Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4065
Gene name
LocationContig_370:6315..9924
Strand+
Gene length (bp)3609
Transcript length (bp)3558
Coding sequence length (bp)3558
Protein length (aa) 1186

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04097 Nic96 Nup93/Nic96 2.9E-205 507 1177
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 2.5E-14 2 96
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 1.2E-06 70 162
PF13634 Nucleoporin_FG Nucleoporin FG repeat region 7.5E-02 152 230

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|G0S024|NIC96_CHATD Nucleoporin NIC96 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NIC96 PE=1 SV=1 88 1185 0.0E+00
sp|P34077|NIC96_YEAST Nucleoporin NIC96 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIC96 PE=1 SV=2 256 1179 2.0E-94
sp|O94418|MUG87_SCHPO Meiotically up-regulated gene 87 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug87 PE=1 SV=1 489 1185 9.0E-84
sp|O14310|NP106_SCHPO Nucleoporin npp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npp106 PE=1 SV=1 256 1179 1.0E-60
sp|Q8N1F7|NUP93_HUMAN Nuclear pore complex protein Nup93 OS=Homo sapiens GN=NUP93 PE=1 SV=2 498 1170 4.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|G0S024|NIC96_CHATD Nucleoporin NIC96 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NIC96 PE=1 SV=1 88 1185 0.0E+00
sp|P34077|NIC96_YEAST Nucleoporin NIC96 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NIC96 PE=1 SV=2 256 1179 2.0E-94
sp|O94418|MUG87_SCHPO Meiotically up-regulated gene 87 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mug87 PE=1 SV=1 489 1185 9.0E-84
sp|O14310|NP106_SCHPO Nucleoporin npp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=npp106 PE=1 SV=1 256 1179 1.0E-60
sp|Q8N1F7|NUP93_HUMAN Nuclear pore complex protein Nup93 OS=Homo sapiens GN=NUP93 PE=1 SV=2 498 1170 4.0E-29
sp|Q7ZU29|NUP93_DANRE Nuclear pore complex protein Nup93 OS=Danio rerio GN=dye PE=2 SV=1 540 1171 6.0E-29
sp|Q5R822|NUP93_PONAB Nuclear pore complex protein Nup93 OS=Pongo abelii GN=NUP93 PE=2 SV=2 498 1170 6.0E-29
sp|Q8BJ71|NUP93_MOUSE Nuclear pore complex protein Nup93 OS=Mus musculus GN=Nup93 PE=1 SV=1 540 1170 3.0E-28
sp|A5PJZ5|NUP93_BOVIN Nuclear pore complex protein Nup93 OS=Bos taurus GN=NUP93 PE=2 SV=1 540 1170 3.0E-28
sp|Q6NX12|NUP93_XENTR Nuclear pore complex protein Nup93 OS=Xenopus tropicalis GN=nup93 PE=2 SV=1 540 988 4.0E-28
sp|Q66HC5|NUP93_RAT Nuclear pore complex protein Nup93 OS=Rattus norvegicus GN=Nup93 PE=1 SV=1 540 1170 5.0E-28
sp|Q7ZX96|NUP93_XENLA Nuclear pore complex protein Nup93 OS=Xenopus laevis GN=nup93 PE=2 SV=1 540 988 4.0E-26
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 4 249 7.0E-15
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 2 226 6.0E-11
sp|Q54EQ8|NUP98_DICDI Nuclear pore complex protein Nup98-Nup96 OS=Dictyostelium discoideum GN=nup98 PE=3 SV=1 11 231 1.0E-10
sp|G5EEH9|NUP98_CAEEL Nuclear pore complex protein Nup98-Nup96 OS=Caenorhabditis elegans GN=npp-10 PE=2 SV=1 13 263 2.0E-10
sp|O22224|NP93A_ARATH Nuclear pore complex protein NUP93A OS=Arabidopsis thaliana GN=NUP93A PE=1 SV=2 256 1126 4.0E-10
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 3 199 5.0E-09
sp|Q02629|NU100_YEAST Nucleoporin NUP100/NSP100 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP100 PE=1 SV=1 8 215 6.0E-09
sp|P48837|NUP57_YEAST Nucleoporin NUP57 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP57 PE=1 SV=1 6 148 8.0E-08
sp|F4J284|NU93B_ARATH Nuclear pore complex protein NUP93B OS=Arabidopsis thaliana GN=NUP93B PE=1 SV=1 256 987 1.0E-07
sp|G0S4X2|NUP49_CHATD Nucleoporin NUP49 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP49 PE=1 SV=1 12 231 2.0E-07
sp|G0SAK3|NU145_CHATD Nucleoporin NUP145 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=NUP145 PE=1 SV=1 24 239 3.0E-06
sp|P49687|NU145_YEAST Nucleoporin NUP145 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NUP145 PE=1 SV=1 3 257 3.0E-06
sp|Q09793|NUP45_SCHPO Nucleoporin nup45 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nup45 PE=1 SV=2 4 182 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005643 nuclear pore Yes
GO:0017056 structural constituent of nuclear pore Yes
GO:0003674 molecular_function No
GO:0005575 cellular_component No
GO:0005198 structural molecule activity No
GO:0140513 nuclear protein-containing complex No
GO:0032991 protein-containing complex No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3851
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3509
Ophiocordyceps australis map64 (Brazil) OphauB2|1382
Ophiocordyceps camponoti-floridani Ophcf2|00480
Ophiocordyceps camponoti-rufipedis Ophun1|4065 (this protein)
Ophiocordyceps kimflemingae Ophio5|7084
Ophiocordyceps subramaniannii Hirsu2|7623

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4065
MSLFGQPASGSSLFGAQQQQQPASGSSLFGAQQQQQQPSSASSLFGAQQQQPASSGGLFGQQQQTQNQGNATTGT
GLFGQAVQNQTAAATGTGLFGQPAQAANAGCSGLLGQPAQASITGGSSLFGQPAQASNTGGSGLFGQPAQNQAAA
NTTTTTGGSLFGQLQNQQQKPSLFASSNLQASGFGASVAKPSLSLFGSTAPDANAQQNAGLALGGGLSGAPTQTT
QQQQQLAGAYFDSLFAKTLKEGGGKTDMESLPSLELGLGDLRHRLRKLQNKSLERPLDGKAHYLLAGSGVDPSAA
AKDLGMLDVQGARADRTNGYAPTELDVETYLSNLQTKTTLSMISDDLERSLRDFDNFLDDHVAMEWEAQRKRIYQ
HFGIKPRDDSAAAARDSQAASFGRSSRRSKSHQAGASRAGGSVLGSSLAQRSVIGPPSRIGAHPTDFSDVVGGGE
GLRTRGANDFRLLRDRQAKLADKVRALNAARLGKRPYAIFAELCEVADKSVEAHAPHVAEAYRAMMELVGEDEAP
AMTGERRFAGVYLDDNAQSAGAVEMRKRILDAANRFLERQFMRQVESLIAKHPHEAKLGGKPDVTSKMRAYIRLR
SARKDLVPDNTELQQVQGEYVWAVVFYLLRSGHVKEAAEFVNDHGSQFRGIDRTFATYLNSYAVSQDRRITNRKL
LDRCTNEFTQRARNAPDHSIDPFRMACYKVIGRVELGNRTLEGLHTDVNDWIWLQFNLAREGDRSVEMAGESYGL
VELQASVRDIGLKHFPKAASDDAGNGSFGMFFYLQVLAGMFEDAVAYLYPFSYVDAVHFGLALTYYGLLRPADPL
SSSGGNELRSLSVRGLAQINFGRMLGYYTRDFRAADVVSAVDYLALICLNGDLPGESGRRQAALCREALRDLVLE
TREFSKLLGDIRPDGHGIRGVIDERAPLMGLDDVGDGDDDFVASVTLQAASLADENGRTTDAVLLYHLAGEYDTV
VAIVSRALSEAVSLEMGEDPMRLAPVKPREDKDVVGQQASSSSLSLAAIDDPVELAKVMMAMYERDAMFYGRIRA
DNRVACHVLLAMSGIKKLVEAGRWAQALDKIRGLEILPLEAGGDASTIRAFASKFSALSQPVAINVPNLLMWTII
CCLRQREQLTDGQFSGNEGTRRLMVEQLKQMTLDLTTYTSQLRYRFPPHLHEALARASAE*
Coding >Ophun1|4065
ATGTCGCTCTTTGGACAGCCGGCTTCGGGGTCGTCGTTGTTTGGAGCCCAGCAGCAGCAGCAGCCGGCCTCTGGG
TCATCGTTGTTTGGGGCCCAACAGCAGCAACAGCAGCCGTCCTCTGCGTCGTCGCTGTTTGGTGCTCAGCAGCAG
CAGCCGGCTTCGAGTGGGGGACTTTTCGGCCAGCAGCAGCAGACGCAGAATCAAGGCAACGCTACGACTGGGACG
GGTCTGTTTGGTCAGGCGGTTCAGAACCAGACGGCTGCTGCGACTGGTACTGGTCTTTTTGGCCAGCCTGCTCAG
GCTGCGAATGCGGGCTGTAGCGGTCTTCTTGGCCAGCCAGCTCAAGCTTCGATCACGGGCGGTAGCAGTCTGTTT
GGCCAGCCAGCTCAAGCCTCGAACACAGGCGGCAGCGGCCTCTTTGGCCAGCCTGCTCAGAACCAGGCCGCGGCA
AATACGACGACGACAACTGGCGGTTCTCTCTTTGGTCAGCTGCAGAATCAGCAGCAGAAGCCCTCTCTCTTCGCC
AGCTCCAACCTGCAGGCCAGCGGCTTCGGAGCTTCGGTGGCCAAACCGTCGCTTTCGCTCTTCGGCTCGACTGCC
CCTGATGCCAACGCCCAACAGAATGCCGGTCTCGCTCTCGGAGGCGGCCTCTCGGGGGCTCCGACTCAGACGACA
CAGCAGCAGCAGCAGCTCGCCGGCGCCTACTTCGACAGCCTCTTCGCCAAAACGCTCAAAGAAGGGGGCGGCAAG
ACGGACATGGAGTCTCTCCCCAGCCTGGAGCTCGGCCTCGGCGATCTGCGCCACCGGCTGAGGAAGCTTCAGAAC
AAGTCTCTCGAGAGGCCGCTTGATGGCAAGGCGCACTACCTCCTGGCCGGTTCAGGCGTTGACCCCAGCGCGGCC
GCCAAGGACCTCGGTATGCTCGACGTTCAGGGCGCCCGCGCAGACCGGACCAATGGCTACGCGCCGACGGAGCTC
GATGTCGAGACATATCTATCTAACCTGCAGACCAAGACGACGCTTAGCATGATCTCGGACGACCTCGAGCGATCG
CTGCGTGACTTTGACAACTTCCTCGACGACCACGTCGCCATGGAGTGGGAGGCACAGCGGAAGCGCATCTACCAG
CACTTTGGCATCAAGCCACGCGATGACTCGGCCGCCGCCGCCCGGGACTCACAGGCAGCCAGCTTCGGCCGTTCA
TCGCGCCGCAGCAAGTCCCATCAGGCGGGGGCATCCCGGGCTGGAGGCAGCGTACTCGGCTCATCGCTGGCACAA
CGGTCCGTCATCGGCCCTCCTAGCCGCATCGGCGCTCATCCGACCGACTTCTCCGATGTCGTCGGCGGCGGCGAA
GGGCTCCGGACGCGCGGCGCCAACGACTTCCGTCTGCTTCGCGACAGGCAGGCCAAGCTGGCCGACAAGGTGCGG
GCTCTCAACGCGGCGCGTCTGGGCAAGCGACCTTATGCCATCTTCGCCGAGCTGTGCGAGGTGGCGGACAAGTCG
GTCGAGGCGCACGCGCCGCACGTGGCCGAGGCCTACCGGGCCATGATGGAGCTGGTCGGCGAGGATGAGGCGCCA
GCCATGACGGGAGAGCGGCGCTTCGCCGGCGTCTACCTCGACGACAACGCCCAGTCGGCCGGAGCCGTCGAGATG
CGCAAGCGGATACTGGACGCTGCCAACCGGTTCCTGGAGCGGCAGTTTATGCGTCAGGTCGAGTCGCTCATCGCC
AAGCACCCGCACGAGGCCAAGCTCGGTGGAAAGCCGGACGTGACGAGCAAGATGAGGGCCTATATCCGGCTGCGG
TCGGCGCGCAAGGACCTGGTGCCCGACAATACGGAGCTGCAGCAGGTCCAGGGCGAGTACGTCTGGGCCGTCGTC
TTCTACCTGCTCCGGTCCGGTCACGTTAAGGAGGCGGCCGAGTTCGTCAACGATCACGGCAGCCAGTTTCGCGGC
ATCGACCGCACATTTGCCACGTACCTCAACAGCTATGCCGTCAGTCAGGACCGGCGCATCACCAACCGGAAGCTG
CTCGACCGCTGCACAAACGAGTTCACGCAGCGGGCTCGCAACGCCCCGGATCACTCCATCGACCCCTTCCGCATG
GCCTGCTACAAGGTCATCGGCCGCGTCGAGCTCGGCAACCGCACTCTCGAAGGCCTCCACACCGATGTCAACGAC
TGGATCTGGCTGCAGTTCAACTTGGCCCGCGAGGGAGACCGTTCCGTCGAGATGGCTGGCGAGTCGTACGGACTG
GTCGAGCTACAGGCCAGCGTGCGTGATATTGGCCTCAAGCACTTCCCCAAGGCCGCCTCGGATGACGCGGGCAAC
GGCAGCTTTGGCATGTTCTTCTACCTTCAGGTGCTGGCCGGCATGTTCGAGGACGCCGTCGCGTATCTGTACCCC
TTTTCCTACGTCGATGCCGTTCACTTCGGCCTGGCCCTGACCTACTACGGCCTCCTGCGGCCGGCCGATCCGCTC
TCGTCGTCGGGTGGCAACGAGCTGCGCAGCCTCAGCGTCAGGGGCTTGGCGCAGATCAACTTTGGCCGCATGCTG
GGCTACTATACTCGCGACTTTCGCGCCGCCGACGTCGTCTCCGCTGTCGACTACCTGGCCCTCATCTGCCTCAAC
GGCGACCTCCCCGGCGAGTCCGGCCGTCGTCAGGCCGCCCTGTGTCGCGAGGCGCTGCGCGATCTGGTGCTCGAG
ACGCGCGAGTTCAGTAAGCTGCTGGGCGACATTAGGCCTGACGGTCACGGCATCCGCGGCGTCATCGACGAGCGC
GCGCCTCTCATGGGGCTCGACGACGTGGGCGACGGCGACGACGACTTTGTCGCTTCCGTGACGCTGCAGGCGGCC
AGCCTCGCCGACGAAAATGGCCGGACGACGGACGCGGTGCTGCTGTATCACTTGGCGGGCGAGTACGATACTGTC
GTCGCCATCGTCAGCCGCGCTCTTAGTGAGGCCGTCTCGCTTGAGATGGGTGAGGATCCGATGCGACTGGCGCCC
GTCAAGCCGCGTGAAGACAAGGATGTCGTCGGCCAGCAGGCCAGCAGCAGCAGCTTAAGCTTGGCAGCCATTGAC
GACCCCGTCGAGCTGGCCAAGGTCATGATGGCCATGTACGAGCGCGACGCCATGTTCTACGGCAGGATCCGGGCC
GACAACAGGGTGGCCTGCCACGTGCTGCTGGCCATGAGCGGCATCAAGAAGCTGGTGGAGGCGGGACGATGGGCT
CAGGCGCTGGATAAAATCCGCGGCCTGGAAATCCTACCGCTCGAGGCGGGCGGCGACGCGAGCACGATCCGGGCC
TTTGCGTCCAAATTCTCGGCGCTGTCGCAGCCGGTGGCCATCAACGTGCCTAACCTGCTCATGTGGACCATCATC
TGCTGTCTTCGCCAGCGGGAGCAGCTCACCGACGGCCAGTTCAGCGGCAACGAGGGGACGAGGCGGTTGATGGTG
GAGCAGCTGAAGCAGATGACGCTGGATTTGACGACGTATACCAGTCAGTTGCGGTATCGGTTTCCGCCGCATTTG
CATGAGGCGTTGGCGAGGGCTTCGGCTGAGTAG
Transcript >Ophun1|4065
ATGTCGCTCTTTGGACAGCCGGCTTCGGGGTCGTCGTTGTTTGGAGCCCAGCAGCAGCAGCAGCCGGCCTCTGGG
TCATCGTTGTTTGGGGCCCAACAGCAGCAACAGCAGCCGTCCTCTGCGTCGTCGCTGTTTGGTGCTCAGCAGCAG
CAGCCGGCTTCGAGTGGGGGACTTTTCGGCCAGCAGCAGCAGACGCAGAATCAAGGCAACGCTACGACTGGGACG
GGTCTGTTTGGTCAGGCGGTTCAGAACCAGACGGCTGCTGCGACTGGTACTGGTCTTTTTGGCCAGCCTGCTCAG
GCTGCGAATGCGGGCTGTAGCGGTCTTCTTGGCCAGCCAGCTCAAGCTTCGATCACGGGCGGTAGCAGTCTGTTT
GGCCAGCCAGCTCAAGCCTCGAACACAGGCGGCAGCGGCCTCTTTGGCCAGCCTGCTCAGAACCAGGCCGCGGCA
AATACGACGACGACAACTGGCGGTTCTCTCTTTGGTCAGCTGCAGAATCAGCAGCAGAAGCCCTCTCTCTTCGCC
AGCTCCAACCTGCAGGCCAGCGGCTTCGGAGCTTCGGTGGCCAAACCGTCGCTTTCGCTCTTCGGCTCGACTGCC
CCTGATGCCAACGCCCAACAGAATGCCGGTCTCGCTCTCGGAGGCGGCCTCTCGGGGGCTCCGACTCAGACGACA
CAGCAGCAGCAGCAGCTCGCCGGCGCCTACTTCGACAGCCTCTTCGCCAAAACGCTCAAAGAAGGGGGCGGCAAG
ACGGACATGGAGTCTCTCCCCAGCCTGGAGCTCGGCCTCGGCGATCTGCGCCACCGGCTGAGGAAGCTTCAGAAC
AAGTCTCTCGAGAGGCCGCTTGATGGCAAGGCGCACTACCTCCTGGCCGGTTCAGGCGTTGACCCCAGCGCGGCC
GCCAAGGACCTCGGTATGCTCGACGTTCAGGGCGCCCGCGCAGACCGGACCAATGGCTACGCGCCGACGGAGCTC
GATGTCGAGACATATCTATCTAACCTGCAGACCAAGACGACGCTTAGCATGATCTCGGACGACCTCGAGCGATCG
CTGCGTGACTTTGACAACTTCCTCGACGACCACGTCGCCATGGAGTGGGAGGCACAGCGGAAGCGCATCTACCAG
CACTTTGGCATCAAGCCACGCGATGACTCGGCCGCCGCCGCCCGGGACTCACAGGCAGCCAGCTTCGGCCGTTCA
TCGCGCCGCAGCAAGTCCCATCAGGCGGGGGCATCCCGGGCTGGAGGCAGCGTACTCGGCTCATCGCTGGCACAA
CGGTCCGTCATCGGCCCTCCTAGCCGCATCGGCGCTCATCCGACCGACTTCTCCGATGTCGTCGGCGGCGGCGAA
GGGCTCCGGACGCGCGGCGCCAACGACTTCCGTCTGCTTCGCGACAGGCAGGCCAAGCTGGCCGACAAGGTGCGG
GCTCTCAACGCGGCGCGTCTGGGCAAGCGACCTTATGCCATCTTCGCCGAGCTGTGCGAGGTGGCGGACAAGTCG
GTCGAGGCGCACGCGCCGCACGTGGCCGAGGCCTACCGGGCCATGATGGAGCTGGTCGGCGAGGATGAGGCGCCA
GCCATGACGGGAGAGCGGCGCTTCGCCGGCGTCTACCTCGACGACAACGCCCAGTCGGCCGGAGCCGTCGAGATG
CGCAAGCGGATACTGGACGCTGCCAACCGGTTCCTGGAGCGGCAGTTTATGCGTCAGGTCGAGTCGCTCATCGCC
AAGCACCCGCACGAGGCCAAGCTCGGTGGAAAGCCGGACGTGACGAGCAAGATGAGGGCCTATATCCGGCTGCGG
TCGGCGCGCAAGGACCTGGTGCCCGACAATACGGAGCTGCAGCAGGTCCAGGGCGAGTACGTCTGGGCCGTCGTC
TTCTACCTGCTCCGGTCCGGTCACGTTAAGGAGGCGGCCGAGTTCGTCAACGATCACGGCAGCCAGTTTCGCGGC
ATCGACCGCACATTTGCCACGTACCTCAACAGCTATGCCGTCAGTCAGGACCGGCGCATCACCAACCGGAAGCTG
CTCGACCGCTGCACAAACGAGTTCACGCAGCGGGCTCGCAACGCCCCGGATCACTCCATCGACCCCTTCCGCATG
GCCTGCTACAAGGTCATCGGCCGCGTCGAGCTCGGCAACCGCACTCTCGAAGGCCTCCACACCGATGTCAACGAC
TGGATCTGGCTGCAGTTCAACTTGGCCCGCGAGGGAGACCGTTCCGTCGAGATGGCTGGCGAGTCGTACGGACTG
GTCGAGCTACAGGCCAGCGTGCGTGATATTGGCCTCAAGCACTTCCCCAAGGCCGCCTCGGATGACGCGGGCAAC
GGCAGCTTTGGCATGTTCTTCTACCTTCAGGTGCTGGCCGGCATGTTCGAGGACGCCGTCGCGTATCTGTACCCC
TTTTCCTACGTCGATGCCGTTCACTTCGGCCTGGCCCTGACCTACTACGGCCTCCTGCGGCCGGCCGATCCGCTC
TCGTCGTCGGGTGGCAACGAGCTGCGCAGCCTCAGCGTCAGGGGCTTGGCGCAGATCAACTTTGGCCGCATGCTG
GGCTACTATACTCGCGACTTTCGCGCCGCCGACGTCGTCTCCGCTGTCGACTACCTGGCCCTCATCTGCCTCAAC
GGCGACCTCCCCGGCGAGTCCGGCCGTCGTCAGGCCGCCCTGTGTCGCGAGGCGCTGCGCGATCTGGTGCTCGAG
ACGCGCGAGTTCAGTAAGCTGCTGGGCGACATTAGGCCTGACGGTCACGGCATCCGCGGCGTCATCGACGAGCGC
GCGCCTCTCATGGGGCTCGACGACGTGGGCGACGGCGACGACGACTTTGTCGCTTCCGTGACGCTGCAGGCGGCC
AGCCTCGCCGACGAAAATGGCCGGACGACGGACGCGGTGCTGCTGTATCACTTGGCGGGCGAGTACGATACTGTC
GTCGCCATCGTCAGCCGCGCTCTTAGTGAGGCCGTCTCGCTTGAGATGGGTGAGGATCCGATGCGACTGGCGCCC
GTCAAGCCGCGTGAAGACAAGGATGTCGTCGGCCAGCAGGCCAGCAGCAGCAGCTTAAGCTTGGCAGCCATTGAC
GACCCCGTCGAGCTGGCCAAGGTCATGATGGCCATGTACGAGCGCGACGCCATGTTCTACGGCAGGATCCGGGCC
GACAACAGGGTGGCCTGCCACGTGCTGCTGGCCATGAGCGGCATCAAGAAGCTGGTGGAGGCGGGACGATGGGCT
CAGGCGCTGGATAAAATCCGCGGCCTGGAAATCCTACCGCTCGAGGCGGGCGGCGACGCGAGCACGATCCGGGCC
TTTGCGTCCAAATTCTCGGCGCTGTCGCAGCCGGTGGCCATCAACGTGCCTAACCTGCTCATGTGGACCATCATC
TGCTGTCTTCGCCAGCGGGAGCAGCTCACCGACGGCCAGTTCAGCGGCAACGAGGGGACGAGGCGGTTGATGGTG
GAGCAGCTGAAGCAGATGACGCTGGATTTGACGACGTATACCAGTCAGTTGCGGTATCGGTTTCCGCCGCATTTG
CATGAGGCGTTGGCGAGGGCTTCGGCTGAGTAG
Gene >Ophun1|4065
ATGTCGCTCTTTGGACAGCCGGCTTCGGGGTCGTCGTTGTTTGGAGCCCAGCAGCAGCAGCAGCCGGCCTCTGGG
TCATCGTTGTTTGGGGCCCAACAGCAGCAACAGCAGCCGTCCTCTGCGTCGTCGCTGTTTGGTGCTCAGCAGCAG
CAGCCGGCTTCGAGTGGGGGACTTTTCGGCCAGCAGCAGCAGACGCAGAATCAAGGCAACGCTACGACTGGGACG
GGTCTGTTTGGTCAGGCGGTTCAGAACCAGACGGCTGCTGCGACTGGTACTGGTCTTTTTGGCCAGCCTGCTCAG
GCTGCGAATGCGGGCTGTAGCGGTCTTCTTGGCCAGCCAGCTCAAGCTTCGATCACGGGCGGTAGCAGTCTGTTT
GGCCAGCCAGCTCAAGCCTCGAACACAGGCGGCAGCGGCCTCTTTGGCCAGCCTGCTCAGAACCAGGCCGCGGCA
AATACGACGACGACAACTGGCGGTTCTCTCTTTGGTCAGCTGCAGAATCAGCAGCAGAAGCCCTCTCTCTTCGCC
AGCTCCAACCTGCAGGCCAGCGGCTTCGGAGCTTCGGTGGCCAAACCGTCGCTTTCGCTCTTCGGCTCGACTGCC
CCTGATGCCAACGCCCAACAGAATGCCGGTCTCGCTCTCGGAGGCGGCCTCTCGGGGGCTCCGACTCAGACGACA
CAGCAGCAGCAGCAGCTCGCCGGCGCCTACTTCGACAGCCTCTTCGCCAAAACGCTCAAAGAAGGGGGCGGCAAG
ACGGACATGGAGTCTCTCCCCAGCCTGGAGCTCGGCCTCGGCGATCTGCGCCACCGGCTGAGGAAGCTTCAGAAC
AAGTCTCTCGAGAGGCCGCTTGATGGCAAGGCGCACTACCTCCTGGCCGGTTCAGGCGTTGACCCCAGCGCGGCC
GCCAAGGACCTCGGTATGCTCGACGTTCAGGGCGCCCGCGCAGACCGGACCAATGGCTACGCGCCGACGGAGCTC
GATGTCGAGACATATCTATCTAACCTGCAGACCAAGACGACGCTTAGCATGATCTCGGACGACCTCGAGCGATCG
CTGCGTGACTTTGACAACTTCCTCGACGACCACGTCGCCATGGAGTGGGAGGCACAGCGGAAGCGCATCTACCAG
CACTTTGGCATCAAGCCACGCGATGACTCGGCCGCCGCCGCCCGGGACTCACAGGCAGCCAGCTTCGGCCGTTCA
TCGCGCCGCAGCAAGTCCCATCAGGCGGGGGCATCCCGGGCTGGAGGCAGCGTACTCGGCTCATCGCTGGCACAA
CGGTCCGTCATCGGCCCTCCTAGCCGCATCGGCGCTCATCCGACCGACTTCTCCGATGTCGTCGGCGGCGGCGAA
GGGCTCCGGACGCGCGGCGCCAACGACTTCCGTCTGCTTCGCGACAGGCAGGCCAAGCTGGCCGACAAGGTGCGG
GCTCTCAACGCGGCGCGTCTGGGCAAGCGACCTTATGCCATCTTCGCCGAGCTGTGCGAGGTGGCGGACAAGTCG
GTCGAGGCGCACGCGCCGCACGTGGCCGAGGCCTACCGGGCCATGATGGAGCTGGTCGGCGAGGATGAGGCGCCA
GCCATGACGGGAGAGCGGCGCTTCGCCGGCGTCTACCTCGACGACAACGCCCAGTCGGCCGGAGCCGTCGAGATG
CGCAAGCGGATACTGGACGCTGCCAACCGGTTCCTGGAGCGGCAGTTTATGCGTCAGGTCGAGTCGCTCATCGCC
AAGCACCCGCACGAGGCCAAGCTCGGTGGAAAGCCGGACGTGACGAGCAAGATGAGGGCCTATATCCGGCTGCGG
TCGGCGCGCAAGGACCTGGTGCCCGACAATACGGAGCTGCAGCAGGTCCAGGGCGAGTACGTCTGGGCCGTCGTC
TTCTACCTGCTCCGGTCCGGTCACGTTAAGGAGGCGGCCGAGTTCGTCAACGATCACGGCAGCCAGTTTCGCGGC
ATCGACCGCACATTTGCCACGTACCTCAACAGCTATGCCGTCAGTCAGGACCGGCGCATCACCAACCGGAAGCTG
CTCGACCGCTGCACAAACGAGTTCACGCAGCGGGCTCGCAACGCCCCGGATCACTCCATCGACCCCTTCCGCATG
GCCTGCTACAAGGTCATCGGCCGCGTCGAGCTCGGCAACCGCACTCTCGAAGGCCTCCACACCGATGTCAACGAC
TGGATCTGGCTGCAGTTCAACTTGGCCCGCGAGGGAGACCGTTCCGTCGAGATGGCTGGCGAGTCGTACGGACTG
GTCGAGCTACAGGCCAGCGTGCGTGATATTGGCCTCAAGCACTTCCCCAAGGCCGCCTCGGATGACGCGGGCAAC
GGCAGCTTTGGCATGTTCTTCTACCTTCAGGTGCTGGCCGGCATGTTCGAGGACGCCGTCGCGTATCTGTACCCC
TTTTCCTACGTCGATGCCGTTCACTTCGGCCTGGCCCTGACCTACTACGGCCTCCTGCGGCCGGCCGATCCGCTC
TCGTCGTCGGGTGGCAACGAGCTGCGCAGCCTCAGCGTCAGGGGCTTGGCGCAGATCAACTTTGGCCGCATGCTG
GGCTACTATACTCGCGACTTTCGCGCCGCCGACGTCGTCTCCGCTGTCGACTACCTGGCCCTCATCTGCCTCAAC
GGCGACCTCCCCGGCGAGTCCGGCCGTCGTCAGGCCGCCCTGTGTCGCGAGGCGCTGCGCGATCTGGTGCTCGAG
ACGCGCGAGTTCAGTAAGCTGCTGGGCGACATTAGGCCTGACGGTCACGGCATCCGCGGCGTCATCGACGAGCGC
GCGCCTCTCATGGGGCTCGACGACGTGGGCGACGGCGACGACGACTTTGTCGCTTCCGTGACGCTGCAGGCGGCC
AGCCTCGCCGACGAAAATGGCCGGACGACGGACGCGGTGCTGCTGTATCACTTGGCGGGCGAGTACGATACTGTC
GTCGCCATCGTCAGCCGCGCTCTTAGTGAGGCCGTCTCGCTTGAGATGGGTGAGGATCCGATGCGACTGGCGCCC
GTCAAGCCGCGTGAAGACAAGGATGTCGTCGGCCAGCAGGCCAGCAGCAGCAGCTTAAGCTTGGCAGCCATTGAC
GACCCCGTCGAGCTGGCCAAGGTCATGATGGCCATGTACGAGCGCGACGCCATGTTCTACGGCAGGATCCGGGCC
GACAACAGGGTGGCCTGCCACGTGCTGCTGGCCATGAGCGGCATCAAGAAGCTGGTGGAGGCGGGACGATGGGCT
CAGGCGCTGGATGTAAGTCGGATGGACTCTTCGAGAAGCGGATCAAGCACTGACAGGGAGCAGAAAATCCGCGGC
CTGGAAATCCTACCGCTCGAGGCGGGCGGCGACGCGAGCACGATCCGGGCCTTTGCGTCCAAATTCTCGGCGCTG
TCGCAGCCGGTGGCCATCAACGTGCCTAACCTGCTCATGTGGACCATCATCTGCTGTCTTCGCCAGCGGGAGCAG
CTCACCGACGGCCAGTTCAGCGGCAACGAGGGGACGAGGCGGTTGATGGTGGAGCAGCTGAAGCAGATGACGCTG
GATTTGACGACGTATACCAGTCAGTTGCGGTATCGGTTTCCGCCGCATTTGCATGAGGCGTTGGCGAGGGCTTCG
GCTGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail