Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4071
Gene name
LocationContig_371:3973..6809
Strand-
Gene length (bp)2836
Transcript length (bp)2499
Coding sequence length (bp)2499
Protein length (aa) 833

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04112 Mak10 Mak10 subunit, NatC N(alpha)-terminal acetyltransferase 3.3E-63 124 286

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZHV2|NAA35_CHICK N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Gallus gallus GN=NAA35 PE=2 SV=1 96 723 2.0E-45
sp|Q5RBT3|NAA35_PONAB N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Pongo abelii GN=NAA35 PE=2 SV=1 96 723 5.0E-44
sp|Q5VZE5|NAA35_HUMAN N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Homo sapiens GN=NAA35 PE=1 SV=1 96 723 5.0E-44
sp|Q4R708|NAA35_MACFA N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Macaca fascicularis GN=NAA35 PE=2 SV=1 96 723 7.0E-44
sp|Q6PHQ8|NAA35_MOUSE N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Mus musculus GN=Naa35 PE=1 SV=1 96 723 1.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZHV2|NAA35_CHICK N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Gallus gallus GN=NAA35 PE=2 SV=1 96 723 2.0E-45
sp|Q5RBT3|NAA35_PONAB N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Pongo abelii GN=NAA35 PE=2 SV=1 96 723 5.0E-44
sp|Q5VZE5|NAA35_HUMAN N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Homo sapiens GN=NAA35 PE=1 SV=1 96 723 5.0E-44
sp|Q4R708|NAA35_MACFA N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Macaca fascicularis GN=NAA35 PE=2 SV=1 96 723 7.0E-44
sp|Q6PHQ8|NAA35_MOUSE N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Mus musculus GN=Naa35 PE=1 SV=1 96 723 1.0E-42
sp|Q6DKG0|NAA35_RAT N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Rattus norvegicus GN=Naa35 PE=1 SV=1 96 723 8.0E-42
sp|Q7T322|NAA35_DANRE N-alpha-acetyltransferase 35, NatC auxiliary subunit OS=Danio rerio GN=naa35 PE=2 SV=1 108 723 4.0E-40
sp|Q9W1A2|NAA35_DROME N-alpha-acetyltransferase, 35 NatC auxiliary subunit homolog OS=Drosophila melanogaster GN=CG4065 PE=2 SV=1 108 723 3.0E-35
sp|Q02197|NAA35_YEAST N-alpha-acetyltransferase, 35 NatC auxiliary subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK10 PE=1 SV=1 108 723 2.0E-23
sp|Q9USY3|NAA35_SCHPO N-alpha-acetyltransferase, 35 NatC auxiliary subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak10 PE=3 SV=1 108 621 5.0E-23
[Show less]

GO

GO Term Description Terminal node
GO:0017196 N-terminal peptidyl-methionine acetylation Yes
GO:0031417 NatC complex Yes
GO:0044238 primary metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:1902494 catalytic complex No
GO:0008152 metabolic process No
GO:0018193 peptidyl-amino acid modification No
GO:0018206 peptidyl-methionine modification No
GO:0032991 protein-containing complex No
GO:0006474 N-terminal protein amino acid acetylation No
GO:0051604 protein maturation No
GO:0031414 N-terminal protein acetyltransferase complex No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0043412 macromolecule modification No
GO:0031365 N-terminal protein amino acid modification No
GO:0036211 protein modification process No
GO:0005575 cellular_component No
GO:0031248 protein acetyltransferase complex No
GO:1901564 organonitrogen compound metabolic process No
GO:0006473 protein acetylation No
GO:0140535 intracellular protein-containing complex No
GO:0008150 biological_process No
GO:1902493 acetyltransferase complex No
GO:0043543 protein acylation No
GO:0071704 organic substance metabolic process No
GO:1990234 transferase complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2751
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4236
Ophiocordyceps australis map64 (Brazil) OphauB2|3243
Ophiocordyceps camponoti-floridani Ophcf2|06645
Ophiocordyceps camponoti-rufipedis Ophun1|4071 (this protein)
Ophiocordyceps kimflemingae Ophio5|5293
Ophiocordyceps subramaniannii Hirsu2|4352

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4071
MACKAVARSTSPSGRAPPKNTRYPTDNSEPQHLLQLPVSVIHHPVHGQLMASHGQSMALPQHQAQPSMAGHGGGD
ASDEIARLSLGQTPESPPPPLPPDMESPGILAVDITSDFAEAVRAALAPGELIKDNHFTLFESVAALEIMDPKMD
SGCVQPGDESDALYDVSTALLPDEVLGIIDQLLCHEMSWHLGYPLSQTLFTSVHVEALLMPTPVTVNEACFVRQA
DAAANQQPMLRILRAYCLGMLKACGYVNERIKSEHFYEEEDFVTNTYNRTLLSSIPTDAIHQVLIDAQDLLESLK
GSIDPSIAEALTLRLKLRRIFLATAESTQHGGHPDTARQPWTEALALLPDLASTHGLAKPVDEAFSVKLQRKLAS
TMPPRPIVELGFDEAFRHLSRLFEDGCEVIGALEYTNSRCLQTFVATFQAKKPQPLVYVRTLLQTFLFSDMQILG
SMSIRQLLDDDMSIISMAASPLLDRDNDDVEVVQDPRFIMAQQMEQFRQLAAQPFLDIFRTACQNRCRQRRTLCH
LVRDWESLQVEAEYIDQTLQDKTGQRPLIQQSATRGDEPMELYPLVLSSWTYHYKLLQMELIVQLGFELHMYQAD
ELAGMYWHLNYLARFRLQHAERVKSFVVDAVERARSEPRSDGRAAEDGQQLKRSLAQARLSLLDAAVTWELSDAL
CCLYTVLHRLGLVKSPPRPYSSDELRFALRMRPFAAIGFPPPPTFDEFVAGVSQPDATTAELLQYGESAAAGAKK
GFETLSRMSADESFSMGSHPRWLAAVKAALKSSIATGVAISTVRKALDKQSSGDGLNIRAEVPSPKEAYHDWWIV
PVVMPAV*
Coding >Ophun1|4071
ATGGCCTGTAAGGCTGTGGCCCGCAGCACCAGCCCATCAGGCAGAGCGCCCCCCAAAAATACCCGGTACCCCACC
GACAACTCAGAACCTCAACACCTCCTACAGCTGCCTGTCTCCGTGATCCATCATCCAGTCCATGGCCAGTTGATG
GCCAGTCACGGCCAGTCTATGGCGCTTCCTCAGCACCAGGCACAGCCCTCAATGGCCGGCCATGGCGGGGGAGAC
GCATCAGACGAAATCGCCAGGCTCTCGCTCGGCCAGACTCCCGAATCGCCGCCTCCGCCGCTGCCGCCCGACATG
GAGAGCCCCGGTATCCTGGCCGTCGACATCACCAGCGACTTCGCCGAAGCTGTCCGCGCGGCCCTGGCTCCGGGA
GAGCTGATCAAGGATAACCACTTCACTCTCTTCGAGTCCGTCGCCGCTCTCGAGATCATGGATCCCAAGATGGAT
AGCGGCTGTGTCCAGCCCGGCGACGAGTCTGACGCGCTGTACGATGTCTCGACCGCGCTTCTACCCGACGAGGTG
CTCGGCATCATTGACCAGCTGCTCTGCCACGAGATGTCCTGGCATCTTGGCTATCCGCTGTCGCAGACGCTCTTC
ACCAGCGTTCACGTCGAGGCTCTTTTGATGCCTACTCCCGTCACCGTCAACGAGGCATGTTTTGTTCGACAAGCC
GATGCGGCGGCTAACCAGCAGCCCATGCTGAGGATTCTGAGGGCATACTGTCTCGGCATGCTCAAGGCGTGCGGC
TACGTCAACGAGCGCATCAAGTCGGAACACTTCTACGAGGAGGAGGACTTTGTCACCAACACGTACAACCGGACA
CTGCTCAGCAGCATCCCCACCGATGCCATCCACCAAGTGCTAATCGACGCTCAAGATCTCCTCGAGTCTCTGAAG
GGCTCCATCGATCCTTCCATCGCCGAAGCTCTCACTCTTCGACTAAAGCTGCGCCGCATCTTTCTTGCTACGGCC
GAAAGCACCCAGCATGGCGGGCATCCAGATACGGCCAGACAGCCGTGGACCGAGGCGCTGGCGCTGCTCCCCGAC
CTGGCCTCGACTCACGGTCTGGCAAAACCGGTCGACGAGGCCTTTAGTGTCAAGCTGCAGAGGAAGCTGGCCAGC
ACGATGCCTCCGCGGCCCATTGTCGAGCTCGGCTTCGACGAGGCGTTCCGTCACCTGTCCCGCCTGTTCGAGGAC
GGCTGCGAGGTGATAGGCGCCCTTGAGTACACCAACTCGCGGTGCCTTCAGACCTTTGTGGCCACGTTCCAAGCC
AAGAAGCCTCAGCCGCTGGTCTACGTCAGGACCTTACTACAGACCTTTCTCTTCAGCGACATGCAGATCCTCGGC
TCCATGAGCATCCGCCAGCTCCTCGACGACGACATGTCCATCATTTCCATGGCAGCCAGCCCATTGCTCGATCGG
GACAATGACGACGTCGAAGTCGTGCAGGATCCGCGCTTCATCATGGCACAGCAGATGGAGCAGTTTCGGCAGCTT
GCGGCGCAGCCCTTTCTCGATATTTTCCGTACGGCCTGTCAGAATCGCTGCCGACAGCGGCGGACGCTCTGCCAC
CTCGTCCGAGACTGGGAGAGCCTCCAGGTCGAGGCCGAGTACATCGACCAGACGCTGCAGGACAAGACCGGGCAG
CGGCCCCTGATACAGCAGTCGGCGACGCGCGGGGACGAGCCGATGGAGCTATATCCGCTGGTTCTGTCCTCGTGG
ACGTACCACTACAAGCTGCTCCAGATGGAGCTCATCGTCCAGCTCGGCTTCGAGCTGCACATGTATCAGGCCGAC
GAGCTGGCCGGCATGTACTGGCACCTCAACTACCTGGCCCGCTTCCGGCTCCAGCACGCCGAGCGGGTAAAGTCG
TTTGTCGTCGACGCCGTCGAACGGGCCCGGTCTGAGCCGAGGTCTGACGGGCGGGCGGCCGAGGACGGGCAGCAG
CTGAAGCGGTCGCTGGCTCAGGCGCGACTATCGCTGCTCGACGCGGCCGTGACGTGGGAGCTGTCGGACGCGCTG
TGCTGCCTCTACACGGTCCTCCACCGTCTGGGACTGGTCAAGTCGCCGCCGAGGCCGTACAGCAGCGACGAGCTC
CGGTTCGCGCTGCGCATGAGGCCCTTTGCCGCCATCGGCTTCCCGCCGCCTCCGACGTTTGACGAGTTCGTCGCC
GGCGTCAGCCAGCCGGATGCGACGACGGCCGAGCTGCTTCAGTATGGCGAGAGCGCCGCGGCTGGGGCCAAAAAG
GGCTTCGAGACGCTGAGTAGGATGTCGGCCGACGAGTCGTTTTCCATGGGCTCGCATCCGAGGTGGCTGGCGGCG
GTCAAGGCGGCTCTCAAGTCAAGCATCGCCACTGGCGTCGCCATCTCGACTGTCCGCAAGGCTTTGGATAAACAG
TCGTCCGGCGACGGCTTGAATATCCGGGCCGAGGTGCCCAGTCCCAAAGAGGCTTACCATGACTGGTGGATCGTT
CCGGTGGTGATGCCGGCTGTATGA
Transcript >Ophun1|4071
ATGGCCTGTAAGGCTGTGGCCCGCAGCACCAGCCCATCAGGCAGAGCGCCCCCCAAAAATACCCGGTACCCCACC
GACAACTCAGAACCTCAACACCTCCTACAGCTGCCTGTCTCCGTGATCCATCATCCAGTCCATGGCCAGTTGATG
GCCAGTCACGGCCAGTCTATGGCGCTTCCTCAGCACCAGGCACAGCCCTCAATGGCCGGCCATGGCGGGGGAGAC
GCATCAGACGAAATCGCCAGGCTCTCGCTCGGCCAGACTCCCGAATCGCCGCCTCCGCCGCTGCCGCCCGACATG
GAGAGCCCCGGTATCCTGGCCGTCGACATCACCAGCGACTTCGCCGAAGCTGTCCGCGCGGCCCTGGCTCCGGGA
GAGCTGATCAAGGATAACCACTTCACTCTCTTCGAGTCCGTCGCCGCTCTCGAGATCATGGATCCCAAGATGGAT
AGCGGCTGTGTCCAGCCCGGCGACGAGTCTGACGCGCTGTACGATGTCTCGACCGCGCTTCTACCCGACGAGGTG
CTCGGCATCATTGACCAGCTGCTCTGCCACGAGATGTCCTGGCATCTTGGCTATCCGCTGTCGCAGACGCTCTTC
ACCAGCGTTCACGTCGAGGCTCTTTTGATGCCTACTCCCGTCACCGTCAACGAGGCATGTTTTGTTCGACAAGCC
GATGCGGCGGCTAACCAGCAGCCCATGCTGAGGATTCTGAGGGCATACTGTCTCGGCATGCTCAAGGCGTGCGGC
TACGTCAACGAGCGCATCAAGTCGGAACACTTCTACGAGGAGGAGGACTTTGTCACCAACACGTACAACCGGACA
CTGCTCAGCAGCATCCCCACCGATGCCATCCACCAAGTGCTAATCGACGCTCAAGATCTCCTCGAGTCTCTGAAG
GGCTCCATCGATCCTTCCATCGCCGAAGCTCTCACTCTTCGACTAAAGCTGCGCCGCATCTTTCTTGCTACGGCC
GAAAGCACCCAGCATGGCGGGCATCCAGATACGGCCAGACAGCCGTGGACCGAGGCGCTGGCGCTGCTCCCCGAC
CTGGCCTCGACTCACGGTCTGGCAAAACCGGTCGACGAGGCCTTTAGTGTCAAGCTGCAGAGGAAGCTGGCCAGC
ACGATGCCTCCGCGGCCCATTGTCGAGCTCGGCTTCGACGAGGCGTTCCGTCACCTGTCCCGCCTGTTCGAGGAC
GGCTGCGAGGTGATAGGCGCCCTTGAGTACACCAACTCGCGGTGCCTTCAGACCTTTGTGGCCACGTTCCAAGCC
AAGAAGCCTCAGCCGCTGGTCTACGTCAGGACCTTACTACAGACCTTTCTCTTCAGCGACATGCAGATCCTCGGC
TCCATGAGCATCCGCCAGCTCCTCGACGACGACATGTCCATCATTTCCATGGCAGCCAGCCCATTGCTCGATCGG
GACAATGACGACGTCGAAGTCGTGCAGGATCCGCGCTTCATCATGGCACAGCAGATGGAGCAGTTTCGGCAGCTT
GCGGCGCAGCCCTTTCTCGATATTTTCCGTACGGCCTGTCAGAATCGCTGCCGACAGCGGCGGACGCTCTGCCAC
CTCGTCCGAGACTGGGAGAGCCTCCAGGTCGAGGCCGAGTACATCGACCAGACGCTGCAGGACAAGACCGGGCAG
CGGCCCCTGATACAGCAGTCGGCGACGCGCGGGGACGAGCCGATGGAGCTATATCCGCTGGTTCTGTCCTCGTGG
ACGTACCACTACAAGCTGCTCCAGATGGAGCTCATCGTCCAGCTCGGCTTCGAGCTGCACATGTATCAGGCCGAC
GAGCTGGCCGGCATGTACTGGCACCTCAACTACCTGGCCCGCTTCCGGCTCCAGCACGCCGAGCGGGTAAAGTCG
TTTGTCGTCGACGCCGTCGAACGGGCCCGGTCTGAGCCGAGGTCTGACGGGCGGGCGGCCGAGGACGGGCAGCAG
CTGAAGCGGTCGCTGGCTCAGGCGCGACTATCGCTGCTCGACGCGGCCGTGACGTGGGAGCTGTCGGACGCGCTG
TGCTGCCTCTACACGGTCCTCCACCGTCTGGGACTGGTCAAGTCGCCGCCGAGGCCGTACAGCAGCGACGAGCTC
CGGTTCGCGCTGCGCATGAGGCCCTTTGCCGCCATCGGCTTCCCGCCGCCTCCGACGTTTGACGAGTTCGTCGCC
GGCGTCAGCCAGCCGGATGCGACGACGGCCGAGCTGCTTCAGTATGGCGAGAGCGCCGCGGCTGGGGCCAAAAAG
GGCTTCGAGACGCTGAGTAGGATGTCGGCCGACGAGTCGTTTTCCATGGGCTCGCATCCGAGGTGGCTGGCGGCG
GTCAAGGCGGCTCTCAAGTCAAGCATCGCCACTGGCGTCGCCATCTCGACTGTCCGCAAGGCTTTGGATAAACAG
TCGTCCGGCGACGGCTTGAATATCCGGGCCGAGGTGCCCAGTCCCAAAGAGGCTTACCATGACTGGTGGATCGTT
CCGGTGGTGATGCCGGCTGTATGA
Gene >Ophun1|4071
ATGGCCTGTAAGGCTGTGGCCCGCAGCACCAGCCCATCAGGCAGAGCGCCCCCCAAAAATACCCGGTACCCCACC
GACAACTCAGAACCTCAACACCTCCTACAGCTGCCTGTCTCCGTGATCCATCATCCAGTCCATGGCCAGTTGATG
GCCAGTCACGGCCAGTCTATGGCGCTTCCTCAGCACCAGGCACAGCCCTCAATGGCCGGCCATGGCGGGGGAGAC
GCATCAGACGGTGAGCAGCTGCCTGAAAGCACCAGCCATCGTCTCGGGCACCGCTAAGCAAACGGCCGCGCAGAA
ATCGCCAGGCTCTCGCTCGGCCAGACTCCCGAATCGCCGCCTCCGCCGCTGCCGCCCGACATGGAGAGCCCCGGT
ATCCTGGCCGTCGACATCACCAGCGACTTCGCCGAAGCTGTCCGCGGTGAGTTGGCTGCTGGACGGCCTGCCTGT
TCGCTGGCTGACAGACCACAGCGGCCCTGGCTCCGGGAGAGCTGATCAAGGATAACCACTTCACTCTCTTCGAGT
CCGTCGCCGCTCTCGAGGTTCGTTGCTCTTGTCGGACATGATGCTCTTCTCTACTCGCTGACACACCGTCAGATC
ATGGATCCCAAGATGGATAGCGGCTGTGTCCAGCCCGGCGACGAGTCTGACGCGCTGTACGATGTCTCGACCGCG
CTTCTACCCGACGAGGTGCTCGGCATCATTGACCAGCTGCTCTGCCACGAGGTGCGTGAGCCTTCTTTCGCTGCG
GCTTGACCGCTCGCTCACCCGTTTTCGATAGATGTCCTGGCATCTTGGCTATCCGCTGTCGCAGACGCTCTTCAC
CAGCGTTCACGTCGAGGCTCTTTTGATGCCTACTCCCGTCACCGTCAACGAGGCATGTTTTGTTCGACAAGCCGA
TGCGGCGGCTAACCAGCAGCCCATGCTGAGGATTCTGAGGGCATACTGTCTCGGCATGCTCAAGGCGTGCGGCTA
CGTCAACGAGCGCATCAAGTCGGAACACTTCTACGAGGTAGCCATGGCACTCTTGCTCTGCAGACGAGACGAGAC
GCTGACGACGCTTTCGAACAGGAGGAGGACTTTGTCACCAACACGTACAACCGGACACTGCTCAGCAGCATCCCC
ACCGATGCCATCCACCAAGTGCTAATCGACGCTCAAGATCTCCTCGAGTCTCTGAAGGGCTCCATCGATCCTTCC
ATCGCCGAAGCTCTCACTCTTCGACTAAAGCTGCGCCGCATCTTTCTTGCTACGGCCGAAAGCACCCAGCATGGC
GGGCATCCAGATACGGCCAGACAGCCGTGGACCGAGGCGCTGGCGCTGCTCCCCGACCTGGCCTCGACTCACGGT
CTGGCAAAACCGGTCGACGAGGCCTTTAGTGTCAAGCTGCAGAGGAAGCTGGCCAGCACGATGCCTCCGCGGCCC
ATTGTCGAGCTCGGCTTCGACGAGGCGTTCCGTCACCTGTCCCGCCTGTTCGAGGACGGCTGCGAGGTGATAGGC
GCCCTTGAGTACACCAACTCGCGGTGCCTTCAGGTGAGTAGCCGGTATCTTGCGTCTCGCTCTGTGGCACACGCT
GATGGGCATTCAGACCTTTGTGGCCACGTTCCAAGCCAAGAAGCCTCAGCCGCTGGTCTACGTCAGGACCTTACT
ACAGACCTTTCTCTTCAGCGACATGCAGATCCTCGGCTCCATGAGCATCCGCCAGCTCCTCGACGACGACATGTC
CATCATTTCCATGGCAGCCAGCCCATTGCTCGATCGGGACAATGACGACGTCGAAGTCGTGCAGGATCCGCGCTT
CATCATGGCACAGCAGATGGAGCAGTTTCGGCAGCTTGCGGCGCAGCCCTTTCTCGATATTTTCCGTACGGCCTG
TCAGAATCGCTGCCGACAGCGGCGGACGCTCTGCCACCTCGTCCGAGACTGGGAGAGCCTCCAGGTCGAGGCCGA
GTACATCGACCAGACGCTGCAGGACAAGACCGGGCAGCGGCCCCTGATACAGCAGTCGGCGACGCGCGGGGACGA
GCCGATGGAGCTATATCCGCTGGTTCTGTCCTCGTGGACGTACCACTACAAGCTGCTCCAGATGGAGCTCATCGT
CCAGCTCGGCTTCGAGCTGCACATGTATCAGGCCGACGAGCTGGCCGGCATGTACTGGCACCTCAACTACCTGGC
CCGCTTCCGGCTCCAGCACGCCGAGCGGGTAAAGTCGTTTGTCGTCGACGCCGTCGAACGGGCCCGGTCTGAGCC
GAGGTCTGACGGGCGGGCGGCCGAGGACGGGCAGCAGCTGAAGCGGTCGCTGGCTCAGGCGCGACTATCGCTGCT
CGACGCGGCCGTGACGTGGGAGCTGTCGGACGCGCTGTGCTGCCTCTACACGGTCCTCCACCGTCTGGGACTGGT
CAAGTCGCCGCCGAGGCCGTACAGCAGCGACGAGCTCCGGTTCGCGCTGCGCATGAGGCCCTTTGCCGCCATCGG
CTTCCCGCCGCCTCCGACGTTTGACGAGTTCGTCGCCGGCGTCAGCCAGCCGGATGCGACGACGGCCGAGCTGCT
TCAGTATGGCGAGAGCGCCGCGGCTGGGGCCAAAAAGGGCTTCGAGACGCTGAGTAGGATGTCGGCCGACGAGTC
GTTTTCCATGGGCTCGCATCCGAGGTGGCTGGCGGCGGTCAAGGCGGCTCTCAAGTCAAGCATCGCCACTGGCGT
CGCCATCTCGACTGTCCGCAAGGCTTTGGATAAACAGTCGTCCGGCGACGGCTTGAATATCCGGGCCGAGGTGCC
CAGTCCCAAAGAGGCTTACCATGACTGGTGGATCGTTCCGGTGGTGATGCCGGCTGTATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail