Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4075
Gene name
LocationContig_371:12174..15655
Strand+
Gene length (bp)3481
Transcript length (bp)3042
Coding sequence length (bp)3042
Protein length (aa) 1014

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03200 Glyco_hydro_63 Glycosyl hydrolase family 63 C-terminal domain 6.9E-06 720 809

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q04336|YM54_YEAST Uncharacterized protein YMR196W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR196W PE=1 SV=1 4 948 0.0E+00

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2749
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3522
Ophiocordyceps australis map64 (Brazil) OphauB2|6534
Ophiocordyceps camponoti-floridani Ophcf2|06641
Ophiocordyceps camponoti-rufipedis Ophun1|4075 (this protein)
Ophiocordyceps kimflemingae Ophio5|5288
Ophiocordyceps subramaniannii Hirsu2|4345

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4075
MVAFTYITDEEKRLKEDRERVKYWKKWGPYVAERQWATVREDYSADGDAWSHFPHNHARSRAFRWGEDGIAGVSD
THGFENIGFSFWNEKDDILKERLYGLSNPQGNHGESVKEAYFHLDNTPHSYMKFLYKYPQAKFPYQDIREENAKR
SKQDREYQITDTGVFDQDRYWDIFIETAKEADDPDELLFRVTAWNRGPDSAPLHIIPQLWFRNTWSWGRESQDKK
PSIHKHATMAVTSDHYSLGRRFLVLSPSPGVGSSEEDVMPDLLFTENDTNFNTLYGQENKQPYVKDAFHRHIIDD
VKNAINPAKTGTKCAAWFSFTENGGVEPGECAVVRFRFSRKDMAFIDEEEFDNIIDRRREEADEFYFKISPLPMT
DDLRNIQRQAFAGMMWTKQHYHFVWDQWANGDPAMPPPPPNRIGLRNDQWKHMHCDDILSMPDSWEYPFFAAWDS
AFHCIPLAMIDPDFAKKQLDLFTREWYCHPNGQLPAYEWNFSDVNPPVHAWATFRVFKIERKMYGRQDLDFLERV
FHKLLLNFTWWVNRKDANSKNIFEGGFLGLDNIGLFNRSEPLPTGGVLEQADSTGWMGFFCLSMLNISLELAKHR
RIYEDIASKFFEHFILISDAMTFRAGQKSEQSLWNEEDGFYYDAISWGGPWVQQLPVRSLVGLIPLYATATLEPE
LVNKLPSFRKRVEWFVANRCDLAERNMASIRKRGKGNRILLSIVSKDRLEKILKRMLDEDEFLSGHGIRSLSKYH
RDHPYSMEVNGQKFTVGYVPGDSDSGLFGGNSNWRGPIWLCVNFLLVESLQRFYLFYGPDFRVECPTGSGEYMHL
GRVSEEIQHRLQHLFIRTEEGRRSVNGGDNRLDFDEHWRNYLWFHEFFDGNSGRGLGASHQCGWTGLIARVIHDT
GVNCRLPQTPRTPSIGMAHYFDDVFHRAVDPGTPTARRHRRSSTARSIGARSDFDANGLDEGVLSPESDHAEGRH
RERAEADSHLHRYVANQLNDYMKREGEYQHEDEFETQA*
Coding >Ophun1|4075
ATGGTCGCCTTCACGTATATCACCGATGAAGAGAAGCGCCTCAAGGAAGATCGGGAGCGCGTCAAGTACTGGAAG
AAATGGGGTCCCTACGTTGCCGAGCGGCAATGGGCCACGGTGCGCGAAGACTACAGCGCTGACGGAGATGCTTGG
AGCCACTTTCCCCATAATCACGCCCGCTCGCGTGCTTTCAGATGGGGCGAGGATGGCATTGCTGGTGTTTCCGAC
ACGCACGGCTTCGAGAACATTGGCTTTAGCTTCTGGAACGAGAAAGACGATATTCTGAAAGAGAGGCTCTATGGC
CTGTCAAACCCGCAGGGGAACCATGGCGAGAGCGTCAAGGAGGCCTACTTTCATCTTGACAACACTCCACACTCG
TACATGAAGTTTCTCTACAAGTATCCACAGGCCAAGTTTCCCTATCAAGACATTCGCGAGGAAAACGCCAAGAGG
TCCAAACAAGACAGGGAGTACCAAATCACCGACACCGGCGTCTTTGACCAGGACCGCTACTGGGACATCTTCATC
GAGACGGCAAAGGAGGCGGACGATCCCGATGAGCTTCTCTTCCGGGTCACGGCGTGGAATAGAGGCCCGGACTCT
GCGCCCCTTCACATTATACCGCAACTATGGTTTCGCAACACTTGGAGCTGGGGCCGCGAGTCGCAAGACAAGAAG
CCCTCTATCCACAAACACGCGACCATGGCCGTCACGTCTGACCATTACAGTCTCGGCCGCCGTTTCTTGGTTCTG
TCTCCGTCCCCTGGCGTGGGGTCGAGCGAGGAAGATGTCATGCCCGATCTCCTGTTTACCGAAAACGACACCAAC
TTCAATACGCTCTACGGCCAAGAGAACAAGCAACCATACGTCAAGGATGCCTTCCACCGACACATCATCGACGAC
GTCAAGAATGCAATCAATCCAGCCAAGACGGGTACCAAATGTGCTGCTTGGTTCAGCTTCACCGAGAACGGGGGG
GTCGAACCGGGCGAGTGTGCGGTCGTCAGATTCCGCTTCTCCAGGAAAGACATGGCCTTTATTGATGAGGAAGAG
TTCGACAACATCATCGATCGGCGCAGGGAAGAGGCCGACGAGTTCTACTTCAAAATCAGCCCCCTACCGATGACT
GACGATCTGCGTAACATTCAGAGACAGGCATTCGCGGGCATGATGTGGACGAAGCAGCACTACCACTTCGTATGG
GACCAATGGGCCAACGGCGACCCTGCCATGCCTCCTCCGCCCCCGAATCGAATAGGGCTACGAAACGACCAGTGG
AAACACATGCACTGCGACGACATCCTATCCATGCCCGACTCCTGGGAGTATCCCTTCTTCGCCGCTTGGGACAGC
GCCTTTCACTGCATTCCTCTGGCCATGATCGATCCCGACTTCGCCAAGAAGCAGCTGGACCTGTTTACTCGGGAG
TGGTACTGTCATCCAAACGGACAGCTTCCTGCATACGAGTGGAACTTTAGCGACGTGAACCCTCCAGTTCACGCC
TGGGCAACCTTCAGGGTGTTTAAGATTGAGCGCAAGATGTACGGCCGTCAGGACCTGGACTTTCTCGAACGTGTG
TTTCACAAACTGCTTCTCAACTTCACCTGGTGGGTGAATCGAAAGGACGCAAACAGCAAGAATATTTTCGAAGGC
GGCTTCTTGGGACTGGACAACATTGGTCTTTTCAACCGATCCGAGCCCTTGCCGACGGGAGGCGTGCTGGAGCAG
GCGGATAGCACGGGGTGGATGGGTTTCTTTTGTCTGTCGATGCTCAACATTTCTCTGGAGCTGGCCAAGCATCGT
CGAATCTACGAAGACATCGCGTCCAAGTTCTTTGAGCACTTTATCCTCATCAGCGACGCCATGACCTTCAGGGCC
GGCCAGAAGAGCGAGCAGTCGCTGTGGAACGAAGAGGACGGCTTCTACTACGATGCCATCTCGTGGGGAGGGCCG
TGGGTGCAGCAGCTGCCCGTGAGGTCGCTCGTGGGCCTGATTCCGCTGTACGCCACGGCCACGCTGGAGCCGGAG
CTGGTCAACAAGCTCCCTTCGTTCCGGAAGAGGGTCGAGTGGTTCGTCGCCAACCGATGCGATCTGGCAGAAAGA
AACATGGCCAGCATCCGGAAGAGAGGCAAGGGGAACCGCATCCTCCTGTCGATTGTCAGCAAGGACAGGCTGGAG
AAGATTCTCAAGCGGATGCTGGACGAGGACGAGTTTCTCAGCGGCCACGGCATCCGATCGCTGTCCAAGTATCAC
CGAGACCATCCTTACTCGATGGAAGTCAACGGGCAAAAGTTTACGGTGGGATACGTGCCCGGAGACTCGGACAGC
GGGCTCTTTGGTGGCAACAGCAACTGGAGGGGCCCCATCTGGCTGTGCGTCAACTTTCTGCTGGTCGAGTCGCTG
CAGCGTTTCTATCTGTTTTACGGGCCGGATTTCCGGGTCGAGTGCCCGACGGGCAGCGGAGAGTACATGCATTTG
GGCCGGGTTTCGGAGGAGATTCAGCACCGGCTCCAGCACCTCTTTATCCGAACCGAAGAGGGCAGGCGGAGCGTC
AACGGCGGCGACAATCGGCTGGACTTTGACGAGCACTGGAGGAACTACTTGTGGTTCCACGAGTTCTTTGACGGC
AACTCGGGACGGGGCCTCGGGGCCAGCCATCAATGCGGCTGGACGGGTTTGATTGCGCGTGTGATACACGATACG
GGGGTCAACTGCCGGCTTCCGCAGACGCCTCGGACGCCGTCTATCGGCATGGCGCATTACTTTGACGACGTGTTC
CACCGAGCCGTCGACCCGGGGACTCCCACGGCTCGGCGGCACAGGCGGTCGTCGACGGCGCGGTCCATCGGGGCA
CGCAGCGACTTTGACGCCAACGGGCTGGACGAGGGCGTCTTGAGCCCCGAGTCGGATCATGCCGAGGGGCGGCAC
AGAGAGAGGGCAGAGGCGGACTCGCACCTCCACCGGTACGTGGCGAACCAGCTCAACGACTACATGAAGCGGGAG
GGAGAGTACCAGCACGAGGACGAGTTTGAGACGCAGGCCTGA
Transcript >Ophun1|4075
ATGGTCGCCTTCACGTATATCACCGATGAAGAGAAGCGCCTCAAGGAAGATCGGGAGCGCGTCAAGTACTGGAAG
AAATGGGGTCCCTACGTTGCCGAGCGGCAATGGGCCACGGTGCGCGAAGACTACAGCGCTGACGGAGATGCTTGG
AGCCACTTTCCCCATAATCACGCCCGCTCGCGTGCTTTCAGATGGGGCGAGGATGGCATTGCTGGTGTTTCCGAC
ACGCACGGCTTCGAGAACATTGGCTTTAGCTTCTGGAACGAGAAAGACGATATTCTGAAAGAGAGGCTCTATGGC
CTGTCAAACCCGCAGGGGAACCATGGCGAGAGCGTCAAGGAGGCCTACTTTCATCTTGACAACACTCCACACTCG
TACATGAAGTTTCTCTACAAGTATCCACAGGCCAAGTTTCCCTATCAAGACATTCGCGAGGAAAACGCCAAGAGG
TCCAAACAAGACAGGGAGTACCAAATCACCGACACCGGCGTCTTTGACCAGGACCGCTACTGGGACATCTTCATC
GAGACGGCAAAGGAGGCGGACGATCCCGATGAGCTTCTCTTCCGGGTCACGGCGTGGAATAGAGGCCCGGACTCT
GCGCCCCTTCACATTATACCGCAACTATGGTTTCGCAACACTTGGAGCTGGGGCCGCGAGTCGCAAGACAAGAAG
CCCTCTATCCACAAACACGCGACCATGGCCGTCACGTCTGACCATTACAGTCTCGGCCGCCGTTTCTTGGTTCTG
TCTCCGTCCCCTGGCGTGGGGTCGAGCGAGGAAGATGTCATGCCCGATCTCCTGTTTACCGAAAACGACACCAAC
TTCAATACGCTCTACGGCCAAGAGAACAAGCAACCATACGTCAAGGATGCCTTCCACCGACACATCATCGACGAC
GTCAAGAATGCAATCAATCCAGCCAAGACGGGTACCAAATGTGCTGCTTGGTTCAGCTTCACCGAGAACGGGGGG
GTCGAACCGGGCGAGTGTGCGGTCGTCAGATTCCGCTTCTCCAGGAAAGACATGGCCTTTATTGATGAGGAAGAG
TTCGACAACATCATCGATCGGCGCAGGGAAGAGGCCGACGAGTTCTACTTCAAAATCAGCCCCCTACCGATGACT
GACGATCTGCGTAACATTCAGAGACAGGCATTCGCGGGCATGATGTGGACGAAGCAGCACTACCACTTCGTATGG
GACCAATGGGCCAACGGCGACCCTGCCATGCCTCCTCCGCCCCCGAATCGAATAGGGCTACGAAACGACCAGTGG
AAACACATGCACTGCGACGACATCCTATCCATGCCCGACTCCTGGGAGTATCCCTTCTTCGCCGCTTGGGACAGC
GCCTTTCACTGCATTCCTCTGGCCATGATCGATCCCGACTTCGCCAAGAAGCAGCTGGACCTGTTTACTCGGGAG
TGGTACTGTCATCCAAACGGACAGCTTCCTGCATACGAGTGGAACTTTAGCGACGTGAACCCTCCAGTTCACGCC
TGGGCAACCTTCAGGGTGTTTAAGATTGAGCGCAAGATGTACGGCCGTCAGGACCTGGACTTTCTCGAACGTGTG
TTTCACAAACTGCTTCTCAACTTCACCTGGTGGGTGAATCGAAAGGACGCAAACAGCAAGAATATTTTCGAAGGC
GGCTTCTTGGGACTGGACAACATTGGTCTTTTCAACCGATCCGAGCCCTTGCCGACGGGAGGCGTGCTGGAGCAG
GCGGATAGCACGGGGTGGATGGGTTTCTTTTGTCTGTCGATGCTCAACATTTCTCTGGAGCTGGCCAAGCATCGT
CGAATCTACGAAGACATCGCGTCCAAGTTCTTTGAGCACTTTATCCTCATCAGCGACGCCATGACCTTCAGGGCC
GGCCAGAAGAGCGAGCAGTCGCTGTGGAACGAAGAGGACGGCTTCTACTACGATGCCATCTCGTGGGGAGGGCCG
TGGGTGCAGCAGCTGCCCGTGAGGTCGCTCGTGGGCCTGATTCCGCTGTACGCCACGGCCACGCTGGAGCCGGAG
CTGGTCAACAAGCTCCCTTCGTTCCGGAAGAGGGTCGAGTGGTTCGTCGCCAACCGATGCGATCTGGCAGAAAGA
AACATGGCCAGCATCCGGAAGAGAGGCAAGGGGAACCGCATCCTCCTGTCGATTGTCAGCAAGGACAGGCTGGAG
AAGATTCTCAAGCGGATGCTGGACGAGGACGAGTTTCTCAGCGGCCACGGCATCCGATCGCTGTCCAAGTATCAC
CGAGACCATCCTTACTCGATGGAAGTCAACGGGCAAAAGTTTACGGTGGGATACGTGCCCGGAGACTCGGACAGC
GGGCTCTTTGGTGGCAACAGCAACTGGAGGGGCCCCATCTGGCTGTGCGTCAACTTTCTGCTGGTCGAGTCGCTG
CAGCGTTTCTATCTGTTTTACGGGCCGGATTTCCGGGTCGAGTGCCCGACGGGCAGCGGAGAGTACATGCATTTG
GGCCGGGTTTCGGAGGAGATTCAGCACCGGCTCCAGCACCTCTTTATCCGAACCGAAGAGGGCAGGCGGAGCGTC
AACGGCGGCGACAATCGGCTGGACTTTGACGAGCACTGGAGGAACTACTTGTGGTTCCACGAGTTCTTTGACGGC
AACTCGGGACGGGGCCTCGGGGCCAGCCATCAATGCGGCTGGACGGGTTTGATTGCGCGTGTGATACACGATACG
GGGGTCAACTGCCGGCTTCCGCAGACGCCTCGGACGCCGTCTATCGGCATGGCGCATTACTTTGACGACGTGTTC
CACCGAGCCGTCGACCCGGGGACTCCCACGGCTCGGCGGCACAGGCGGTCGTCGACGGCGCGGTCCATCGGGGCA
CGCAGCGACTTTGACGCCAACGGGCTGGACGAGGGCGTCTTGAGCCCCGAGTCGGATCATGCCGAGGGGCGGCAC
AGAGAGAGGGCAGAGGCGGACTCGCACCTCCACCGGTACGTGGCGAACCAGCTCAACGACTACATGAAGCGGGAG
GGAGAGTACCAGCACGAGGACGAGTTTGAGACGCAGGCCTGA
Gene >Ophun1|4075
ATGGTCGCCTTCACGTATATCACCGATGAAGAGAAGCGCCTCAAGGAAGATCGGGAGCGCGTCAAGTACTGGAAG
AAATGGGGTCCCTACGTTGCCGAGCGGCAATGGGCCACGGGTGATTATTCTCTTCAAGCAGCTACTCTCAAGGCG
CGGCTGACGACGTCGCAGTGCGCGAAGACTACAGCGCTGACGGAGATGCTTGGAGCCGTATGCTTCCATCTTGTC
TCACGTCCGCCAGCTCTCATTGACGTTTCCTTGCAGACTTTCCCCATAATCACGCCCGCTCGCGTGCTTTCAGAT
GGGGCGAGGATGGCATTGCTGGTGTTTCCGACACGCACGGCTTCGAGAACATTGGCTTTAGCTTCTGGAACGAGA
AAGAGTCCGTCTTCTTTCCGCTTGGAGAAACCCTGCTAATCTGATTCGTCTCAGCGATATTCTGAAAGAGAGGCT
CTATGGCCTGTCAAACCCGCAGGGGAACCATGGCGAGAGCGTCAAGGAGGCCTACTTTCATCTTGACAACACTCC
AGTTCGTCAATCCCCGCTTTCTGCCCGTGTCAAGCCTGCCGACTAATCCGCCCCGATAGACCGTATGACTGCGAT
TGCTCCCCCCCTCGTCGGCCCTTCGCCACGGTGCTAACACCTCACAGCACTCGTACATGAAGTTTCTCTACAAGT
ATCCACAGGCCAAGTTTCCCTATCAAGACATTCGCGAGGAAAACGCCAAGAGGTCCAAACAAGACAGGGAGTACC
AAATCACCGACACCGGCGTCTTTGACCAGGACCGCTACTGGGACATCTTCATCGAGACGGCAAAGGAGGCGGACG
ATCCCGATGAGCTTCTCTTCCGGGTCACGGCGTGGAATAGAGGCCCGGACTCTGCGCCCCTTCACATTATACCGC
AACTATGGTTTCGCAACACTTGGAGCTGGGGCCGCGAGTCGCAAGACAAGAAGCCCTCTATCCACAAACACGCGA
CCATGGCCGTCACGTCTGACCATTACAGTCTCGGCCGCCGTTTCTTGGTTCTGTCTCCGTCCCCTGGCGTGGGGT
CGAGCGAGGAAGATGTCATGCCCGATCTCCTGTTTACCGAAAACGACACCAACTTCAATACGCTCTACGGCCAAG
AGAACAAGCAACCATACGTCAAGGATGCCTTCCACCGACACATCATCGACGACGTCAAGAATGCAATCAATCCAG
CCAAGACGGGTACCAAATGTGCTGCTTGGTTCAGCTTCACCGAGAACGGGGGGGTCGAACCGGGCGAGTGTGCGG
GTATGGGTTGAGTCTGTTTCGCCGCAGCGGCTTGTTCTAACGGGATATTCTAGTCGTCAGATTCCGCTTCTCCAG
GAAAGACATGGCCTTTATTGATGAGGAAGAGTTCGACAACATCATCGATCGGCGCAGGGAAGAGGCCGACGAGTT
CTACTTCAAAATCAGCCCCCTACCGATGACTGACGATCTGCGTAACATTCAGAGACAGGCATTCGCGGGCATGAT
GTGGACGAAGCAGCACTACCACTTCGTATGGGACCAATGGGCCAACGGCGACCCTGCCATGCCTCCTCCGCCCCC
GAATCGAATAGGGCTACGAAACGACCAGTGGAAACACATGCACTGCGACGACATCCTATCCATGCCCGACTCCTG
GGAGTATCCCTTCTTCGCCGCTTGGGACAGCGCCTTTCACTGCATTCCTCTGGCCATGATCGATCCCGACTTCGC
CAAGAAGCAGCTGGACCTGTTTACTCGGGAGTGGTACTGTCATCCAAACGGACAGCTTCCTGCGTGAGTCGTCAA
GTCTCGTCTGCCGATGGGATTTCACTGACGATGAGACAGATACGAGTGGAACTTTAGCGACGTGAACCCTCCAGT
TCACGCCTGGGCAACCTTCAGGGTGTTTAAGATTGAGCGCAAGATGTACGGCCGTCAGGACCTGGACTTTCTCGA
ACGTGTGTTTCACAAACTGCTTCTCAACTTCACCTGGTGGGTGAATCGAAAGGACGCAAACAGCAAGAATATTTT
CGAAGGCGGCTTCTTGGGACTGGACAACATTGGTCTTTTCAACCGATCCGAGCCCTTGCCGACGGGAGGCGTGCT
GGAGCAGGCGGATAGCACGGGGTGGATGGGTTTCTTTTGTCTGTCGATGCTCAACATTTCTCTGGAGCTGGCCAA
GCATCGTCGAATCTACGAAGACATCGCGTCCAAGTTCTTTGAGCACTTTATCCTCATCAGCGACGCCATGACCTT
CAGGGCCGGCCAGAAGAGCGAGCAGTCGCTGTGGAACGAAGAGGACGGCTTCTACTACGATGCCATCTCGTGGGG
AGGGCCGTGGGTGCAGCAGCTGCCCGTGAGGTCGCTCGTGGGCCTGATTCCGCTGTACGCCACGGCCACGCTGGA
GCCGGAGCTGGTCAACAAGCTCCCTTCGTTCCGGAAGAGGGTCGAGTGGTTCGTCGCCAACCGATGCGATCTGGC
AGAAAGAAACATGGCCAGCATCCGGAAGAGAGGCAAGGGGAACCGCATCCTCCTGTCGATTGTCAGCAAGGACAG
GCTGGAGAAGATTCTCAAGCGGATGCTGGACGAGGACGAGTTTCTCAGCGGCCACGGCATCCGATCGCTGTCCAA
GTATCACCGAGACCATCCTTACTCGATGGAAGTCAACGGGCAAAAGTTTACGGTGGGATACGTGCCCGGAGACTC
GGACAGCGGGCTCTTTGGTGGCAACAGCAACTGGAGGGGCCCCATCTGGCTGTGCGTCAACTTTCTGCTGGTCGA
GTCGCTGCAGCGTTTCTATCTGTTTTACGGGCCGGATTTCCGGGTCGAGTGCCCGACGGGCAGCGGAGAGTACAT
GCATTTGGGCCGGGTTTCGGAGGAGATTCAGCACCGGCTCCAGCACCTCTTTATCCGAACCGAAGAGGGCAGGCG
GAGCGTCAACGGCGGCGACAATCGGCTGGACTTTGACGAGCACTGGAGGAACTACTTGTGGTTCCACGAGTTCTT
TGACGGCAACTCGGGACGGGGCCTCGGGGCCAGCCATCAATGCGGCTGGACGGGTTTGATTGCGCGTGTGATACA
CGATACGGGGTGAGTTTGGGAAAGGTGATGACGATGGGCGAGTGTTGCTGACGGCTCCGTCTACAGGGTCAACTG
CCGGCTTCCGCAGACGCCTCGGACGCCGTCTATCGGCATGGCGCATTACTTTGACGACGTGTTCCACCGAGCCGT
CGACCCGGGGACTCCCACGGCTCGGCGGCACAGGCGGTCGTCGACGGCGCGGTCCATCGGGGCACGCAGCGACTT
TGACGCCAACGGGCTGGACGAGGGCGTCTTGAGCCCCGAGTCGGATCATGCCGAGGGGCGGCACAGAGAGAGGGC
AGAGGCGGACTCGCACCTCCACCGGTACGTGGCGAACCAGCTCAACGACTACATGAAGCGGGAGGGAGAGTACCA
GCACGAGGACGAGTTTGAGACGCAGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail