT
CTGTACACCGTCGTCGATACAGTCTGACCAGAAGAACCGAGAGCCGTCGTCACTGTCACAGCGGTTGATCCGCAT
CGATTATCTCGGGGTTGTCCTCCTTGTAAGTCCCCTCGCGTCTACTCAGCTGCCCGGACTCACCATTCAGTGCCT
CACGGTAGTTCTCTTCCTCTACGGCCTCGCCAGCACCGTCCAGCCTCTCATCCTCGGCCTGTCCATCGTATCTCT
CGTGGCCTTTATCGCGTGCGAGTATCTCGTCGCCGTTGATCCCGTCTTACCCCTGACTCTCCTCTCCTCCCGCGG
CGTCCTCCTCTCGTGTCTCTCCCAGCTTGGTCTCATGGCCGCCCGCTGGAGCCTACTCTTCTTCGCACCCATCTT
CATCCTGGCCGTTCACGGTGCTCCCCGTGCCGCAGCGGGTTCCGTCCTGGTGCCTACCAACCTCGGCTTCGCTCT
AGGGGGCATCGTCGTCGGCTCGCTGCACATTCGTCGTGCCGGTTCCTTCTGGCTATCATGTCTCATCGCCCTGGC
CATCTTTTCCGCCTCTCTGCTCGGTCTCGCTATCGTAGCAGCCCCCCGAGCCGCTCTGACGCCCCTGATTACCCT
CGTCTTCATCAATGGCTTCGCAACGGGAGCTGCCCTCAACTACACCATGGCTCATCTGCTTCATCTCTGCCATCC
AGATACCGCGTACATCGCCGCCAGTCTCCTCACCACGTTCCGCGGCTTCGGCGGCAGCTTCGGGACCTCCATCGG
CGGCGGCATGTTCTATCGCTTCCTGAGACGCAGCCTCACCCGTGGCTTCTTGGCCCTCGACGGCGGCCAGCACCT
CAGCCCGGCTCATAATGCGCTGATACCACGCCTCCTGGGCATGCCGGAGCTGGTATTGCACGGTGGCCTTTCCGG
CGAAGAGCAGAAAGTTGCCTTGAACGGCTATGCGGGTGCCATCGGCTTCGTCTGGATGGCCGCTGCAATTATGAT
GCTCTTGGTGATGGCGGCACAGGCGGCGACGGGATGGACAGCGCCCGAGCCATTAACAGCAGCAGATGGAGAGGC
CGGCGGACACGATGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail