Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4083
Gene name
LocationContig_372:14164..18169
Strand-
Gene length (bp)4005
Transcript length (bp)3633
Coding sequence length (bp)3633
Protein length (aa) 1211

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00814 TsaD tRNA N6-adenosine threonylcarbamoyltransferase 5.2E-44 831 1178

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94710|QRI7_SCHPO tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgp1 PE=3 SV=1 797 1200 7.0E-51
sp|P43122|QRI7_YEAST tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QRI7 PE=1 SV=1 779 1200 2.0E-45
sp|B8GPT9|TSAD_THISH tRNA N6-adenosine threonylcarbamoyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=tsaD PE=3 SV=1 802 1205 2.0E-45
sp|Q2VYV2|TSAD_MAGSA tRNA N6-adenosine threonylcarbamoyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=tsaD PE=3 SV=1 799 1203 7.0E-45
sp|P43764|TSAD_HAEIN tRNA N6-adenosine threonylcarbamoyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tsaD PE=3 SV=1 802 1202 7.0E-44
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94710|QRI7_SCHPO tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pgp1 PE=3 SV=1 797 1200 7.0E-51
sp|P43122|QRI7_YEAST tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QRI7 PE=1 SV=1 779 1200 2.0E-45
sp|B8GPT9|TSAD_THISH tRNA N6-adenosine threonylcarbamoyltransferase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=tsaD PE=3 SV=1 802 1205 2.0E-45
sp|Q2VYV2|TSAD_MAGSA tRNA N6-adenosine threonylcarbamoyltransferase OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=tsaD PE=3 SV=1 799 1203 7.0E-45
sp|P43764|TSAD_HAEIN tRNA N6-adenosine threonylcarbamoyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tsaD PE=3 SV=1 802 1202 7.0E-44
sp|A8FS64|TSAD_SHESH tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella sediminis (strain HAW-EB3) GN=tsaD PE=3 SV=1 801 1204 5.0E-43
sp|Q9L7A5|TSAD_HAEDU tRNA N6-adenosine threonylcarbamoyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=tsaD PE=3 SV=1 802 1204 8.0E-43
sp|Q0ATQ2|TSAD_MARMM tRNA N6-adenosine threonylcarbamoyltransferase OS=Maricaulis maris (strain MCS10) GN=tsaD PE=3 SV=1 797 1203 9.0E-43
sp|A4VHG9|TSAD_PSEU5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=tsaD PE=3 SV=2 799 1204 3.0E-42
sp|Q2NWE6|TSAD_SODGM tRNA N6-adenosine threonylcarbamoyltransferase OS=Sodalis glossinidius (strain morsitans) GN=tsaD PE=3 SV=1 801 1203 4.0E-42
sp|Q2Y7B6|TSAD_NITMU tRNA N6-adenosine threonylcarbamoyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=tsaD PE=3 SV=1 799 1206 8.0E-42
sp|B2VGJ0|TSAD_ERWT9 tRNA N6-adenosine threonylcarbamoyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=tsaD PE=3 SV=1 801 1200 1.0E-41
sp|Q8EHD6|TSAD_SHEON tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella oneidensis (strain MR-1) GN=tsaD PE=3 SV=1 801 1204 2.0E-41
sp|A9N5Y7|TSAD_SALPB tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|B4T678|TSAD_SALNS tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella newport (strain SL254) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|Q12KB7|TSAD_SHEDO tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=tsaD PE=3 SV=1 801 1204 2.0E-41
sp|Q8XX97|TSAD_RALSO tRNA N6-adenosine threonylcarbamoyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=tsaD PE=3 SV=1 799 1203 2.0E-41
sp|A6VQW2|TSAD_ACTSZ tRNA N6-adenosine threonylcarbamoyltransferase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=tsaD PE=3 SV=1 801 1202 2.0E-41
sp|Q8Z3M6|TSAD_SALTI tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella typhi GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|B5BG20|TSAD_SALPK tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|C0PYY1|TSAD_SALPC tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|Q5PKX9|TSAD_SALPA tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|Q57JQ1|TSAD_SALCH tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|B1JM18|TSAD_YERPY tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|Q665U5|TSAD_YERPS tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|A4THT1|TSAD_YERPP tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pestis (strain Pestoides F) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|Q1CME2|TSAD_YERPN tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|A9R7E3|TSAD_YERPG tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|Q74RQ9|TSAD_YERPE tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pestis GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|B2K2I3|TSAD_YERPB tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|Q1C366|TSAD_YERPA tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|A7FE71|TSAD_YERP3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tsaD PE=3 SV=1 801 1200 2.0E-41
sp|B4RY33|TSAD_ALTMD tRNA N6-adenosine threonylcarbamoyltransferase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tsaD PE=3 SV=1 801 1204 3.0E-41
sp|C3PM69|TSAD_RICAE tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia africae (strain ESF-5) GN=tsaD PE=3 SV=1 802 1203 3.0E-41
sp|Q1LK37|TSAD_CUPMC tRNA N6-adenosine threonylcarbamoyltransferase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=tsaD PE=3 SV=2 799 1202 3.0E-41
sp|Q3K5S1|TSAD_PSEPF tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=tsaD PE=3 SV=1 799 1203 3.0E-41
sp|B4TVU2|TSAD_SALSV tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=tsaD PE=3 SV=1 801 1200 4.0E-41
sp|A4G2A7|TSAD_HERAR tRNA N6-adenosine threonylcarbamoyltransferase OS=Herminiimonas arsenicoxydans GN=tsaD PE=3 SV=1 799 1204 5.0E-41
sp|A8F0E3|TSAD_RICM5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia massiliae (strain Mtu5) GN=tsaD PE=3 SV=1 802 1203 5.0E-41
sp|Q92JK6|TSAD_RICCN tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=tsaD PE=3 SV=1 802 1203 6.0E-41
sp|B2U928|TSAD_RALPJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Ralstonia pickettii (strain 12J) GN=tsaD PE=3 SV=1 799 1203 6.0E-41
sp|Q4K4W4|TSAD_PSEF5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=tsaD PE=3 SV=1 799 1203 6.0E-41
sp|A9IZF6|TSAD_BART1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=tsaD PE=3 SV=1 802 1210 6.0E-41
sp|A8EXA5|TSAD_RICCK tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia canadensis (strain McKiel) GN=tsaD PE=3 SV=1 802 1203 8.0E-41
sp|A8APV4|TSAD_CITK8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tsaD PE=3 SV=1 801 1200 8.0E-41
sp|A5VSL6|TSAD_BRUO2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=tsaD PE=3 SV=1 801 1205 9.0E-41
sp|Q31EM1|TSAD_THICR tRNA N6-adenosine threonylcarbamoyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=tsaD PE=3 SV=1 800 1204 1.0E-40
sp|A1JQW9|TSAD_YERE8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tsaD PE=3 SV=1 801 1200 1.0E-40
sp|A9M8M3|TSAD_BRUC2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=tsaD PE=3 SV=1 801 1205 1.0E-40
sp|P40731|TSAD_SALTY tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tsaD PE=3 SV=2 801 1200 1.0E-40
sp|B4TI59|TSAD_SALHS tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella heidelberg (strain SL476) GN=tsaD PE=3 SV=1 801 1200 1.0E-40
sp|B5REG6|TSAD_SALG2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=tsaD PE=3 SV=1 801 1200 1.0E-40
sp|B5QZ44|TSAD_SALEP tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=tsaD PE=3 SV=1 801 1200 1.0E-40
sp|B5FHU3|TSAD_SALDC tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella dublin (strain CT_02021853) GN=tsaD PE=3 SV=1 801 1200 1.0E-40
sp|B5F6A4|TSAD_SALA4 tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella agona (strain SL483) GN=tsaD PE=3 SV=1 801 1200 1.0E-40
sp|Q0HSD5|TSAD_SHESR tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella sp. (strain MR-7) GN=tsaD PE=3 SV=1 801 1204 1.0E-40
sp|Q0HG42|TSAD_SHESM tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella sp. (strain MR-4) GN=tsaD PE=3 SV=1 801 1204 1.0E-40
sp|A0KZT8|TSAD_SHESA tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella sp. (strain ANA-3) GN=tsaD PE=3 SV=1 801 1204 1.0E-40
sp|Q2S8V7|TSAD_HAHCH tRNA N6-adenosine threonylcarbamoyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=tsaD PE=3 SV=2 799 1200 1.0E-40
sp|B0BQ60|TSAD_ACTPJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=tsaD PE=3 SV=1 802 1202 1.0E-40
sp|B3GY07|TSAD_ACTP7 tRNA N6-adenosine threonylcarbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=tsaD PE=3 SV=1 802 1202 1.0E-40
sp|A3N1C4|TSAD_ACTP2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=tsaD PE=3 SV=1 802 1202 1.0E-40
sp|B1LF56|TSAD_ECOSM tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=tsaD PE=3 SV=1 801 1200 2.0E-40
sp|Q5GT66|TSAD_WOLTR tRNA N6-adenosine threonylcarbamoyltransferase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=tsaD PE=3 SV=1 802 1204 2.0E-40
sp|Q8FYI5|TSAD_BRUSU tRNA N6-adenosine threonylcarbamoyltransferase OS=Brucella suis biovar 1 (strain 1330) GN=tsaD PE=3 SV=1 801 1205 2.0E-40
sp|Q8YJB1|TSAD_BRUME tRNA N6-adenosine threonylcarbamoyltransferase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=tsaD PE=3 SV=1 801 1205 2.0E-40
sp|C0RFD2|TSAD_BRUMB tRNA N6-adenosine threonylcarbamoyltransferase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=tsaD PE=3 SV=1 801 1205 2.0E-40
sp|C6DKG9|TSAD_PECCP tRNA N6-adenosine threonylcarbamoyltransferase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=tsaD PE=3 SV=1 801 1200 2.0E-40
sp|B4EW57|TSAD_PROMH tRNA N6-adenosine threonylcarbamoyltransferase OS=Proteus mirabilis (strain HI4320) GN=tsaD PE=3 SV=1 801 1200 2.0E-40
sp|Q5NL82|TSAD_ZYMMO tRNA N6-adenosine threonylcarbamoyltransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=tsaD PE=3 SV=1 800 1203 2.0E-40
sp|C3K338|TSAD_PSEFS tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=tsaD PE=3 SV=1 799 1203 2.0E-40
sp|Q48NU8|TSAD_PSE14 tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=tsaD PE=3 SV=1 799 1203 2.0E-40
sp|B0CIE0|TSAD_BRUSI tRNA N6-adenosine threonylcarbamoyltransferase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=tsaD PE=3 SV=1 801 1205 2.0E-40
sp|Q7VQQ9|TSAD_BLOFL tRNA N6-adenosine threonylcarbamoyltransferase OS=Blochmannia floridanus GN=tsaD PE=3 SV=1 802 1204 2.0E-40
sp|Q1RH23|TSAD_RICBR tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia bellii (strain RML369-C) GN=tsaD PE=3 SV=1 802 1203 2.0E-40
sp|A8GU95|TSAD_RICB8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia bellii (strain OSU 85-389) GN=tsaD PE=3 SV=1 802 1203 2.0E-40
sp|A3D1Q4|TSAD_SHEB5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tsaD PE=3 SV=1 801 1204 2.0E-40
sp|Q6G1R3|TSAD_BARHE tRNA N6-adenosine threonylcarbamoyltransferase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=tsaD PE=3 SV=1 802 1210 2.0E-40
sp|Q88A57|TSAD_PSESM tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=tsaD PE=3 SV=1 799 1203 3.0E-40
sp|A4XZK6|TSAD_PSEMY tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas mendocina (strain ymp) GN=tsaD PE=3 SV=1 799 1204 3.0E-40
sp|A9L5I3|TSAD_SHEB9 tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella baltica (strain OS195) GN=tsaD PE=3 SV=1 801 1204 3.0E-40
sp|A6WKK4|TSAD_SHEB8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella baltica (strain OS185) GN=tsaD PE=3 SV=1 801 1204 3.0E-40
sp|B8EBV5|TSAD_SHEB2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella baltica (strain OS223) GN=tsaD PE=3 SV=1 801 1204 3.0E-40
sp|B1Z1G4|TSAD_BURA4 tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=tsaD PE=3 SV=1 799 1204 3.0E-40
sp|A8GJV1|TSAD_SERP5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Serratia proteamaculans (strain 568) GN=tsaD PE=3 SV=1 801 1200 3.0E-40
sp|Q1R6R7|TSAD_ECOUT tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain UTI89 / UPEC) GN=tsaD PE=3 SV=1 801 1200 3.0E-40
sp|Q8FDG6|TSAD_ECOL6 tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tsaD PE=3 SV=1 801 1200 3.0E-40
sp|Q0TD42|TSAD_ECOL5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tsaD PE=3 SV=1 801 1200 3.0E-40
sp|A1AFY6|TSAD_ECOK1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O1:K1 / APEC GN=tsaD PE=3 SV=1 801 1200 3.0E-40
sp|B7N068|TSAD_ECO81 tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O81 (strain ED1a) GN=tsaD PE=3 SV=1 801 1200 3.0E-40
sp|B7MB00|TSAD_ECO45 tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=tsaD PE=3 SV=1 801 1200 3.0E-40
sp|B8F7W7|TSAD_HAEPS tRNA N6-adenosine threonylcarbamoyltransferase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=tsaD PE=3 SV=1 802 1202 3.0E-40
sp|C4K157|TSAD_RICPU tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia peacockii (strain Rustic) GN=tsaD PE=3 SV=1 802 1203 4.0E-40
sp|Q21MU7|TSAD_SACD2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=tsaD PE=3 SV=1 801 1204 4.0E-40
sp|C5BHG1|TSAD_EDWI9 tRNA N6-adenosine threonylcarbamoyltransferase OS=Edwardsiella ictaluri (strain 93-146) GN=tsaD PE=3 SV=1 801 1202 4.0E-40
sp|Q73H71|TSAD_WOLPM tRNA N6-adenosine threonylcarbamoyltransferase OS=Wolbachia pipientis wMel GN=tsaD PE=3 SV=1 802 1204 4.0E-40
sp|A9ANA0|TSAD_BURM1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=tsaD PE=3 SV=1 799 1204 4.0E-40
sp|A6TE46|TSAD_KLEP7 tRNA N6-adenosine threonylcarbamoyltransferase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|Q3YXH9|TSAD_SHISS tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella sonnei (strain Ss046) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|Q83Q42|TSAD_SHIFL tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella flexneri GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|Q0T0J9|TSAD_SHIF8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella flexneri serotype 5b (strain 8401) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|Q31WX0|TSAD_SHIBS tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella boydii serotype 4 (strain Sb227) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|B2U1G7|TSAD_SHIB3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|B7LQD8|TSAD_ESCF3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|B6I436|TSAD_ECOSE tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain SE11) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|B1IRQ2|TSAD_ECOLC tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|A8A4M1|TSAD_ECOHS tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O9:H4 (strain HS) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|B7LZL4|TSAD_ECO8A tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O8 (strain IAI1) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|B7NJS7|TSAD_ECO7I tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|B5YRA4|TSAD_ECO5E tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|B7LGZ9|TSAD_ECO55 tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain 55989 / EAEC) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|A7ZRU6|TSAD_ECO24 tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tsaD PE=3 SV=1 801 1200 4.0E-40
sp|Q4ZMF4|TSAD_PSEU2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=tsaD PE=3 SV=1 799 1203 5.0E-40
sp|A4JLT6|TSAD_BURVG tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tsaD PE=3 SV=1 799 1204 5.0E-40
sp|B5XU22|TSAD_KLEP3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Klebsiella pneumoniae (strain 342) GN=tsaD PE=3 SV=1 801 1200 5.0E-40
sp|Q32BQ3|TSAD_SHIDS tRNA N6-adenosine threonylcarbamoyltransferase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tsaD PE=3 SV=1 801 1200 5.0E-40
sp|B7ND53|TSAD_ECOLU tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=tsaD PE=3 SV=1 801 1200 5.0E-40
sp|P05852|TSAD_ECOLI tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain K12) GN=tsaD PE=1 SV=2 801 1200 5.0E-40
sp|B1XG69|TSAD_ECODH tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain K12 / DH10B) GN=tsaD PE=3 SV=1 801 1200 5.0E-40
sp|C4ZQY1|TSAD_ECOBW tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=tsaD PE=3 SV=1 801 1200 5.0E-40
sp|C0R3B8|TSAD_WOLWR tRNA N6-adenosine threonylcarbamoyltransferase OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=tsaD PE=3 SV=1 802 1204 5.0E-40
sp|Q8XBK3|TSAD_ECO57 tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O157:H7 GN=tsaD PE=3 SV=1 801 1200 6.0E-40
sp|Q57B07|TSAD_BRUAB tRNA N6-adenosine threonylcarbamoyltransferase OS=Brucella abortus biovar 1 (strain 9-941) GN=tsaD PE=3 SV=1 801 1205 7.0E-40
sp|Q2YLM4|TSAD_BRUA2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Brucella abortus (strain 2308) GN=tsaD PE=3 SV=1 801 1205 7.0E-40
sp|B2S843|TSAD_BRUA1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Brucella abortus (strain S19) GN=tsaD PE=3 SV=1 801 1205 7.0E-40
sp|A3QBM3|TSAD_SHELP tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tsaD PE=3 SV=1 801 1204 7.0E-40
sp|B3PKA5|TSAD_CELJU tRNA N6-adenosine threonylcarbamoyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=tsaD PE=3 SV=1 801 1204 7.0E-40
sp|Q0BAL6|TSAD_BURCM tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tsaD PE=3 SV=1 799 1204 7.0E-40
sp|Q1IG31|TSAD_PSEE4 tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas entomophila (strain L48) GN=tsaD PE=3 SV=1 799 1204 8.0E-40
sp|B5FB82|TSAD_VIBFM tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio fischeri (strain MJ11) GN=tsaD PE=3 SV=1 802 1203 8.0E-40
sp|B8EJI6|TSAD_METSB tRNA N6-adenosine threonylcarbamoyltransferase OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=tsaD PE=3 SV=1 801 1204 8.0E-40
sp|A0AYZ2|TSAD_BURCH tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=tsaD PE=3 SV=1 799 1204 9.0E-40
sp|B1K3S7|TSAD_BURCC tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=tsaD PE=3 SV=1 799 1204 9.0E-40
sp|Q1BLY9|TSAD_BURCA tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=tsaD PE=3 SV=1 799 1204 9.0E-40
sp|Q65RP0|TSAD_MANSM tRNA N6-adenosine threonylcarbamoyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=tsaD PE=3 SV=1 802 1202 9.0E-40
sp|A1S3S8|TSAD_SHEAM tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tsaD PE=3 SV=1 801 1204 1.0E-39
sp|B0KJ82|TSAD_PSEPG tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas putida (strain GB-1) GN=tsaD PE=3 SV=1 799 1204 1.0E-39
sp|A5VXI4|TSAD_PSEP1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=tsaD PE=3 SV=1 799 1203 1.0E-39
sp|B4EN31|TSAD_BURCJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=tsaD PE=3 SV=1 799 1204 1.0E-39
sp|B7UIX2|TSAD_ECO27 tRNA N6-adenosine threonylcarbamoyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=tsaD PE=3 SV=1 801 1200 1.0E-39
sp|Q6FYF1|TSAD_BARQU tRNA N6-adenosine threonylcarbamoyltransferase OS=Bartonella quintana (strain Toulouse) GN=tsaD PE=3 SV=1 802 1210 2.0E-39
sp|Q393P6|TSAD_BURL3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tsaD PE=3 SV=1 799 1204 2.0E-39
sp|A4Y4F3|TSAD_SHEPC tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tsaD PE=3 SV=1 801 1204 2.0E-39
sp|A9MPV5|TSAD_SALAR tRNA N6-adenosine threonylcarbamoyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tsaD PE=3 SV=1 801 1200 2.0E-39
sp|A8GQJ1|TSAD_RICRS tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia rickettsii (strain Sheila Smith) GN=tsaD PE=3 SV=1 802 1203 2.0E-39
sp|B0BVX7|TSAD_RICRO tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia rickettsii (strain Iowa) GN=tsaD PE=3 SV=1 802 1203 2.0E-39
sp|B8CJF1|TSAD_SHEPW tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=tsaD PE=3 SV=1 801 1204 3.0E-39
sp|C5BPQ9|TSAD_TERTT tRNA N6-adenosine threonylcarbamoyltransferase OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=tsaD PE=3 SV=1 801 1204 3.0E-39
sp|A5WCC7|TSAD_PSYWF tRNA N6-adenosine threonylcarbamoyltransferase OS=Psychrobacter sp. (strain PRwf-1) GN=tsaD PE=3 SV=1 801 1202 3.0E-39
sp|A4WEJ9|TSAD_ENT38 tRNA N6-adenosine threonylcarbamoyltransferase OS=Enterobacter sp. (strain 638) GN=tsaD PE=3 SV=1 801 1200 4.0E-39
sp|Q62DT7|TSAD_BURMA tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia mallei (strain ATCC 23344) GN=tsaD PE=3 SV=1 799 1204 4.0E-39
sp|Q88QU6|TSAD_PSEPK tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas putida (strain KT2440) GN=tsaD PE=3 SV=1 799 1203 4.0E-39
sp|B1JDY5|TSAD_PSEPW tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas putida (strain W619) GN=tsaD PE=3 SV=1 799 1203 4.0E-39
sp|Q2VNJ2|TSAD_METAI tRNA N6-adenosine threonylcarbamoyltransferase OS=Methylocapsa acidiphila GN=tsaD PE=3 SV=1 801 1204 5.0E-39
sp|Q63JF6|TSAD_BURPS tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia pseudomallei (strain K96243) GN=tsaD PE=3 SV=1 799 1204 5.0E-39
sp|Q1QYX8|TSAD_CHRSD tRNA N6-adenosine threonylcarbamoyltransferase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=tsaD PE=3 SV=1 801 1204 5.0E-39
sp|Q6D9D3|TSAD_PECAS tRNA N6-adenosine threonylcarbamoyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tsaD PE=3 SV=1 801 1200 5.0E-39
sp|Q3JKA5|TSAD_BURP1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=tsaD PE=3 SV=2 799 1204 6.0E-39
sp|A3P7W1|TSAD_BURP0 tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia pseudomallei (strain 1106a) GN=tsaD PE=3 SV=2 799 1204 6.0E-39
sp|Q47IP4|TSAD_DECAR tRNA N6-adenosine threonylcarbamoyltransferase OS=Dechloromonas aromatica (strain RCB) GN=tsaD PE=3 SV=2 799 1200 6.0E-39
sp|A6WXJ1|TSAD_OCHA4 tRNA N6-adenosine threonylcarbamoyltransferase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=tsaD PE=3 SV=1 802 1206 6.0E-39
sp|B1KHE2|TSAD_SHEWM tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tsaD PE=3 SV=1 801 1204 6.0E-39
sp|Q1LSM0|TSAD_BAUCH tRNA N6-adenosine threonylcarbamoyltransferase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=tsaD PE=3 SV=1 801 1203 7.0E-39
sp|A7MJU0|TSAD_CROS8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tsaD PE=3 SV=1 801 1200 8.0E-39
sp|Q83C88|TSAD_COXBU tRNA N6-adenosine threonylcarbamoyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tsaD PE=3 SV=1 801 1202 8.0E-39
sp|Q6LV10|TSAD_PHOPR tRNA N6-adenosine threonylcarbamoyltransferase OS=Photobacterium profundum GN=tsaD PE=3 SV=1 802 1203 9.0E-39
sp|A1TYE0|TSAD_MARHV tRNA N6-adenosine threonylcarbamoyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=tsaD PE=3 SV=1 799 1204 1.0E-38
sp|B3CLX6|TSAD_WOLPP tRNA N6-adenosine threonylcarbamoyltransferase OS=Wolbachia pipientis subsp. Culex pipiens (strain wPip) GN=tsaD PE=3 SV=1 802 1206 1.0E-38
sp|Q47W35|TSAD_COLP3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tsaD PE=3 SV=1 802 1204 1.0E-38
sp|Q1GCQ5|TSAD_RUEST tRNA N6-adenosine threonylcarbamoyltransferase OS=Ruegeria sp. (strain TM1040) GN=tsaD PE=3 SV=1 799 1210 2.0E-38
sp|C4LB59|TSAD_TOLAT tRNA N6-adenosine threonylcarbamoyltransferase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=tsaD PE=3 SV=1 801 1204 2.0E-38
sp|Q493X8|TSAD_BLOPB tRNA N6-adenosine threonylcarbamoyltransferase OS=Blochmannia pennsylvanicus (strain BPEN) GN=tsaD PE=3 SV=1 801 1203 2.0E-38
sp|Q602S1|TSAD_METCA tRNA N6-adenosine threonylcarbamoyltransferase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=tsaD PE=3 SV=1 799 1204 2.0E-38
sp|B0TIN7|TSAD_SHEHH tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tsaD PE=3 SV=1 801 1204 3.0E-38
sp|Q2T7N3|TSAD_BURTA tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tsaD PE=3 SV=1 799 1204 3.0E-38
sp|Q7VXN4|TSAD_BORPE tRNA N6-adenosine threonylcarbamoyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=tsaD PE=3 SV=1 799 1202 3.0E-38
sp|Q0K862|TSAD_CUPNH tRNA N6-adenosine threonylcarbamoyltransferase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=tsaD PE=3 SV=1 799 1202 4.0E-38
sp|A1TP41|TSAD_ACIAC tRNA N6-adenosine threonylcarbamoyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=tsaD PE=3 SV=1 800 1204 4.0E-38
sp|Q2L002|TSAD_BORA1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Bordetella avium (strain 197N) GN=tsaD PE=3 SV=1 799 1202 4.0E-38
sp|B6EM15|TSAD_ALISL tRNA N6-adenosine threonylcarbamoyltransferase OS=Aliivibrio salmonicida (strain LFI1238) GN=tsaD PE=3 SV=1 802 1203 4.0E-38
sp|A4SRB1|TSAD_AERS4 tRNA N6-adenosine threonylcarbamoyltransferase OS=Aeromonas salmonicida (strain A449) GN=tsaD PE=3 SV=1 801 1204 6.0E-38
sp|A1SRR5|TSAD_PSYIN tRNA N6-adenosine threonylcarbamoyltransferase OS=Psychromonas ingrahamii (strain 37) GN=tsaD PE=3 SV=1 801 1208 7.0E-38
sp|B2JP66|TSAD_BURP8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=tsaD PE=3 SV=1 799 1204 7.0E-38
sp|A1VM52|TSAD_POLNA tRNA N6-adenosine threonylcarbamoyltransferase OS=Polaromonas naphthalenivorans (strain CJ2) GN=tsaD PE=3 SV=1 799 1206 7.0E-38
sp|Q5FPS6|TSAD_GLUOX tRNA N6-adenosine threonylcarbamoyltransferase OS=Gluconobacter oxydans (strain 621H) GN=tsaD PE=3 SV=2 802 1205 8.0E-38
sp|Q7WI34|TSAD_BORBR tRNA N6-adenosine threonylcarbamoyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=tsaD PE=3 SV=1 799 1202 9.0E-38
sp|A0KGI3|TSAD_AERHH tRNA N6-adenosine threonylcarbamoyltransferase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=tsaD PE=3 SV=1 801 1204 1.0E-37
sp|B3E4U4|TSAD_GEOLS tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=tsaD PE=3 SV=1 799 1206 1.0E-37
sp|Q3IHX1|TSAD_PSEHT tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tsaD PE=3 SV=1 802 1204 1.0E-37
sp|A6UDR4|TSAD_SINMW tRNA N6-adenosine threonylcarbamoyltransferase OS=Sinorhizobium medicae (strain WSM419) GN=tsaD PE=3 SV=1 802 1210 1.0E-37
sp|Q474C0|TSAD_CUPPJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=tsaD PE=3 SV=1 799 1202 2.0E-37
sp|Q16CW3|TSAD_ROSDO tRNA N6-adenosine threonylcarbamoyltransferase OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tsaD PE=3 SV=1 797 1205 2.0E-37
sp|B7VIH2|TSAD_VIBTL tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio tasmaniensis (strain LGP32) GN=tsaD PE=3 SV=1 802 1203 2.0E-37
sp|Q4UN61|TSAD_RICFE tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=tsaD PE=3 SV=1 802 1203 2.0E-37
sp|Q21WR0|TSAD_RHOFT tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=tsaD PE=3 SV=2 801 1200 2.0E-37
sp|B3R5H2|TSAD_CUPTR tRNA N6-adenosine threonylcarbamoyltransferase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=tsaD PE=3 SV=1 799 1202 2.0E-37
sp|Q1GP42|TSAD_SPHAL tRNA N6-adenosine threonylcarbamoyltransferase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=tsaD PE=3 SV=1 800 1203 3.0E-37
sp|B1XVZ2|TSAD_POLNS tRNA N6-adenosine threonylcarbamoyltransferase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=tsaD PE=3 SV=1 799 1208 3.0E-37
sp|A9IP11|TSAD_BORPD tRNA N6-adenosine threonylcarbamoyltransferase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=tsaD PE=3 SV=1 799 1202 3.0E-37
sp|A8H152|TSAD_SHEPA tRNA N6-adenosine threonylcarbamoyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tsaD PE=3 SV=1 801 1204 3.0E-37
sp|Q65N07|TSAD_BACLD tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tsaD PE=3 SV=1 796 1204 3.0E-37
sp|A1W9P4|TSAD_ACISJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Acidovorax sp. (strain JS42) GN=tsaD PE=3 SV=2 800 1204 4.0E-37
sp|Q0VMU1|TSAD_ALCBS tRNA N6-adenosine threonylcarbamoyltransferase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=tsaD PE=3 SV=1 801 1200 4.0E-37
sp|Q2N8R7|TSAD_ERYLH tRNA N6-adenosine threonylcarbamoyltransferase OS=Erythrobacter litoralis (strain HTCC2594) GN=tsaD PE=3 SV=1 800 1203 4.0E-37
sp|Q92LH8|TSAD_RHIME tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhizobium meliloti (strain 1021) GN=tsaD PE=3 SV=1 802 1210 4.0E-37
sp|Q0A5M7|TSAD_ALKEH tRNA N6-adenosine threonylcarbamoyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=tsaD PE=3 SV=1 801 1202 4.0E-37
sp|B0USH5|TSAD_HISS2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Histophilus somni (strain 2336) GN=tsaD PE=3 SV=1 801 1202 5.0E-37
sp|Q5PAV6|TSAD_ANAMM tRNA N6-adenosine threonylcarbamoyltransferase OS=Anaplasma marginale (strain St. Maries) GN=tsaD PE=3 SV=1 801 1200 5.0E-37
sp|A5IEF9|TSAD_LEGPC tRNA N6-adenosine threonylcarbamoyltransferase OS=Legionella pneumophila (strain Corby) GN=tsaD PE=3 SV=1 799 1200 6.0E-37
sp|Q5ZT08|TSAD_LEGPH tRNA N6-adenosine threonylcarbamoyltransferase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tsaD PE=3 SV=1 799 1200 8.0E-37
sp|Q2GEG6|TSAD_NEOSM tRNA N6-adenosine threonylcarbamoyltransferase OS=Neorickettsia sennetsu (strain Miyayama) GN=tsaD PE=3 SV=1 800 1199 8.0E-37
sp|Q5WU89|TSAD_LEGPL tRNA N6-adenosine threonylcarbamoyltransferase OS=Legionella pneumophila (strain Lens) GN=tsaD PE=3 SV=1 799 1200 9.0E-37
sp|Q7W668|TSAD_BORPA tRNA N6-adenosine threonylcarbamoyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=tsaD PE=3 SV=1 799 1202 9.0E-37
sp|C1DIY3|TSAD_AZOVD tRNA N6-adenosine threonylcarbamoyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=tsaD PE=3 SV=1 799 1204 9.0E-37
sp|Q7NUE3|TSAD_CHRVO tRNA N6-adenosine threonylcarbamoyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tsaD PE=3 SV=1 799 1204 1.0E-36
sp|Q6FCK9|TSAD_ACIAD tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=tsaD PE=3 SV=1 799 1202 1.0E-36
sp|C4K3R9|TSAD_HAMD5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=tsaD PE=3 SV=1 801 1202 1.0E-36
sp|A8GM49|TSAD_RICAH tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia akari (strain Hartford) GN=tsaD PE=3 SV=1 802 1203 2.0E-36
sp|Q5QY46|TSAD_IDILO tRNA N6-adenosine threonylcarbamoyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tsaD PE=3 SV=1 801 1202 2.0E-36
sp|Q0AJ91|TSAD_NITEC tRNA N6-adenosine threonylcarbamoyltransferase OS=Nitrosomonas eutropha (strain C91) GN=tsaD PE=3 SV=1 799 1203 2.0E-36
sp|A4SZK1|TSAD_POLSQ tRNA N6-adenosine threonylcarbamoyltransferase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=tsaD PE=3 SV=1 799 1207 2.0E-36
sp|Q7N0B6|TSAD_PHOLL tRNA N6-adenosine threonylcarbamoyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tsaD PE=3 SV=1 801 1200 2.0E-36
sp|A1WHJ5|TSAD_VEREI tRNA N6-adenosine threonylcarbamoyltransferase OS=Verminephrobacter eiseniae (strain EF01-2) GN=tsaD PE=3 SV=2 799 1204 2.0E-36
sp|B1LA07|TSAD_THESQ tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermotoga sp. (strain RQ2) GN=tsaD PE=3 SV=1 802 1198 4.0E-36
sp|A5IKS6|TSAD_THEP1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=tsaD PE=3 SV=1 802 1198 4.0E-36
sp|A6VU47|TSAD_MARMS tRNA N6-adenosine threonylcarbamoyltransferase OS=Marinomonas sp. (strain MWYL1) GN=tsaD PE=3 SV=1 801 1200 4.0E-36
sp|Q5X2T1|TSAD_LEGPA tRNA N6-adenosine threonylcarbamoyltransferase OS=Legionella pneumophila (strain Paris) GN=tsaD PE=3 SV=1 799 1200 4.0E-36
sp|A6UZ83|TSAD_PSEA7 tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=tsaD PE=3 SV=1 801 1204 4.0E-36
sp|C1DB12|TSAD_LARHH tRNA N6-adenosine threonylcarbamoyltransferase OS=Laribacter hongkongensis (strain HLHK9) GN=tsaD PE=3 SV=1 799 1204 5.0E-36
sp|Q9I5V7|TSAD_PSEAE tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tsaD PE=3 SV=1 801 1204 5.0E-36
sp|A8LP83|TSAD_DINSH tRNA N6-adenosine threonylcarbamoyltransferase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=tsaD PE=3 SV=1 799 1204 6.0E-36
sp|Q02TI3|TSAD_PSEAB tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tsaD PE=3 SV=1 801 1204 7.0E-36
sp|Q3JF13|TSAD_NITOC tRNA N6-adenosine threonylcarbamoyltransferase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=tsaD PE=3 SV=1 801 1204 7.0E-36
sp|A4IJU4|TSAD_GEOTN tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=tsaD PE=3 SV=2 799 1198 7.0E-36
sp|Q13RW9|TSAD_BURXL tRNA N6-adenosine threonylcarbamoyltransferase OS=Burkholderia xenovorans (strain LB400) GN=tsaD PE=3 SV=1 799 1204 1.0E-35
sp|Q1QE85|TSAD_PSYCK tRNA N6-adenosine threonylcarbamoyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=tsaD PE=3 SV=1 801 1202 1.0E-35
sp|B7V4G6|TSAD_PSEA8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=tsaD PE=3 SV=1 801 1204 1.0E-35
sp|Q2G4K2|TSAD_NOVAD tRNA N6-adenosine threonylcarbamoyltransferase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=tsaD PE=3 SV=1 800 1203 1.0E-35
sp|Q63GW2|TSAD_BACCZ tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus cereus (strain ZK / E33L) GN=tsaD PE=3 SV=1 797 1204 1.0E-35
sp|Q6I4E9|TSAD_BACAN tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus anthracis GN=tsaD PE=3 SV=1 797 1204 1.0E-35
sp|Q4FNV6|TSAD_PELUB tRNA N6-adenosine threonylcarbamoyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=tsaD PE=3 SV=1 797 1204 1.0E-35
sp|Q3SGB3|TSAD_THIDA tRNA N6-adenosine threonylcarbamoyltransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=tsaD PE=3 SV=1 799 1204 2.0E-35
sp|Q0C5X3|TSAD_HYPNA tRNA N6-adenosine threonylcarbamoyltransferase OS=Hyphomonas neptunium (strain ATCC 15444) GN=tsaD PE=3 SV=1 797 1203 2.0E-35
sp|Q6HPD3|TSAD_BACHK tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=tsaD PE=3 SV=1 797 1204 2.0E-35
sp|Q9ZEA8|TSAD_RICPR tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia prowazekii (strain Madrid E) GN=tsaD PE=3 SV=1 802 1203 3.0E-35
sp|B0VKC7|TSAD_ACIBS tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baumannii (strain SDF) GN=tsaD PE=3 SV=1 799 1202 3.0E-35
sp|Q2GK88|TSAD_ANAPZ tRNA N6-adenosine threonylcarbamoyltransferase OS=Anaplasma phagocytophilum (strain HZ) GN=tsaD PE=3 SV=1 800 1204 3.0E-35
sp|Q5L3F6|TSAD_GEOKA tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacillus kaustophilus (strain HTA426) GN=tsaD PE=3 SV=1 799 1198 3.0E-35
sp|Q68XR3|TSAD_RICTY tRNA N6-adenosine threonylcarbamoyltransferase OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=tsaD PE=3 SV=1 802 1203 4.0E-35
sp|B5YDS4|TSAD_DICT6 tRNA N6-adenosine threonylcarbamoyltransferase OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=tsaD PE=3 SV=1 799 1205 4.0E-35
sp|Q9WXZ2|TSAD_THEMA tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=tsaD PE=3 SV=1 802 1198 4.0E-35
sp|A1ARX8|TSAD_PELPD tRNA N6-adenosine threonylcarbamoyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=tsaD PE=3 SV=1 799 1203 4.0E-35
sp|Q73ES6|TSAD_BACC1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=tsaD PE=3 SV=2 797 1204 5.0E-35
sp|Q4FV71|TSAD_PSYA2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=tsaD PE=3 SV=1 801 1202 5.0E-35
sp|Q2RND2|TSAD_RHORT tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=tsaD PE=3 SV=2 801 1203 5.0E-35
sp|A0R8V9|TSAD_BACAH tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus thuringiensis (strain Al Hakam) GN=tsaD PE=3 SV=1 797 1204 6.0E-35
sp|B0V811|TSAD_ACIBY tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baumannii (strain AYE) GN=tsaD PE=3 SV=1 799 1202 7.0E-35
sp|B2HUS7|TSAD_ACIBC tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=tsaD PE=3 SV=1 799 1202 7.0E-35
sp|B7I2K6|TSAD_ACIB5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=tsaD PE=3 SV=1 799 1202 7.0E-35
sp|B7H0A7|TSAD_ACIB3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=tsaD PE=3 SV=1 799 1202 7.0E-35
sp|Q81IS8|TSAD_BACCR tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=tsaD PE=3 SV=1 797 1204 7.0E-35
sp|A4XM18|TSAD_CALS8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=tsaD PE=3 SV=1 799 1205 8.0E-35
sp|P36175|TSAD_MANHA tRNA N6-adenosine threonylcarbamoyltransferase OS=Mannheimia haemolytica GN=tsaD PE=1 SV=1 802 1179 1.0E-34
sp|O22145|OSGP2_ARATH Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Arabidopsis thaliana GN=GCP1 PE=2 SV=2 799 1187 1.0E-34
sp|Q8D283|TSAD_WIGBR tRNA N6-adenosine threonylcarbamoyltransferase OS=Wigglesworthia glossinidia brevipalpis GN=tsaD PE=3 SV=1 799 1203 1.0E-34
sp|B8E1B4|TSAD_DICTD tRNA N6-adenosine threonylcarbamoyltransferase OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=tsaD PE=3 SV=1 799 1205 2.0E-34
sp|B3CRT6|TSAD_ORITI tRNA N6-adenosine threonylcarbamoyltransferase OS=Orientia tsutsugamushi (strain Ikeda) GN=tsaD PE=3 SV=1 802 1203 2.0E-34
sp|Q7MNZ9|TSAD_VIBVY tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio vulnificus (strain YJ016) GN=tsaD PE=3 SV=1 802 1203 3.0E-34
sp|Q8DEG4|TSAD_VIBVU tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio vulnificus (strain CMCP6) GN=tsaD PE=3 SV=1 802 1203 3.0E-34
sp|A5CE49|TSAD_ORITB tRNA N6-adenosine threonylcarbamoyltransferase OS=Orientia tsutsugamushi (strain Boryong) GN=tsaD PE=3 SV=1 802 1203 4.0E-34
sp|Q1GYU4|TSAD_METFK tRNA N6-adenosine threonylcarbamoyltransferase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=tsaD PE=3 SV=1 799 1202 4.0E-34
sp|Q82XN2|TSAD_NITEU tRNA N6-adenosine threonylcarbamoyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=tsaD PE=3 SV=1 799 1203 5.0E-34
sp|Q127W3|TSAD_POLSJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=tsaD PE=3 SV=1 799 1202 5.0E-34
sp|Q8PFV1|TSAD_XANAC tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tsaD PE=3 SV=1 801 1204 5.0E-34
sp|A4VSP7|TSAD_STRSY tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus suis (strain 05ZYH33) GN=tsaD PE=3 SV=1 800 1204 5.0E-34
sp|A4VYZ0|TSAD_STRS2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus suis (strain 98HAH33) GN=tsaD PE=3 SV=1 800 1204 5.0E-34
sp|B7GFQ4|TSAD_ANOFW tRNA N6-adenosine threonylcarbamoyltransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=tsaD PE=3 SV=1 796 1198 6.0E-34
sp|Q9ABZ9|TSAD_CAUCR tRNA N6-adenosine threonylcarbamoyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=tsaD PE=3 SV=1 799 1203 8.0E-34
sp|O05518|TSAD_BACSU tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus subtilis (strain 168) GN=tsaD PE=1 SV=1 794 1204 1.0E-33
sp|Q5LLR7|TSAD_RUEPO tRNA N6-adenosine threonylcarbamoyltransferase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tsaD PE=3 SV=1 799 1203 1.0E-33
sp|A1UQZ7|TSAD_BARBK tRNA N6-adenosine threonylcarbamoyltransferase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=tsaD PE=3 SV=1 802 1210 1.0E-33
sp|Q5HBC3|TSAD_EHRRW tRNA N6-adenosine threonylcarbamoyltransferase OS=Ehrlichia ruminantium (strain Welgevonden) GN=tsaD PE=3 SV=1 800 1204 2.0E-33
sp|C5CT30|TSAD_VARPS tRNA N6-adenosine threonylcarbamoyltransferase OS=Variovorax paradoxus (strain S110) GN=tsaD PE=3 SV=1 799 1204 2.0E-33
sp|Q5FGU3|TSAD_EHRRG tRNA N6-adenosine threonylcarbamoyltransferase OS=Ehrlichia ruminantium (strain Gardel) GN=tsaD PE=3 SV=1 800 1204 2.0E-33
sp|B7IGB4|TSAD_THEAB tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermosipho africanus (strain TCF52B) GN=tsaD PE=3 SV=1 799 1198 4.0E-33
sp|B4RQ33|TSAD_NEIG2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=tsaD PE=3 SV=1 799 1202 4.0E-33
sp|Q5FAC2|TSAD_NEIG1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=tsaD PE=3 SV=1 799 1202 4.0E-33
sp|Q87SL5|TSAD_VIBPA tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tsaD PE=3 SV=1 802 1203 4.0E-33
sp|A1WZH8|TSAD_HALHL tRNA N6-adenosine threonylcarbamoyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=tsaD PE=3 SV=1 801 1202 4.0E-33
sp|Q3BNE2|TSAD_XANC5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tsaD PE=3 SV=1 801 1202 5.0E-33
sp|A3CKS0|TSAD_STRSV tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus sanguinis (strain SK36) GN=tsaD PE=3 SV=1 802 1204 5.0E-33
sp|A8AUT2|TSAD_STRGC tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=tsaD PE=3 SV=1 802 1204 6.0E-33
sp|A1VD24|TSAD_DESVV tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=tsaD PE=3 SV=1 799 1199 7.0E-33
sp|Q72B00|TSAD_DESVH tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=tsaD PE=3 SV=1 799 1199 7.0E-33
sp|A2SFL8|TSAD_METPP tRNA N6-adenosine threonylcarbamoyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=tsaD PE=3 SV=2 799 1204 7.0E-33
sp|A3PG14|TSAD_RHOS1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=tsaD PE=3 SV=1 797 1203 8.0E-33
sp|A1AXM9|TSAD_RUTMC tRNA N6-adenosine threonylcarbamoyltransferase OS=Ruthia magnifica subsp. Calyptogena magnifica GN=tsaD PE=3 SV=1 799 1203 9.0E-33
sp|C3LS11|TSAD_VIBCM tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=tsaD PE=3 SV=1 802 1203 1.0E-32
sp|A5F9E8|TSAD_VIBC3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tsaD PE=3 SV=1 802 1203 1.0E-32
sp|Q74C11|TSAD_GEOSL tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=tsaD PE=3 SV=1 799 1203 1.0E-32
sp|C5CD32|TSAD_KOSOT tRNA N6-adenosine threonylcarbamoyltransferase OS=Kosmotoga olearia (strain TBF 19.5.1) GN=tsaD PE=3 SV=1 802 1204 1.0E-32
sp|Q9JY06|TSAD_NEIMB tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=tsaD PE=3 SV=1 799 1200 1.0E-32
sp|Q5P261|TSAD_AROAE tRNA N6-adenosine threonylcarbamoyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=tsaD PE=3 SV=1 801 1176 2.0E-32
sp|B9KRE8|TSAD_RHOSK tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodobacter sphaeroides (strain KD131 / KCTC 12085) GN=tsaD PE=3 SV=1 797 1203 3.0E-32
sp|A1KS96|TSAD_NEIMF tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=tsaD PE=3 SV=1 799 1202 3.0E-32
sp|Q3J6D2|TSAD_RHOS4 tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=tsaD PE=3 SV=1 797 1203 3.0E-32
sp|Q67K94|TSAD_SYMTH tRNA N6-adenosine threonylcarbamoyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tsaD PE=3 SV=1 800 1202 3.0E-32
sp|Q30BK9|TSAD_NEIME tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria meningitidis GN=tsaD PE=3 SV=1 799 1202 4.0E-32
sp|Q9PG67|TSAD_XYLFA tRNA N6-adenosine threonylcarbamoyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=tsaD PE=3 SV=1 801 1204 4.0E-32
sp|A5CVM3|TSAD_VESOH tRNA N6-adenosine threonylcarbamoyltransferase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=tsaD PE=3 SV=1 799 1203 4.0E-32
sp|Q8P494|TSAD_XANCP tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tsaD PE=3 SV=1 801 1204 5.0E-32
sp|B0RXI2|TSAD_XANCB tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=tsaD PE=3 SV=1 801 1204 5.0E-32
sp|Q4UPU5|TSAD_XANC8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tsaD PE=3 SV=1 801 1204 5.0E-32
sp|Q32LQ3|OSGP2_DANRE Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Danio rerio GN=osgepl1 PE=2 SV=2 789 1187 5.0E-32
sp|Q49Z04|TSAD_STAS1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=tsaD PE=3 SV=1 800 1194 7.0E-32
sp|C0QTG9|TSAD_PERMH tRNA N6-adenosine threonylcarbamoyltransferase OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=tsaD PE=3 SV=1 802 1203 7.0E-32
sp|C1CI40|TSAD_STRZP tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain P1031) GN=tsaD PE=3 SV=1 802 1189 8.0E-32
sp|Q2GGH9|TSAD_EHRCR tRNA N6-adenosine threonylcarbamoyltransferase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=tsaD PE=3 SV=1 800 1204 8.0E-32
sp|Q87B17|TSAD_XYLFT tRNA N6-adenosine threonylcarbamoyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=tsaD PE=3 SV=1 801 1204 8.0E-32
sp|B0U4B5|TSAD_XYLFM tRNA N6-adenosine threonylcarbamoyltransferase OS=Xylella fastidiosa (strain M12) GN=tsaD PE=3 SV=1 801 1204 8.0E-32
sp|B2I7X4|TSAD_XYLF2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Xylella fastidiosa (strain M23) GN=tsaD PE=3 SV=1 801 1204 8.0E-32
sp|Q5GV94|TSAD_XANOR tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tsaD PE=3 SV=1 801 1204 9.0E-32
sp|B2SLA3|TSAD_XANOP tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=tsaD PE=3 SV=1 801 1204 9.0E-32
sp|Q2NYH1|TSAD_XANOM tRNA N6-adenosine threonylcarbamoyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tsaD PE=3 SV=1 801 1204 9.0E-32
sp|B8ZK13|TSAD_STRPJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=tsaD PE=3 SV=1 802 1189 9.0E-32
sp|Q4L7T2|TSAD_STAHJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=tsaD PE=3 SV=1 797 1203 9.0E-32
sp|B5ZTC5|TSAD_RHILW tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=tsaD PE=3 SV=1 799 1210 1.0E-31
sp|A0L5L8|TSAD_MAGMM tRNA N6-adenosine threonylcarbamoyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=tsaD PE=3 SV=1 799 1177 1.0E-31
sp|A1IQ95|TSAD_NEIMA tRNA N6-adenosine threonylcarbamoyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=tsaD PE=3 SV=1 799 1202 1.0E-31
sp|A5G3X1|TSAD_GEOUR tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=tsaD PE=3 SV=1 799 1204 1.0E-31
sp|Q8CNL9|TSAD_STAES tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=tsaD PE=3 SV=1 800 1204 1.0E-31
sp|Q5HMG7|TSAD_STAEQ tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=tsaD PE=3 SV=1 800 1204 1.0E-31
sp|Q03E69|TSAD_PEDPA tRNA N6-adenosine threonylcarbamoyltransferase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=tsaD PE=3 SV=1 800 1206 2.0E-31
sp|C1CBV0|TSAD_STRZJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain JJA) GN=tsaD PE=3 SV=1 802 1189 2.0E-31
sp|Q9KFD3|TSAD_BACHD tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=tsaD PE=3 SV=1 798 1204 2.0E-31
sp|O66986|TSAD_AQUAE tRNA N6-adenosine threonylcarbamoyltransferase OS=Aquifex aeolicus (strain VF5) GN=tsaD PE=3 SV=1 801 1203 2.0E-31
sp|B5E614|TSAD_STRP4 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=tsaD PE=3 SV=1 802 1189 2.0E-31
sp|Q98EI6|TSAD_RHILO tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhizobium loti (strain MAFF303099) GN=tsaD PE=3 SV=1 801 1204 2.0E-31
sp|C1CP14|TSAD_STRZT tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=tsaD PE=3 SV=1 802 1189 3.0E-31
sp|A6LKP0|TSAD_THEM4 tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=tsaD PE=3 SV=1 799 1202 3.0E-31
sp|Q11TP2|TSAD_CYTH3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=tsaD PE=3 SV=1 802 1189 3.0E-31
sp|Q3AE55|TSAD_CARHZ tRNA N6-adenosine threonylcarbamoyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=tsaD PE=3 SV=1 800 1198 3.0E-31
sp|C6BTU8|TSAD_DESAD tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=tsaD PE=3 SV=1 799 1199 3.0E-31
sp|A0M1X3|TSAD_GRAFK tRNA N6-adenosine threonylcarbamoyltransferase OS=Gramella forsetii (strain KT0803) GN=tsaD PE=3 SV=1 797 1200 3.0E-31
sp|B1I843|TSAD_STRPI tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=tsaD PE=3 SV=1 802 1189 3.0E-31
sp|A7HGZ6|TSAD_ANADF tRNA N6-adenosine threonylcarbamoyltransferase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tsaD PE=3 SV=1 801 1202 3.0E-31
sp|B8J7H2|TSAD_ANAD2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=tsaD PE=3 SV=1 801 1202 4.0E-31
sp|Q929U3|TSAD_LISIN tRNA N6-adenosine threonylcarbamoyltransferase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=tsaD PE=3 SV=1 796 1203 4.0E-31
sp|C1CAF6|TSAD_STRP7 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain 70585) GN=tsaD PE=3 SV=1 802 1189 4.0E-31
sp|Q8DRH2|TSAD_STRR6 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=tsaD PE=3 SV=1 802 1204 4.0E-31
sp|Q04MU2|TSAD_STRP2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=tsaD PE=3 SV=1 802 1204 4.0E-31
sp|A0Q864|TSAD_FRATN tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. novicida (strain U112) GN=tsaD PE=3 SV=1 799 1194 5.0E-31
sp|Q2LSP8|TSAD_SYNAS tRNA N6-adenosine threonylcarbamoyltransferase OS=Syntrophus aciditrophicus (strain SB) GN=tsaD PE=3 SV=1 799 1203 5.0E-31
sp|Q97T27|TSAD_STRPN tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=tsaD PE=3 SV=1 802 1189 6.0E-31
sp|A0AKI2|TSAD_LISW6 tRNA N6-adenosine threonylcarbamoyltransferase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=tsaD PE=3 SV=2 796 1203 6.0E-31
sp|B9K6Y6|TSAD_THENN tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=tsaD PE=3 SV=1 802 1202 7.0E-31
sp|C3KUS7|TSAD_CLOB6 tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain 657 / Type Ba4) GN=tsaD PE=3 SV=1 802 1205 8.0E-31
sp|Q89B07|TSAD_BUCBP tRNA N6-adenosine threonylcarbamoyltransferase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=tsaD PE=3 SV=1 802 1202 8.0E-31
sp|Q3YS67|TSAD_EHRCJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Ehrlichia canis (strain Jake) GN=tsaD PE=3 SV=1 800 1204 9.0E-31
sp|B2IRL3|TSAD_STRPS tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus pneumoniae (strain CGSP14) GN=tsaD PE=3 SV=1 802 1188 9.0E-31
sp|A1B3J6|TSAD_PARDP tRNA N6-adenosine threonylcarbamoyltransferase OS=Paracoccus denitrificans (strain Pd 1222) GN=tsaD PE=3 SV=1 799 1205 9.0E-31
sp|A5EWZ5|TSAD_DICNV tRNA N6-adenosine threonylcarbamoyltransferase OS=Dichelobacter nodosus (strain VCS1703A) GN=tsaD PE=3 SV=1 801 1202 9.0E-31
sp|A4WWN6|TSAD_RHOS5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=tsaD PE=3 SV=1 799 1210 1.0E-30
sp|B3Q867|TSAD_RHOPT tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodopseudomonas palustris (strain TIE-1) GN=tsaD PE=3 SV=1 799 1204 1.0E-30
sp|Q2IFU7|TSAD_ANADE tRNA N6-adenosine threonylcarbamoyltransferase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tsaD PE=3 SV=1 801 1202 1.0E-30
sp|A4IWA2|TSAD_FRATW tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tsaD PE=3 SV=1 799 1194 1.0E-30
sp|Q8Y5I7|TSAD_LISMO tRNA N6-adenosine threonylcarbamoyltransferase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=tsaD PE=3 SV=1 796 1203 1.0E-30
sp|B2V910|TSAD_SULSY tRNA N6-adenosine threonylcarbamoyltransferase OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=tsaD PE=3 SV=1 799 1185 1.0E-30
sp|A9NHW6|TSAD_ACHLI tRNA N6-adenosine threonylcarbamoyltransferase OS=Acholeplasma laidlawii (strain PG-8A) GN=tsaD PE=3 SV=1 799 1185 1.0E-30
sp|Q5NIC9|TSAD_FRATT tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tsaD PE=3 SV=1 799 1194 2.0E-30
sp|B2SFD9|TSAD_FRATM tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tsaD PE=3 SV=1 799 1194 2.0E-30
sp|Q14JT2|TSAD_FRAT1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tsaD PE=3 SV=1 799 1194 2.0E-30
sp|Q2K3D7|TSAD_RHIEC tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tsaD PE=3 SV=2 802 1210 2.0E-30
sp|Q03SR5|TSAD_LACBA tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=tsaD PE=3 SV=1 796 1207 2.0E-30
sp|Q28JW5|TSAD_JANSC tRNA N6-adenosine threonylcarbamoyltransferase OS=Jannaschia sp. (strain CCS1) GN=tsaD PE=3 SV=1 799 1204 2.0E-30
sp|Q71XT8|TSAD_LISMF tRNA N6-adenosine threonylcarbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=tsaD PE=3 SV=2 796 1203 2.0E-30
sp|C1KX28|TSAD_LISMC tRNA N6-adenosine threonylcarbamoyltransferase OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=tsaD PE=3 SV=1 796 1203 2.0E-30
sp|Q4V7F3|OSGP2_RAT Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Rattus norvegicus GN=Osgepl1 PE=2 SV=1 800 1188 3.0E-30
sp|B1L1Z3|TSAD_CLOBM tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=tsaD PE=3 SV=1 802 1205 3.0E-30
sp|Q1MAQ8|TSAD_RHIL3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=tsaD PE=3 SV=1 799 1210 3.0E-30
sp|A7GIP8|TSAD_CLOBL tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=tsaD PE=3 SV=1 802 1205 4.0E-30
sp|A5I738|TSAD_CLOBH tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=tsaD PE=3 SV=1 802 1205 4.0E-30
sp|A7FYQ8|TSAD_CLOB1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=tsaD PE=3 SV=1 802 1205 4.0E-30
sp|Q8KA56|TSAD_BUCAP tRNA N6-adenosine threonylcarbamoyltransferase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=tsaD PE=3 SV=1 802 1203 4.0E-30
sp|C1FLX0|TSAD_CLOBJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain Kyoto / Type A2) GN=tsaD PE=3 SV=1 802 1205 4.0E-30
sp|Q6ND54|TSAD_RHOPA tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=tsaD PE=3 SV=2 799 1204 4.0E-30
sp|B2FK06|TSAD_STRMK tRNA N6-adenosine threonylcarbamoyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=tsaD PE=3 SV=1 801 1204 4.0E-30
sp|C6E7C1|TSAD_GEOSM tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacter sp. (strain M21) GN=tsaD PE=3 SV=1 799 1203 5.0E-30
sp|B1IFE9|TSAD_CLOBK tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium botulinum (strain Okra / Type B1) GN=tsaD PE=3 SV=1 802 1205 6.0E-30
sp|A7NEB6|TSAD_FRATF tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tsaD PE=3 SV=1 799 1194 7.0E-30
sp|Q7A4H8|TSAD_STAAN tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain N315) GN=tsaD PE=1 SV=1 797 1203 8.0E-30
sp|Q99SK3|TSAD_STAAM tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=tsaD PE=3 SV=1 797 1203 8.0E-30
sp|A7X4L9|TSAD_STAA1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=tsaD PE=3 SV=1 797 1203 8.0E-30
sp|Q6PEB4|OSGP2_MOUSE Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Mus musculus GN=Osgepl1 PE=1 SV=2 800 1188 9.0E-30
sp|B9JCG8|TSAD_AGRRK tRNA N6-adenosine threonylcarbamoyltransferase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=tsaD PE=3 SV=1 799 1210 9.0E-30
sp|Q0BKC8|TSAD_FRATO tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tsaD PE=3 SV=1 799 1194 9.0E-30
sp|Q2A1N0|TSAD_FRATH tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tsaD PE=3 SV=1 799 1194 9.0E-30
sp|Q2RGJ3|TSAD_MOOTA tRNA N6-adenosine threonylcarbamoyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=tsaD PE=3 SV=1 801 1180 1.0E-29
sp|Q1WSV5|TSAD_LACS1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus salivarius (strain UCC118) GN=tsaD PE=3 SV=1 800 1208 1.0E-29
sp|A5IUJ5|TSAD_STAA9 tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain JH9) GN=tsaD PE=3 SV=1 797 1203 1.0E-29
sp|A6U3D4|TSAD_STAA2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain JH1) GN=tsaD PE=3 SV=1 797 1203 1.0E-29
sp|B8D6X0|TSAD_BUCAT tRNA N6-adenosine threonylcarbamoyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=tsaD PE=3 SV=1 802 1203 1.0E-29
sp|P57166|TSAD_BUCAI tRNA N6-adenosine threonylcarbamoyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=tsaD PE=3 SV=1 802 1203 1.0E-29
sp|B8D8L6|TSAD_BUCA5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=tsaD PE=3 SV=1 802 1203 1.0E-29
sp|Q88YN0|TSAD_LACPL tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=tsaD PE=3 SV=1 800 1207 2.0E-29
sp|B4SHI9|TSAD_STRM5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Stenotrophomonas maltophilia (strain R551-3) GN=tsaD PE=3 SV=1 801 1204 2.0E-29
sp|Q7VF36|TSAD_HELHP tRNA N6-adenosine threonylcarbamoyltransferase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=tsaD PE=3 SV=1 800 1187 2.0E-29
sp|Q5WJP5|TSAD_BACSK tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacillus clausii (strain KSM-K16) GN=tsaD PE=3 SV=1 802 1204 2.0E-29
sp|Q8NVJ5|TSAD_STAAW tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain MW2) GN=tsaD PE=3 SV=1 797 1203 2.0E-29
sp|Q6G7Q8|TSAD_STAAS tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain MSSA476) GN=tsaD PE=3 SV=1 797 1203 2.0E-29
sp|Q6GF23|TSAD_STAAR tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain MRSA252) GN=tsaD PE=3 SV=1 797 1203 2.0E-29
sp|A8Z4V2|TSAD_STAAT tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=tsaD PE=3 SV=1 797 1203 2.0E-29
sp|A6QIP6|TSAD_STAAE tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain Newman) GN=tsaD PE=3 SV=1 797 1203 2.0E-29
sp|Q5HEF2|TSAD_STAAC tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain COL) GN=tsaD PE=3 SV=1 797 1203 2.0E-29
sp|Q2FWL2|TSAD_STAA8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain NCTC 8325) GN=tsaD PE=1 SV=1 797 1203 2.0E-29
sp|Q2FF75|TSAD_STAA3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain USA300) GN=tsaD PE=3 SV=1 797 1203 2.0E-29
sp|A9FDL0|TSAD_SORC5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Sorangium cellulosum (strain So ce56) GN=tsaD PE=3 SV=1 801 1202 3.0E-29
sp|Q6MQ48|TSAD_BDEBA tRNA N6-adenosine threonylcarbamoyltransferase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=tsaD PE=3 SV=1 801 1179 3.0E-29
sp|Q7MU42|TSAD_PORGI tRNA N6-adenosine threonylcarbamoyltransferase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=tsaD PE=3 SV=1 796 1187 3.0E-29
sp|Q8UC47|TSAD_AGRFC tRNA N6-adenosine threonylcarbamoyltransferase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=tsaD PE=3 SV=2 799 1210 4.0E-29
sp|B8J025|TSAD_DESDA tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=tsaD PE=3 SV=1 799 1199 4.0E-29
sp|B3PQA4|TSAD_RHIE6 tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhizobium etli (strain CIAT 652) GN=tsaD PE=3 SV=1 801 1210 4.0E-29
sp|Q2YUG0|TSAD_STAAB tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=tsaD PE=3 SV=1 797 1203 5.0E-29
sp|B4U0X7|TSAD_STREM tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain MGCS10565) GN=tsaD PE=3 SV=1 802 1204 7.0E-29
sp|B9DML1|TSAD_STACT tRNA N6-adenosine threonylcarbamoyltransferase OS=Staphylococcus carnosus (strain TM300) GN=tsaD PE=3 SV=1 800 1203 7.0E-29
sp|Q11DF0|TSAD_CHESB tRNA N6-adenosine threonylcarbamoyltransferase OS=Chelativorans sp. (strain BNC1) GN=tsaD PE=3 SV=1 801 1203 7.0E-29
sp|Q6AD38|TSAD_LEIXX tRNA N6-adenosine threonylcarbamoyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=tsaD PE=3 SV=1 800 1189 9.0E-29
sp|Q3A3G6|TSAD_PELCD tRNA N6-adenosine threonylcarbamoyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=tsaD PE=3 SV=1 799 1203 1.0E-28
sp|Q8E3F9|TSAD_STRA3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=tsaD PE=3 SV=1 802 1203 1.0E-28
sp|B9KXJ0|TSAD_THERP tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=tsaD PE=3 SV=1 799 1208 2.0E-28
sp|Q2J3D4|TSAD_RHOP2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=tsaD PE=3 SV=2 799 1204 2.0E-28
sp|Q07VK8|TSAD_RHOP5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodopseudomonas palustris (strain BisA53) GN=tsaD PE=3 SV=2 800 1204 2.0E-28
sp|B7K765|TSAD_CYAP7 tRNA N6-adenosine threonylcarbamoyltransferase OS=Cyanothece sp. (strain PCC 7424) GN=tsaD PE=3 SV=1 802 1200 2.0E-28
sp|Q5L5V3|TSAD_CHLAB tRNA N6-adenosine threonylcarbamoyltransferase OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=tsaD PE=3 SV=1 799 1200 2.0E-28
sp|Q0P4K0|OSGP2_XENTR Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Xenopus tropicalis GN=osgepl1 PE=2 SV=2 787 1187 3.0E-28
sp|Q3SVF4|TSAD_NITWN tRNA N6-adenosine threonylcarbamoyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=tsaD PE=3 SV=1 799 1204 3.0E-28
sp|A7H0K1|TSAD_CAMC5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Campylobacter curvus (strain 525.92) GN=tsaD PE=3 SV=1 800 1187 4.0E-28
sp|A2C0S7|TSAD_PROM1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Prochlorococcus marinus (strain NATL1A) GN=tsaD PE=3 SV=1 800 1203 5.0E-28
sp|Q0AVU0|TSAD_SYNWW tRNA N6-adenosine threonylcarbamoyltransferase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=tsaD PE=3 SV=2 800 1198 5.0E-28
sp|Q3JZC7|TSAD_STRA1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=tsaD PE=3 SV=1 802 1204 5.0E-28
sp|Q822Y4|TSAD_CHLCV tRNA N6-adenosine threonylcarbamoyltransferase OS=Chlamydophila caviae (strain GPIC) GN=tsaD PE=3 SV=1 799 1200 5.0E-28
sp|B8HVK5|TSAD_CYAP4 tRNA N6-adenosine threonylcarbamoyltransferase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=tsaD PE=3 SV=1 801 1202 6.0E-28
sp|Q8DXT9|TSAD_STRA5 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=tsaD PE=3 SV=1 802 1204 7.0E-28
sp|Q891E7|TSAD_CLOTE tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium tetani (strain Massachusetts / E88) GN=tsaD PE=3 SV=1 802 1198 7.0E-28
sp|B2G5W6|TSAD_LACRJ tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus reuteri (strain JCM 1112) GN=tsaD PE=3 SV=1 798 1198 8.0E-28
sp|A5VID8|TSAD_LACRD tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus reuteri (strain DSM 20016) GN=tsaD PE=3 SV=1 798 1198 8.0E-28
sp|A6Q5L0|TSAD_NITSB tRNA N6-adenosine threonylcarbamoyltransferase OS=Nitratiruptor sp. (strain SB155-2) GN=tsaD PE=3 SV=1 800 1184 8.0E-28
sp|Q9VWD6|OSGP2_DROME Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Drosophila melanogaster GN=CG14231 PE=2 SV=1 796 1184 9.0E-28
sp|Q13DY1|TSAD_RHOPS tRNA N6-adenosine threonylcarbamoyltransferase OS=Rhodopseudomonas palustris (strain BisB5) GN=tsaD PE=3 SV=2 799 1204 9.0E-28
sp|Q39W35|TSAD_GEOMG tRNA N6-adenosine threonylcarbamoyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=tsaD PE=3 SV=1 799 1204 1.0E-27
sp|Q254Q0|TSAD_CHLFF tRNA N6-adenosine threonylcarbamoyltransferase OS=Chlamydophila felis (strain Fe/C-56) GN=tsaD PE=3 SV=1 799 1200 1.0E-27
sp|B0TX13|TSAD_FRAP2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tsaD PE=3 SV=1 799 1177 1.0E-27
sp|A6LQD5|TSAD_CLOB8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=tsaD PE=3 SV=1 800 1205 2.0E-27
sp|Q9F0V0|TSAD_RIEAN tRNA N6-adenosine threonylcarbamoyltransferase OS=Riemerella anatipestifer GN=tsaD PE=3 SV=1 797 1205 2.0E-27
sp|A1KAI4|TSAD_AZOSB tRNA N6-adenosine threonylcarbamoyltransferase OS=Azoarcus sp. (strain BH72) GN=tsaD PE=3 SV=1 801 1206 2.0E-27
sp|B1MG63|TSAD_MYCA9 tRNA N6-adenosine threonylcarbamoyltransferase OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=tsaD PE=3 SV=1 800 1198 2.0E-27
sp|Q048X8|TSAD_LACDB tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=tsaD PE=3 SV=1 796 1203 2.0E-27
sp|Q1G933|TSAD_LACDA tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=tsaD PE=3 SV=1 796 1203 2.0E-27
sp|C0Q8X7|TSAD_DESAH tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=tsaD PE=3 SV=1 799 1187 2.0E-27
sp|Q8DVT0|TSAD_STRMU tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=tsaD PE=3 SV=1 802 1203 3.0E-27
sp|Q8DLI9|TSAD_THEEB tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermosynechococcus elongatus (strain BP-1) GN=tsaD PE=3 SV=1 801 1202 3.0E-27
sp|Q46GV3|TSAD_PROMT tRNA N6-adenosine threonylcarbamoyltransferase OS=Prochlorococcus marinus (strain NATL2A) GN=tsaD PE=3 SV=1 800 1203 4.0E-27
sp|Q9H4B0|OSGP2_HUMAN Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial OS=Homo sapiens GN=OSGEPL1 PE=2 SV=2 800 1188 4.0E-27
sp|Q831N0|TSAD_ENTFA tRNA N6-adenosine threonylcarbamoyltransferase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=tsaD PE=3 SV=1 796 1180 4.0E-27
sp|C0MER2|TSAD_STRS7 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=tsaD PE=3 SV=1 802 1204 5.0E-27
sp|C0M9J5|TSAD_STRE4 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus equi subsp. equi (strain 4047) GN=tsaD PE=3 SV=1 802 1204 5.0E-27
sp|Q74KY8|TSAD_LACJO tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=tsaD PE=3 SV=1 796 1202 5.0E-27
sp|A6W504|TSAD_KINRD tRNA N6-adenosine threonylcarbamoyltransferase OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM 14245 / SRS30216) GN=tsaD PE=3 SV=1 799 1199 6.0E-27
sp|Q03IT6|TSAD_STRTD tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=tsaD PE=3 SV=1 802 1198 6.0E-27
sp|Q5FLZ3|TSAD_LACAC tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=tsaD PE=3 SV=1 794 1202 7.0E-27
sp|Q5M2N7|TSAD_STRT2 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=tsaD PE=3 SV=1 802 1198 7.0E-27
sp|Q5LY32|TSAD_STRT1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=tsaD PE=3 SV=1 802 1198 7.0E-27
sp|B6JAE9|TSAD_OLICO tRNA N6-adenosine threonylcarbamoyltransferase OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=tsaD PE=3 SV=1 799 993 7.0E-27
sp|Q045T6|TSAD_LACGA tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=tsaD PE=3 SV=1 796 1202 9.0E-27
sp|B0JJJ4|TSAD_MICAN tRNA N6-adenosine threonylcarbamoyltransferase OS=Microcystis aeruginosa (strain NIES-843) GN=tsaD PE=3 SV=1 800 1194 1.0E-26
sp|B2S1B0|TSAD_BORHD tRNA N6-adenosine threonylcarbamoyltransferase OS=Borrelia hermsii (strain HS1 / DAH) GN=tsaD PE=3 SV=1 799 1177 1.0E-26
sp|A4SCN7|TSAD_CHLPM tRNA N6-adenosine threonylcarbamoyltransferase OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=tsaD PE=3 SV=1 799 1177 1.0E-26
sp|C4XSD3|TSAD_DESMR tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=tsaD PE=3 SV=1 799 1199 1.0E-26
sp|Q8Z0I6|TSAD_NOSS1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=tsaD PE=3 SV=1 801 1202 2.0E-26
sp|A5E8T8|TSAD_BRASB tRNA N6-adenosine threonylcarbamoyltransferase OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=tsaD PE=3 SV=1 802 1208 2.0E-26
sp|A4YK33|TSAD_BRASO tRNA N6-adenosine threonylcarbamoyltransferase OS=Bradyrhizobium sp. (strain ORS278) GN=tsaD PE=3 SV=1 802 1208 2.0E-26
sp|Q3B6I3|TSAD_CHLL7 tRNA N6-adenosine threonylcarbamoyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=tsaD PE=3 SV=1 799 1180 2.0E-26
sp|B0C7S8|TSAD_ACAM1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Acaryochloris marina (strain MBIC 11017) GN=tsaD PE=3 SV=1 801 1196 2.0E-26
sp|A1R0J1|TSAD_BORT9 tRNA N6-adenosine threonylcarbamoyltransferase OS=Borrelia turicatae (strain 91E135) GN=tsaD PE=3 SV=1 802 1177 2.0E-26
sp|Q032D4|TSAD_LACLS tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=tsaD PE=3 SV=1 802 1203 3.0E-26
sp|B9MKR8|TSAD_CALBD tRNA N6-adenosine threonylcarbamoyltransferase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=tsaD PE=3 SV=1 799 1177 3.0E-26
sp|Q8ESI6|TSAD_OCEIH tRNA N6-adenosine threonylcarbamoyltransferase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=tsaD PE=3 SV=1 796 1198 3.0E-26
sp|B2GAG0|TSAD_LACF3 tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=tsaD PE=3 SV=1 797 1202 3.0E-26
sp|A6L5E2|TSAD_BACV8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=tsaD PE=3 SV=1 800 1201 3.0E-26
sp|A2RI22|TSAD_LACLM tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=tsaD PE=3 SV=1 802 1203 3.0E-26
sp|Q1MRF2|TSAD_LAWIP tRNA N6-adenosine threonylcarbamoyltransferase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=tsaD PE=3 SV=1 799 1199 3.0E-26
sp|B3QLC5|TSAD_CHLP8 tRNA N6-adenosine threonylcarbamoyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=tsaD PE=3 SV=1 802 1187 4.0E-26
sp|Q73S13|TSAD_MYCPA tRNA N6-adenosine threonylcarbamoyltransferase OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=tsaD PE=3 SV=1 802 1187 4.0E-26
sp|A0QKR4|TSAD_MYCA1 tRNA N6-adenosine threonylcarbamoyltransferase OS=Mycobacterium avium (strain 104) GN=tsaD PE=3 SV=1 802 1187 4.0E-26
sp|Q9CIR1|TSAD_LACLA tRNA N6-adenosine threonylcarbamoyltransferase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=tsaD PE=3 SV=1 802 1203 5.0E-26
sp|B5YKX4|TSAD_THEYD tRNA N6-adenosine threonylcarbamoyltransferase OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=tsaD PE=3 SV=1 799 1192 5.0E-26
sp|Q8A997|TSAD_BACTN tRNA N6-adenosine threonylcarbamoyltransferase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=tsaD PE=3 SV=1 800 1180 7.0E-26
sp|A7HLB0|TSAD_FERNB tRNA N6-adenosine threonylcarbamoyltransferase OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=tsaD PE=3 SV=1 799 1200 8.0E-26
sp|B9DVQ7|TSAD_STRU0 tRNA N6-adenosine threonylcarbamoyltransferase OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=tsaD PE=3 SV=1 802 1189 8.0E-26
sp|Q6AL73|TSAD_DESPS tRNA N6-adenosine threonylcarbamoyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=tsaD PE=3 SV=1 792 1177 8.0E-26
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 45 0.45

Transmembrane Domains

Domain # Start End Length
1 389 411 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4083
MSSREISRQASIVDSDESTPIVDAKSAPPVRSVWSPDTPDTTNSFNYRPSGSSLASVMANSLGGDAAPPVPALPA
NYSKSPQHEFDSPGSFTSNRNEDDGSPCTLFEEDGGSARLRPARLGLSPATPDSATSRSHGWWDHVVTPFLDKKL
SLLSPVGWRAKAESPQEGSSSPRSGFGLAENNAGPAWSSSGSLLPLHAPIVRKPCPRKGQSPPASLPSEYSSTTS
LPRQGQEAVGREAVGRSPDLESEKPPPYSPPKKKAVAPLQFRAVFPTQHPLHAQFPPSPYQASPGLGATMTSQGA
SQTPIGRGPASPVSGARLPARPQRAFVCHDYFGDDTAIRAHKVERQRRRHEKEDKVARRMGGLWRGRGCVPSTGC
FGRRGREGRKRRRAWLMVWAGLTCVMILVLVLVVVLTGRHRDAPAPPESIWVNLTSFPPMPTGVLTVVGLDNSVS
RSACTEPSTLWSCSLPKEEHKSAEPYKANQPTVAMQIQWEKDTASSHDMRSEPKAPDAKEVWFLGNTTDNVRSEH
KAGETTPFFISLATTVAGLNDGPKLTTNQGAGPRSGNSSLQTLLPPPDLEADGTAAAAVMIPKALRQPVRLFDRG
LDSEHYGFYTHFKRTMFLKSVTILKGTEGGNVPLDEDGGCRKDEADYVVTWAETRVLVQIWTRSLDTNASSLLRA
SGDGQRPGSMPYPVTLTLDTHGGDPNKKVVWSWPVDKRQKVLANKAELLANRMGAGGSWINPRGSGDARMGGFDG
GTGGFQQCSLSSINHTSFIDSSTPHRTPFMLNARPRLQRQALASGRRRLLTLAIETSCDDTAVALLRRQTGLPTQ
LLFNERIASDNRPWGGVNPPVAIAGHHRCLAPLVSKALAALPPDQSKPDVVAATRGPGLPAYLNAGLGVAKGLSL
AWGVPFLAVHHLQAHALTPRLVHALKGGDEGVVMTEMEMELQAVRPVFPFLTLLVSGGHTQLLVSTGLTSHSVIA
ETLDSAIGNALDKAARYILTDSELDLCPDVQYGRHLEAFAFPPELGDVSQQHASFFQPALSRHEEQLTCHSGYEW
ALPMPLKDTRTLAFSFTGIASHVETIMQRRPDMALPERRQLARHTLQAMFQHIASRLCIAIMDAEPVRRLADSFC
DKSLRLILAGGVAANRFLPHVLRTTLAARGLPSLEMVVPPLELCTDNAAMIAWTADEMFRAGWESDLSVCAEPKW
SMESRWMVLV*
Coding >Ophun1|4083
ATGAGCTCGCGCGAAATAAGTCGTCAGGCGTCCATTGTCGATTCAGACGAGTCGACGCCCATCGTCGATGCCAAG
TCAGCACCCCCCGTGAGATCTGTCTGGTCTCCAGACACTCCCGATACGACGAACTCGTTCAACTACCGCCCCAGC
GGTTCAAGCCTGGCCTCAGTGATGGCAAACTCACTGGGCGGCGACGCGGCTCCTCCGGTACCGGCGCTCCCCGCC
AACTATTCCAAGTCGCCACAACATGAATTCGACAGCCCTGGATCGTTCACGAGCAACCGCAACGAAGACGACGGC
TCACCATGCACGCTCTTCGAAGAAGATGGCGGCTCGGCTCGCCTCAGGCCCGCAAGACTCGGTCTGAGCCCGGCG
ACGCCGGATAGCGCTACGTCGAGGTCTCATGGCTGGTGGGACCACGTCGTCACGCCCTTTCTCGACAAGAAATTA
TCTTTGCTCTCGCCTGTGGGCTGGAGAGCCAAGGCCGAATCGCCCCAGGAGGGATCTAGTTCGCCACGGAGCGGC
TTCGGGTTGGCAGAGAACAATGCCGGCCCGGCGTGGTCATCCTCGGGATCTCTGCTGCCACTTCACGCCCCGATT
GTGCGCAAGCCATGTCCCCGCAAAGGCCAGTCGCCTCCCGCCAGTCTCCCGTCCGAGTATTCGTCCACGACATCG
TTGCCGCGTCAAGGCCAGGAAGCCGTTGGCCGAGAAGCCGTCGGACGGAGCCCCGACTTGGAGTCGGAGAAGCCG
CCCCCTTACTCTCCACCGAAGAAGAAGGCCGTCGCGCCGCTTCAATTCCGGGCAGTGTTTCCGACCCAACATCCG
CTTCACGCTCAGTTCCCGCCGTCTCCCTACCAGGCGTCGCCCGGTCTCGGGGCCACCATGACATCCCAGGGGGCA
TCGCAGACGCCGATCGGTCGGGGGCCGGCGTCGCCAGTATCGGGCGCCAGACTCCCGGCGCGACCGCAGAGAGCA
TTCGTCTGCCATGATTATTTCGGAGATGACACGGCAATTCGTGCCCACAAAGTCGAGCGGCAGAGGCGTCGGCAT
GAAAAGGAAGACAAGGTCGCTCGACGCATGGGTGGTCTCTGGCGAGGCCGTGGGTGCGTGCCCTCGACGGGATGC
TTTGGTCGCCGAGGCCGCGAGGGCCGTAAGAGGAGAAGAGCATGGCTCATGGTGTGGGCGGGCCTCACATGCGTC
ATGATCCTCGTTCTGGTGCTGGTCGTGGTTCTCACAGGGCGTCACCGTGATGCGCCTGCGCCACCAGAGTCCATC
TGGGTCAACCTGACGAGCTTCCCACCGATGCCGACCGGCGTCCTCACCGTCGTCGGACTGGACAATAGCGTCTCG
AGAAGCGCATGTACGGAGCCGTCGACGTTGTGGAGCTGCTCCCTGCCCAAGGAGGAGCACAAATCGGCAGAACCG
TACAAGGCGAACCAACCGACGGTGGCGATGCAGATCCAGTGGGAAAAGGACACGGCATCGTCGCACGACATGAGA
TCCGAACCCAAGGCCCCGGACGCCAAGGAAGTGTGGTTCCTGGGGAACACGACAGACAACGTGCGGTCGGAGCAC
AAGGCGGGCGAGACGACGCCCTTTTTCATCAGCCTTGCCACGACGGTGGCCGGTCTCAACGACGGACCGAAGTTG
ACGACTAACCAAGGCGCCGGTCCGCGGAGTGGAAACTCGAGCCTGCAGACGCTTCTGCCCCCTCCGGACTTGGAG
GCAGACGGGACGGCGGCGGCGGCAGTGATGATTCCAAAAGCTCTGCGGCAGCCCGTCCGGCTATTCGACCGCGGC
TTGGACTCGGAGCACTATGGGTTCTACACGCACTTCAAGCGGACCATGTTCCTCAAGTCGGTGACGATACTCAAA
GGGACCGAGGGCGGCAACGTGCCTCTAGACGAGGACGGAGGCTGCCGCAAAGACGAGGCCGACTATGTGGTGACG
TGGGCAGAGACGCGAGTGCTGGTGCAGATCTGGACGCGCAGCCTCGACACGAACGCATCTTCGCTGCTGCGGGCG
AGCGGCGACGGGCAACGACCAGGCTCGATGCCATATCCGGTGACGCTGACGCTGGACACGCACGGGGGGGATCCC
AACAAGAAGGTAGTCTGGAGCTGGCCGGTGGACAAGCGGCAGAAGGTGCTGGCGAACAAGGCCGAGCTCCTGGCC
AACCGGATGGGCGCGGGCGGCAGCTGGATCAACCCGCGCGGCTCGGGAGATGCGAGGATGGGGGGGTTCGACGGG
GGGACTGGAGGGTTCCAACAATGCTCTTTGTCATCCATCAACCACACAAGCTTCATCGACTCGTCCACTCCCCAT
CGAACCCCCTTCATGCTCAACGCCCGGCCCCGACTCCAGCGGCAGGCCCTCGCCAGCGGGCGGCGACGGCTCCTA
ACCCTAGCAATCGAAACATCCTGCGACGACACCGCCGTCGCCCTCCTCCGCCGCCAAACCGGCCTCCCAACCCAA
CTCCTCTTCAACGAGCGCATCGCCTCCGACAACCGACCCTGGGGCGGCGTGAACCCCCCCGTCGCCATAGCGGGC
CACCACCGCTGCCTCGCCCCGCTGGTGAGCAAGGCCTTGGCCGCTTTGCCCCCCGACCAGAGCAAGCCGGACGTG
GTGGCTGCCACGAGGGGACCTGGTCTGCCGGCGTACCTGAATGCTGGGCTGGGAGTTGCAAAGGGCTTGTCGTTG
GCTTGGGGGGTGCCGTTCTTGGCTGTTCATCATCTGCAGGCTCATGCTCTGACGCCGAGGTTGGTGCATGCTTTG
AAGGGGGGTGATGAGGGGGTTGTGATGACGGAGATGGAGATGGAGCTTCAGGCTGTTAGACCTGTTTTCCCCTTT
CTTACTCTCCTTGTCTCGGGGGGTCATACACAACTCCTCGTATCAACAGGTCTAACCTCCCACTCCGTCATCGCC
GAAACCCTCGACTCAGCCATCGGCAACGCCCTCGACAAAGCCGCCCGTTACATCCTCACCGACTCAGAACTCGAC
CTCTGCCCAGACGTCCAGTACGGCCGCCACCTCGAAGCCTTCGCCTTCCCCCCCGAACTGGGCGACGTATCCCAA
CAGCACGCTTCCTTCTTCCAGCCCGCGCTCTCGCGGCACGAGGAGCAGCTGACCTGCCACTCTGGCTACGAATGG
GCGCTACCCATGCCCTTGAAAGATACGCGAACGCTAGCCTTCTCCTTCACCGGCATCGCCTCCCACGTCGAGACC
ATCATGCAGCGAAGACCAGACATGGCCCTGCCAGAACGCCGCCAACTAGCCCGCCACACCCTGCAAGCCATGTTC
CAACACATAGCCTCCCGCCTCTGCATCGCCATCATGGACGCAGAGCCCGTCCGGAGACTGGCAGACAGCTTCTGC
GACAAGTCGCTGCGGCTCATCCTCGCCGGCGGCGTGGCAGCCAACCGCTTCCTCCCGCACGTGCTGCGCACCACG
CTGGCAGCCCGCGGCCTGCCCTCGCTGGAGATGGTGGTGCCGCCGCTGGAGCTGTGCACCGATAACGCGGCCATG
ATTGCCTGGACGGCGGATGAGATGTTCCGGGCTGGCTGGGAGTCGGATTTGTCGGTTTGTGCGGAGCCCAAGTGG
TCGATGGAGTCGAGATGGATGGTCTTGGTGTGA
Transcript >Ophun1|4083
ATGAGCTCGCGCGAAATAAGTCGTCAGGCGTCCATTGTCGATTCAGACGAGTCGACGCCCATCGTCGATGCCAAG
TCAGCACCCCCCGTGAGATCTGTCTGGTCTCCAGACACTCCCGATACGACGAACTCGTTCAACTACCGCCCCAGC
GGTTCAAGCCTGGCCTCAGTGATGGCAAACTCACTGGGCGGCGACGCGGCTCCTCCGGTACCGGCGCTCCCCGCC
AACTATTCCAAGTCGCCACAACATGAATTCGACAGCCCTGGATCGTTCACGAGCAACCGCAACGAAGACGACGGC
TCACCATGCACGCTCTTCGAAGAAGATGGCGGCTCGGCTCGCCTCAGGCCCGCAAGACTCGGTCTGAGCCCGGCG
ACGCCGGATAGCGCTACGTCGAGGTCTCATGGCTGGTGGGACCACGTCGTCACGCCCTTTCTCGACAAGAAATTA
TCTTTGCTCTCGCCTGTGGGCTGGAGAGCCAAGGCCGAATCGCCCCAGGAGGGATCTAGTTCGCCACGGAGCGGC
TTCGGGTTGGCAGAGAACAATGCCGGCCCGGCGTGGTCATCCTCGGGATCTCTGCTGCCACTTCACGCCCCGATT
GTGCGCAAGCCATGTCCCCGCAAAGGCCAGTCGCCTCCCGCCAGTCTCCCGTCCGAGTATTCGTCCACGACATCG
TTGCCGCGTCAAGGCCAGGAAGCCGTTGGCCGAGAAGCCGTCGGACGGAGCCCCGACTTGGAGTCGGAGAAGCCG
CCCCCTTACTCTCCACCGAAGAAGAAGGCCGTCGCGCCGCTTCAATTCCGGGCAGTGTTTCCGACCCAACATCCG
CTTCACGCTCAGTTCCCGCCGTCTCCCTACCAGGCGTCGCCCGGTCTCGGGGCCACCATGACATCCCAGGGGGCA
TCGCAGACGCCGATCGGTCGGGGGCCGGCGTCGCCAGTATCGGGCGCCAGACTCCCGGCGCGACCGCAGAGAGCA
TTCGTCTGCCATGATTATTTCGGAGATGACACGGCAATTCGTGCCCACAAAGTCGAGCGGCAGAGGCGTCGGCAT
GAAAAGGAAGACAAGGTCGCTCGACGCATGGGTGGTCTCTGGCGAGGCCGTGGGTGCGTGCCCTCGACGGGATGC
TTTGGTCGCCGAGGCCGCGAGGGCCGTAAGAGGAGAAGAGCATGGCTCATGGTGTGGGCGGGCCTCACATGCGTC
ATGATCCTCGTTCTGGTGCTGGTCGTGGTTCTCACAGGGCGTCACCGTGATGCGCCTGCGCCACCAGAGTCCATC
TGGGTCAACCTGACGAGCTTCCCACCGATGCCGACCGGCGTCCTCACCGTCGTCGGACTGGACAATAGCGTCTCG
AGAAGCGCATGTACGGAGCCGTCGACGTTGTGGAGCTGCTCCCTGCCCAAGGAGGAGCACAAATCGGCAGAACCG
TACAAGGCGAACCAACCGACGGTGGCGATGCAGATCCAGTGGGAAAAGGACACGGCATCGTCGCACGACATGAGA
TCCGAACCCAAGGCCCCGGACGCCAAGGAAGTGTGGTTCCTGGGGAACACGACAGACAACGTGCGGTCGGAGCAC
AAGGCGGGCGAGACGACGCCCTTTTTCATCAGCCTTGCCACGACGGTGGCCGGTCTCAACGACGGACCGAAGTTG
ACGACTAACCAAGGCGCCGGTCCGCGGAGTGGAAACTCGAGCCTGCAGACGCTTCTGCCCCCTCCGGACTTGGAG
GCAGACGGGACGGCGGCGGCGGCAGTGATGATTCCAAAAGCTCTGCGGCAGCCCGTCCGGCTATTCGACCGCGGC
TTGGACTCGGAGCACTATGGGTTCTACACGCACTTCAAGCGGACCATGTTCCTCAAGTCGGTGACGATACTCAAA
GGGACCGAGGGCGGCAACGTGCCTCTAGACGAGGACGGAGGCTGCCGCAAAGACGAGGCCGACTATGTGGTGACG
TGGGCAGAGACGCGAGTGCTGGTGCAGATCTGGACGCGCAGCCTCGACACGAACGCATCTTCGCTGCTGCGGGCG
AGCGGCGACGGGCAACGACCAGGCTCGATGCCATATCCGGTGACGCTGACGCTGGACACGCACGGGGGGGATCCC
AACAAGAAGGTAGTCTGGAGCTGGCCGGTGGACAAGCGGCAGAAGGTGCTGGCGAACAAGGCCGAGCTCCTGGCC
AACCGGATGGGCGCGGGCGGCAGCTGGATCAACCCGCGCGGCTCGGGAGATGCGAGGATGGGGGGGTTCGACGGG
GGGACTGGAGGGTTCCAACAATGCTCTTTGTCATCCATCAACCACACAAGCTTCATCGACTCGTCCACTCCCCAT
CGAACCCCCTTCATGCTCAACGCCCGGCCCCGACTCCAGCGGCAGGCCCTCGCCAGCGGGCGGCGACGGCTCCTA
ACCCTAGCAATCGAAACATCCTGCGACGACACCGCCGTCGCCCTCCTCCGCCGCCAAACCGGCCTCCCAACCCAA
CTCCTCTTCAACGAGCGCATCGCCTCCGACAACCGACCCTGGGGCGGCGTGAACCCCCCCGTCGCCATAGCGGGC
CACCACCGCTGCCTCGCCCCGCTGGTGAGCAAGGCCTTGGCCGCTTTGCCCCCCGACCAGAGCAAGCCGGACGTG
GTGGCTGCCACGAGGGGACCTGGTCTGCCGGCGTACCTGAATGCTGGGCTGGGAGTTGCAAAGGGCTTGTCGTTG
GCTTGGGGGGTGCCGTTCTTGGCTGTTCATCATCTGCAGGCTCATGCTCTGACGCCGAGGTTGGTGCATGCTTTG
AAGGGGGGTGATGAGGGGGTTGTGATGACGGAGATGGAGATGGAGCTTCAGGCTGTTAGACCTGTTTTCCCCTTT
CTTACTCTCCTTGTCTCGGGGGGTCATACACAACTCCTCGTATCAACAGGTCTAACCTCCCACTCCGTCATCGCC
GAAACCCTCGACTCAGCCATCGGCAACGCCCTCGACAAAGCCGCCCGTTACATCCTCACCGACTCAGAACTCGAC
CTCTGCCCAGACGTCCAGTACGGCCGCCACCTCGAAGCCTTCGCCTTCCCCCCCGAACTGGGCGACGTATCCCAA
CAGCACGCTTCCTTCTTCCAGCCCGCGCTCTCGCGGCACGAGGAGCAGCTGACCTGCCACTCTGGCTACGAATGG
GCGCTACCCATGCCCTTGAAAGATACGCGAACGCTAGCCTTCTCCTTCACCGGCATCGCCTCCCACGTCGAGACC
ATCATGCAGCGAAGACCAGACATGGCCCTGCCAGAACGCCGCCAACTAGCCCGCCACACCCTGCAAGCCATGTTC
CAACACATAGCCTCCCGCCTCTGCATCGCCATCATGGACGCAGAGCCCGTCCGGAGACTGGCAGACAGCTTCTGC
GACAAGTCGCTGCGGCTCATCCTCGCCGGCGGCGTGGCAGCCAACCGCTTCCTCCCGCACGTGCTGCGCACCACG
CTGGCAGCCCGCGGCCTGCCCTCGCTGGAGATGGTGGTGCCGCCGCTGGAGCTGTGCACCGATAACGCGGCCATG
ATTGCCTGGACGGCGGATGAGATGTTCCGGGCTGGCTGGGAGTCGGATTTGTCGGTTTGTGCGGAGCCCAAGTGG
TCGATGGAGTCGAGATGGATGGTCTTGGTGTGA
Gene >Ophun1|4083
ATGAGCTCGCGCGAAATAAGTCGTCAGGCGTCCATTGTCGATTCAGACGAGTCGACGCCCATCGTCGATGCCAAG
TCAGCACCCCCCGTGAGATCTGTCTGGTCTCCAGACACTCCCGATACGACGAACTCGTTCAACTACCGCCCCAGC
GGTTCAAGCCTGGCCTCAGTGATGGCAAACTCACTGGGCGGCGACGCGGCTCCTCCGGTACCGGCGCTCCCCGCC
AACTATTCCAAGTCGCCACAACATGAATTCGACAGCCCTGGATCGTTCACGAGCAACCGCAACGAAGACGACGGC
TCACCATGCACGCTCTTCGAAGAAGATGGCGGCTCGGCTCGCCTCAGGCCCGCAAGACTCGGTCTGAGCCCGGCG
ACGCCGGATAGCGCTACGTCGAGGTCTCATGGCTGGTGGGACCACGTCGTCACGCCCTTTCTCGACAAGAAATTA
TCTTTGCTCTCGCCTGTGGGCTGGAGAGCCAAGGCCGAATCGCCCCAGGAGGGATCTAGTTCGCCACGGAGCGGC
TTCGGGTTGGCAGAGAACAATGCCGGCCCGGCGTGGTCATCCTCGGGATCTCTGCTGCCACTTCACGCCCCGATT
GTGCGCAAGCCATGTCCCCGCAAAGGCCAGTCGCCTCCCGCCAGTCTCCCGTCCGAGTATTCGTCCACGACATCG
TTGCCGCGTCAAGGCCAGGAAGCCGTTGGCCGAGAAGCCGTCGGACGGAGCCCCGACTTGGAGTCGGAGAAGCCG
CCCCCTTACTCTCCACCGAAGAAGAAGGCCGTCGCGCCGCTTCAATTCCGGGCAGTGTTTCCGACCCAACATCCG
CTTCACGCTCAGTTCCCGCCGTCTCCCTACCAGGCGTCGCCCGGTCTCGGGGCCACCATGACATCCCAGGGGGCA
TCGCAGACGCCGATCGGTCGGGGGCCGGCGTCGCCAGTATCGGGCGCCAGACTCCCGGCGCGACCGCAGAGAGCA
TTCGTCTGCCATGATTATTTCGGAGATGACACGGCAATTCGTGCCCACAAAGTCGAGCGGCAGAGGCGTCGGCAT
GAAAAGGAAGACAAGGTCGCTCGACGCATGGGTGGTCTCTGGCGAGGCCGTGGGTGCGTGCCCTCGACGGGATGC
TTTGGTCGCCGAGGCCGCGAGGGCCGTAAGAGGAGAAGAGCATGGCTCATGGTGTGGGCGGGCCTCACATGCGTC
ATGATCCTCGTTCTGGTGCTGGTCGTGGTTCTCACAGGGCGTCACCGTGATGCGCCTGCGCCACCAGAGTCCATC
TGGGTCAACCTGACGAGCTTCCCACCGATGCCGACCGGCGTCCTCACCGTCGTCGGACTGGACAATAGCGTCTCG
AGAAGCGCATGTACGGAGCCGTCGACGTTGTGGAGCTGCTCCCTGCCCAAGGAGGAGCACAAATCGGCAGAACCG
TACAAGGCGAACCAACCGACGGTGGCGATGCAGATCCAGTGGGAAAAGGACACGGCATCGTCGCACGACATGAGA
TCCGAACCCAAGGCCCCGGACGCCAAGGAAGTGTGGTTCCTGGGGAACACGACAGACAACGTGCGGTCGGAGCAC
AAGGCGGGCGAGACGACGCCCTTTTTCATCAGCCTTGCCACGACGGTGGCCGGTCTCAACGACGGACCGAAGTTG
ACGACTAACCAAGGCGCCGGTCCGCGGAGTGGAAACTCGAGCCTGCAGACGCTTCTGCCCCCTCCGGACTTGGAG
GCAGACGGGACGGCGGCGGCGGCAGTGATGATTCCAAAAGCTCTGCGGCAGCCCGTCCGGCTATTCGACCGCGGC
TTGGACTCGGAGCACTATGGGTTCTACACGCACTTCAAGCGGACCATGTTCCTCAAGTCGGTGACGATACTCAAA
GGGACCGAGGGCGGCAACGTGCCTCTAGACGAGGACGGAGGCTGCCGCAAAGACGAGGCCGACTATGTGGTGACG
TGGGCAGAGACGCGAGTGCTGGTGCAGATCTGGACGCGCAGCCTCGACACGAACGCATCTTCGCTGCTGCGGGCG
AGCGGCGACGGGCAACGACCAGGCTCGATGCCATATCCGGTGACGCTGACGCTGGACACGCACGGGGGGGATCCC
AACAAGAAGGTAGTCTGGAGCTGGCCGGTGGACAAGCGGCAGAAGGTGCTGGCGAACAAGGCCGAGCTCCTGGCC
AACCGGATGGGCGCGGGCGGCAGCTGGATCAACCCGCGCGGCTCGGGAGATGCGAGGATGGGGGGGTTCGACGGG
GGGACTGGAGGGTGTAAGTGTGAGTGGGTGAACTGGGTGCGGCGGGTGTCGTGAGGGATGGCGTGAAAGAATAGA
ATGGAGAGAGTGCAGATAGAATGAGGAGGGATAATGCCTCGCTCTGAAGGTGTGACTGAGGTTGTCTGTGAATGG
TCTCGAATCAATTCCGTGAAGGGTTTCGTATAGGTGTCTGAAGGGTATAGACGTGTTTGATGCTAGAGGTGCGAT
GCCAGAAGATGTGGTTGAGCGAGGCGAGGTTGAGGTTGGGTCGAGATTGAGGAGTCAAGATCAGACAGCTGAAGA
TGACGTCACGTGCAGTCCAACAATGCTCTTTGTCATCCATCAACCACACAAGCTTCATCGACTCGTCCACTCCCC
ATCGAACCCCCTTCATGCTCAACGCCCGGCCCCGACTCCAGCGGCAGGCCCTCGCCAGCGGGCGGCGACGGCTCC
TAACCCTAGCAATCGAAACATCCTGCGACGACACCGCCGTCGCCCTCCTCCGCCGCCAAACCGGCCTCCCAACCC
AACTCCTCTTCAACGAGCGCATCGCCTCCGACAACCGACCCTGGGGCGGCGTGAACCCCCCCGTCGCCATAGCGG
GCCACCACCGCTGCCTCGCCCCGCTGGTGAGCAAGGCCTTGGCCGCTTTGCCCCCCGACCAGAGCAAGCCGGACG
TGGTGGCTGCCACGAGGGGACCTGGTCTGCCGGCGTACCTGAATGCTGGGCTGGGAGTTGCAAAGGGCTTGTCGT
TGGCTTGGGGGGTGCCGTTCTTGGCTGTTCATCATCTGCAGGCTCATGCTCTGACGCCGAGGTTGGTGCATGCTT
TGAAGGGGGGTGATGAGGGGGTTGTGATGACGGAGATGGAGATGGAGCTTCAGGCTGTTAGACCTGTTTTCCCCT
TTCTTACTCTCCTTGTCTCGGGGGGTCATACACAACTCCTCGTATCAACAGGTCTAACCTCCCACTCCGTCATCG
CCGAAACCCTCGACTCAGCCATCGGCAACGCCCTCGACAAAGCCGCCCGTTACATCCTCACCGACTCAGAACTCG
ACCTCTGCCCAGACGTCCAGTACGGCCGCCACCTCGAAGCCTTCGCCTTCCCCCCCGAACTGGGCGACGTATCCC
AACAGCACGCTTCCTTCTTCCAGCCCGCGCTCTCGCGGCACGAGGAGCAGCTGACCTGCCACTCTGGCTACGAAT
GGGCGCTACCCATGCCCTTGAAAGATACGCGAACGCTAGCCTTCTCCTTCACCGGCATCGCCTCCCACGTCGAGA
CCATCATGCAGCGAAGACCAGACATGGCCCTGCCAGAACGCCGCCAACTAGCCCGCCACACCCTGCAAGCCATGT
TCCAACACATAGCCTCCCGCCTCTGCATCGCCATCATGGACGCAGAGCCCGTCCGGAGACTGGCAGACAGCTTCT
GCGACAAGTCGCTGCGGCTCATCCTCGCCGGCGGCGTGGCAGCCAACCGCTTCCTCCCGCACGTGCTGCGCACCA
CGCTGGCAGCCCGCGGCCTGCCCTCGCTGGAGATGGTGGTGCCGCCGCTGGAGCTGTGCACCGATAACGCGGCCA
TGATTGCCTGGACGGCGGATGAGATGTTCCGGGCTGGCTGGGAGTCGGATTTGTCGGTTTGTGCGGAGCCCAAGT
GGTCGATGGAGTCGGTGCTTGGGGGGGGGTTGATGGGCGTTCAGGGGTGGAGGAAGAGGGGACGTGCTAAAGAGT
TTTCTGTAGAGATGGATGGTCTTGGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail