Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4064
Gene name
LocationContig_370:3718..5818
Strand+
Gene length (bp)2100
Transcript length (bp)1785
Coding sequence length (bp)1785
Protein length (aa) 595

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02782 FGGY_C FGGY family of carbohydrate kinases, C-terminal domain 5.8E-50 322 533
PF00370 FGGY_N FGGY family of carbohydrate kinases, N-terminal domain 8.8E-21 20 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q04585|YDR09_YEAST Uncharacterized sugar kinase YDR109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR109C PE=1 SV=1 20 533 0.0E+00
sp|A2AJL3|FGGY_MOUSE FGGY carbohydrate kinase domain-containing protein OS=Mus musculus GN=Fggy PE=1 SV=1 19 582 5.0E-143
sp|Q6DCD1|FGGY_XENLA FGGY carbohydrate kinase domain-containing protein OS=Xenopus laevis GN=fggy PE=2 SV=2 19 583 5.0E-141
sp|Q96C11|FGGY_HUMAN FGGY carbohydrate kinase domain-containing protein OS=Homo sapiens GN=FGGY PE=1 SV=2 19 582 1.0E-137
sp|Q6NUW9|FGGY_DANRE FGGY carbohydrate kinase domain-containing protein OS=Danio rerio GN=fggy PE=2 SV=2 19 580 2.0E-125
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q04585|YDR09_YEAST Uncharacterized sugar kinase YDR109C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR109C PE=1 SV=1 20 533 0.0E+00
sp|A2AJL3|FGGY_MOUSE FGGY carbohydrate kinase domain-containing protein OS=Mus musculus GN=Fggy PE=1 SV=1 19 582 5.0E-143
sp|Q6DCD1|FGGY_XENLA FGGY carbohydrate kinase domain-containing protein OS=Xenopus laevis GN=fggy PE=2 SV=2 19 583 5.0E-141
sp|Q96C11|FGGY_HUMAN FGGY carbohydrate kinase domain-containing protein OS=Homo sapiens GN=FGGY PE=1 SV=2 19 582 1.0E-137
sp|Q6NUW9|FGGY_DANRE FGGY carbohydrate kinase domain-containing protein OS=Danio rerio GN=fggy PE=2 SV=2 19 580 2.0E-125
sp|P53583|MPA43_YEAST Protein MPA43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPA43 PE=1 SV=1 21 591 2.0E-52
sp|Q49V87|ARAB2_STAS1 Ribulokinase 2 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=araB2 PE=3 SV=1 17 592 2.0E-38
sp|P63550|ARAB_STAAN Ribulokinase OS=Staphylococcus aureus (strain N315) GN=araB PE=3 SV=1 17 549 1.0E-36
sp|P63549|ARAB_STAAM Ribulokinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=araB PE=3 SV=1 17 549 1.0E-36
sp|A7WYY2|ARAB_STAA1 Ribulokinase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=araB PE=3 SV=1 17 549 1.0E-36
sp|A6QEK4|ARAB_STAAE Ribulokinase OS=Staphylococcus aureus (strain Newman) GN=araB PE=3 SV=1 17 549 1.0E-36
sp|Q5HIC3|ARAB_STAAC Ribulokinase OS=Staphylococcus aureus (strain COL) GN=araB PE=3 SV=1 17 549 1.0E-36
sp|Q2G0M6|ARAB_STAA8 Ribulokinase OS=Staphylococcus aureus (strain NCTC 8325) GN=araB PE=3 SV=1 17 549 1.0E-36
sp|Q2FJ88|ARAB_STAA3 Ribulokinase OS=Staphylococcus aureus (strain USA300) GN=araB PE=3 SV=1 17 549 1.0E-36
sp|Q2YSA9|ARAB_STAAB Ribulokinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=araB PE=3 SV=1 17 549 3.0E-36
sp|Q6GJB6|ARAB_STAAR Ribulokinase OS=Staphylococcus aureus (strain MRSA252) GN=araB PE=3 SV=1 17 549 5.0E-36
sp|Q8NXY1|ARAB_STAAW Ribulokinase OS=Staphylococcus aureus (strain MW2) GN=araB PE=3 SV=1 17 549 6.0E-36
sp|Q6GBT5|ARAB_STAAS Ribulokinase OS=Staphylococcus aureus (strain MSSA476) GN=araB PE=3 SV=1 17 549 6.0E-36
sp|Q49ZR6|ARAB1_STAS1 Ribulokinase 1 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=araB1 PE=3 SV=1 17 549 2.0E-35
sp|Q8CRC6|ARAB_STAES Ribulokinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=araB PE=3 SV=1 17 554 1.0E-34
sp|Q5HLQ6|ARAB_STAEQ Ribulokinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=araB PE=3 SV=1 17 554 1.0E-34
sp|P94524|ARAB_BACSU Ribulokinase OS=Bacillus subtilis (strain 168) GN=araB PE=2 SV=1 17 575 3.0E-33
sp|Q5KYP6|ARAB_GEOKA Ribulokinase OS=Geobacillus kaustophilus (strain HTA426) GN=araB PE=3 SV=1 19 513 3.0E-28
sp|B7GGV9|ARAB_ANOFW Ribulokinase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=araB PE=3 SV=1 19 513 3.0E-28
sp|A4IPA2|ARAB_GEOTN Ribulokinase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=araB PE=3 SV=1 19 513 7.0E-28
sp|Q9S468|ARAB_GEOSE Ribulokinase OS=Geobacillus stearothermophilus GN=araB PE=3 SV=1 19 513 2.0E-27
sp|Q65GC1|ARAB_BACLD Ribulokinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=araB PE=3 SV=1 61 533 4.0E-27
sp|Q5WL06|ARAB_BACSK Ribulokinase OS=Bacillus clausii (strain KSM-K16) GN=araB PE=3 SV=1 19 556 2.0E-24
sp|Q9LBQ3|ARAB_MYCSM Ribulokinase OS=Mycobacterium smegmatis GN=araB PE=3 SV=1 11 511 4.0E-24
sp|Q9KBQ3|ARAB_BACHD Ribulokinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=araB PE=1 SV=1 19 548 3.0E-21
sp|Q8CR47|XYLB_STAES D-xylulose kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=xylB PE=3 SV=1 21 572 1.0E-19
sp|Q5HL88|XYLB_STAEQ D-xylulose kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=xylB PE=3 SV=1 21 572 2.0E-19
sp|C6DH20|ARAB_PECCP Ribulokinase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=araB PE=3 SV=1 21 513 8.0E-16
sp|Q6D4W6|ARAB_PECAS Ribulokinase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=araB PE=3 SV=1 21 513 2.0E-15
sp|A9MQF0|ARAB_SALAR Ribulokinase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=araB PE=3 SV=1 21 513 5.0E-15
sp|A4W6G7|ARAB_ENT38 Ribulokinase OS=Enterobacter sp. (strain 638) GN=araB PE=3 SV=1 21 513 2.0E-14
sp|B5BL44|ARAB_SALPK Ribulokinase OS=Salmonella paratyphi A (strain AKU_12601) GN=araB PE=3 SV=1 21 513 2.0E-14
sp|Q5PDF1|ARAB_SALPA Ribulokinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=araB PE=3 SV=1 21 513 2.0E-14
sp|P58542|ARAB_SALTI Ribulokinase OS=Salmonella typhi GN=araB PE=3 SV=2 21 513 2.0E-14
sp|B4SU24|ARAB_SALNS Ribulokinase OS=Salmonella newport (strain SL254) GN=araB PE=3 SV=1 21 513 2.0E-14
sp|B4TWU9|ARAB_SALSV Ribulokinase OS=Salmonella schwarzengrund (strain CVM19633) GN=araB PE=3 SV=1 21 513 3.0E-14
sp|A8ALN9|ARAB_CITK8 Ribulokinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=araB PE=3 SV=1 21 513 4.0E-14
sp|B5F784|ARAB_SALA4 Ribulokinase OS=Salmonella agona (strain SL483) GN=araB PE=3 SV=1 21 513 6.0E-14
sp|Q0T8D4|ARAB_SHIF8 Ribulokinase OS=Shigella flexneri serotype 5b (strain 8401) GN=araB PE=3 SV=1 21 513 6.0E-14
sp|B5YZ99|ARAB_ECO5E Ribulokinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=araB PE=3 SV=1 21 513 1.0E-13
sp|P58541|ARAB_ECO57 Ribulokinase OS=Escherichia coli O157:H7 GN=araB PE=3 SV=2 21 513 1.0E-13
sp|Q87FK5|ARAB_VIBPA Ribulokinase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=araB PE=3 SV=1 19 513 2.0E-13
sp|B1LFZ7|ARAB_ECOSM Ribulokinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=araB PE=3 SV=1 21 513 2.0E-13
sp|B7N7T7|ARAB_ECOLU Ribulokinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=araB PE=3 SV=1 21 513 2.0E-13
sp|Q1RGD6|ARAB_ECOUT Ribulokinase OS=Escherichia coli (strain UTI89 / UPEC) GN=araB PE=3 SV=1 21 513 3.0E-13
sp|A1A7B0|ARAB_ECOK1 Ribulokinase OS=Escherichia coli O1:K1 / APEC GN=araB PE=3 SV=1 21 513 3.0E-13
sp|B7MAI6|ARAB_ECO45 Ribulokinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=araB PE=3 SV=1 21 513 3.0E-13
sp|B7LVT4|ARAB_ESCF3 Ribulokinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=araB PE=3 SV=1 21 513 3.0E-13
sp|B1IRB5|ARAB_ECOLC Ribulokinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=araB PE=3 SV=1 21 513 3.0E-13
sp|Q8FL88|ARAB_ECOL6 Ribulokinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=araB PE=3 SV=3 21 513 4.0E-13
sp|Q326H2|ARAB_SHIBS Ribulokinase OS=Shigella boydii serotype 4 (strain Sb227) GN=araB PE=3 SV=1 21 513 5.0E-13
sp|B7UIA9|ARAB_ECO27 Ribulokinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=araB PE=3 SV=1 21 513 5.0E-13
sp|Q83MG5|ARAB_SHIFL Ribulokinase OS=Shigella flexneri GN=araB PE=3 SV=3 21 513 5.0E-13
sp|B7NHG9|ARAB_ECO7I Ribulokinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=araB PE=3 SV=1 21 513 6.0E-13
sp|Q3Z5U8|ARAB_SHISS Ribulokinase OS=Shigella sonnei (strain Ss046) GN=araB PE=3 SV=1 21 513 6.0E-13
sp|B2U269|ARAB_SHIB3 Ribulokinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=araB PE=3 SV=1 21 513 8.0E-13
sp|A7ZW13|ARAB_ECOHS Ribulokinase OS=Escherichia coli O9:H4 (strain HS) GN=araB PE=3 SV=1 21 513 9.0E-13
sp|B7L4I4|ARAB_ECO55 Ribulokinase OS=Escherichia coli (strain 55989 / EAEC) GN=araB PE=3 SV=1 21 513 9.0E-13
sp|P08204|ARAB_ECOLI Ribulokinase OS=Escherichia coli (strain K12) GN=araB PE=1 SV=4 21 513 9.0E-13
sp|Q0TLS7|ARAB_ECOL5 Ribulokinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=araB PE=3 SV=1 21 513 1.0E-12
sp|B7MNS0|ARAB_ECO81 Ribulokinase OS=Escherichia coli O81 (strain ED1a) GN=araB PE=3 SV=1 21 513 1.0E-12
sp|C4ZPY6|ARAB_ECOBW Ribulokinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=araB PE=3 SV=1 21 513 1.0E-12
sp|B6HZ43|ARAB_ECOSE Ribulokinase OS=Escherichia coli (strain SE11) GN=araB PE=3 SV=1 21 513 1.0E-12
sp|B7M0F8|ARAB_ECO8A Ribulokinase OS=Escherichia coli O8 (strain IAI1) GN=araB PE=3 SV=1 21 513 1.0E-12
sp|A7ZHF4|ARAB_ECO24 Ribulokinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=araB PE=3 SV=1 21 513 1.0E-12
sp|Q32K30|ARAB_SHIDS Ribulokinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=araB PE=3 SV=1 21 513 2.0E-12
sp|P21939|XYLB_LACPE Xylulose kinase OS=Lactobacillus pentosus GN=xylB PE=3 SV=1 21 198 4.0E-12
sp|A1JJ57|LSRK_YERE8 Autoinducer-2 kinase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lsrK PE=3 SV=2 18 567 1.0E-11
sp|P39211|XYLB_BACSU Xylulose kinase OS=Bacillus subtilis (strain 168) GN=xylB PE=3 SV=2 17 292 1.0E-11
sp|B2VEQ9|ARAB_ERWT9 Ribulokinase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=araB PE=3 SV=1 21 513 2.0E-11
sp|Q4L607|GLPK_STAHJ Glycerol kinase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=glpK PE=3 SV=1 17 110 1.0E-10
sp|P35850|XYLB_LACBR Xylulose kinase OS=Lactobacillus brevis GN=xylB PE=2 SV=2 19 202 5.0E-10
sp|B5Y1Y0|ARAB_KLEP3 Ribulokinase OS=Klebsiella pneumoniae (strain 342) GN=araB PE=3 SV=1 21 513 7.0E-10
sp|Q2SSQ8|GLPK_MYCCT Glycerol kinase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=glpK PE=3 SV=1 15 173 1.0E-09
sp|A6T4K1|ARAB_KLEP7 Ribulokinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=araB PE=3 SV=1 21 513 1.0E-09
sp|A4WER6|LSRK_ENT38 Autoinducer-2 kinase OS=Enterobacter sp. (strain 638) GN=lsrK PE=3 SV=1 17 556 1.0E-09
sp|Q1CIX8|ARAB_YERPN Ribulokinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=araB PE=3 SV=1 21 513 2.0E-09
sp|Q1C7J2|ARAB_YERPA Ribulokinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=araB PE=3 SV=1 21 513 2.0E-09
sp|P58543|ARAB_YERPE Ribulokinase OS=Yersinia pestis GN=araB PE=3 SV=1 21 513 2.0E-09
sp|P44991|LYXK_HAEIN Probable L-xylulose kinase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lyx PE=3 SV=1 17 110 6.0E-09
sp|Q6MTY7|GLPK_MYCMS Glycerol kinase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=glpK PE=3 SV=1 19 173 6.0E-09
sp|A2SM29|GLPK_METPP Glycerol kinase OS=Methylibium petroleiphilum (strain PM1) GN=glpK PE=3 SV=1 17 173 7.0E-09
sp|P77432|LSRK_ECOLI Autoinducer-2 kinase OS=Escherichia coli (strain K12) GN=lsrK PE=1 SV=1 19 554 1.0E-08
sp|B1IRU9|LSRK_ECOLC Autoinducer-2 kinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=lsrK PE=3 SV=1 19 554 1.0E-08
sp|B1XE99|LSRK_ECODH Autoinducer-2 kinase OS=Escherichia coli (strain K12 / DH10B) GN=lsrK PE=3 SV=1 19 554 1.0E-08
sp|Q2YXR6|GLPK_STAAB Glycerol kinase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|A6TEC0|LSRK_KLEP7 Autoinducer-2 kinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lsrK PE=3 SV=1 17 556 1.0E-08
sp|Q8NWX7|GLPK_STAAW Glycerol kinase OS=Staphylococcus aureus (strain MW2) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|Q6G9R3|GLPK_STAAS Glycerol kinase OS=Staphylococcus aureus (strain MSSA476) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|Q6GHD5|GLPK_STAAR Glycerol kinase OS=Staphylococcus aureus (strain MRSA252) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|A8Z1X0|GLPK_STAAT Glycerol kinase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|A6QGJ8|GLPK_STAAE Glycerol kinase OS=Staphylococcus aureus (strain Newman) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|Q5HGD2|GLPK_STAAC Glycerol kinase OS=Staphylococcus aureus (strain COL) GN=glpK PE=1 SV=1 17 110 1.0E-08
sp|Q2FYZ5|GLPK_STAA8 Glycerol kinase OS=Staphylococcus aureus (strain NCTC 8325) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|Q2FHD9|GLPK_STAA3 Glycerol kinase OS=Staphylococcus aureus (strain USA300) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|B1JLP8|LSRK_YERPY Autoinducer-2 kinase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lsrK PE=3 SV=1 18 308 1.0E-08
sp|Q66EY7|LSRK_YERPS Autoinducer-2 kinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lsrK PE=3 SV=1 18 567 1.0E-08
sp|A4TQL2|LSRK_YERPP Autoinducer-2 kinase OS=Yersinia pestis (strain Pestoides F) GN=lsrK PE=3 SV=1 18 567 1.0E-08
sp|B2K3G3|LSRK_YERPB Autoinducer-2 kinase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lsrK PE=3 SV=1 18 567 1.0E-08
sp|A7FMJ5|LSRK_YERP3 Autoinducer-2 kinase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lsrK PE=3 SV=1 18 567 1.0E-08
sp|P99113|GLPK_STAAN Glycerol kinase OS=Staphylococcus aureus (strain N315) GN=glpK PE=1 SV=1 17 110 1.0E-08
sp|P63741|GLPK_STAAM Glycerol kinase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|A5ISI2|GLPK_STAA9 Glycerol kinase OS=Staphylococcus aureus (strain JH9) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|A6U1B8|GLPK_STAA2 Glycerol kinase OS=Staphylococcus aureus (strain JH1) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|A7X1U3|GLPK_STAA1 Glycerol kinase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=glpK PE=3 SV=1 17 110 1.0E-08
sp|A7ZLW9|LSRK_ECO24 Autoinducer-2 kinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lsrK PE=3 SV=1 19 554 1.0E-08
sp|Q1CN11|LSRK_YERPN Autoinducer-2 kinase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lsrK PE=3 SV=1 18 567 2.0E-08
sp|Q0WJP7|LSRK_YERPE Autoinducer-2 kinase OS=Yersinia pestis GN=lsrK PE=3 SV=1 18 567 2.0E-08
sp|Q1C142|LSRK_YERPA Autoinducer-2 kinase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lsrK PE=3 SV=1 18 567 2.0E-08
sp|A9R072|LSRK_YERPG Autoinducer-2 kinase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lsrK PE=3 SV=1 18 308 2.0E-08
sp|O34153|GLPK_ENTCA Glycerol kinase OS=Enterococcus casseliflavus GN=glpK PE=1 SV=3 18 172 2.0E-08
sp|Q66AF7|ARAB_YERPS Ribulokinase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=araB PE=3 SV=2 21 513 2.0E-08
sp|Q65M11|GLPK_BACLD Glycerol kinase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=glpK PE=3 SV=1 17 110 2.0E-08
sp|Q8CSS0|GLPK_STAES Glycerol kinase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=glpK PE=3 SV=1 17 110 2.0E-08
sp|Q5HPP1|GLPK_STAEQ Glycerol kinase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=glpK PE=3 SV=1 17 110 2.0E-08
sp|A7IJ56|GLPK_XANP2 Glycerol kinase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=glpK PE=3 SV=1 19 149 3.0E-08
sp|A6SUL1|GLPK_JANMA Glycerol kinase OS=Janthinobacterium sp. (strain Marseille) GN=glpK PE=3 SV=1 21 186 3.0E-08
sp|B3E6Z6|GLPK_GEOLS Glycerol kinase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=glpK PE=3 SV=1 17 137 3.0E-08
sp|A8A064|LSRK_ECOHS Autoinducer-2 kinase OS=Escherichia coli O9:H4 (strain HS) GN=lsrK PE=3 SV=1 19 554 4.0E-08
sp|P18157|GLPK_BACSU Glycerol kinase OS=Bacillus subtilis (strain 168) GN=glpK PE=1 SV=2 19 110 4.0E-08
sp|Q7N2E1|LSRK_PHOLL Autoinducer-2 kinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=lsrK PE=3 SV=1 19 561 4.0E-08
sp|Q88ZF1|GLPK1_LACPL Glycerol kinase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=glpK1 PE=3 SV=1 18 168 4.0E-08
sp|B9EBI8|GLPK_MACCJ Glycerol kinase OS=Macrococcus caseolyticus (strain JCSC5402) GN=glpK PE=3 SV=1 17 110 6.0E-08
sp|Q9WX53|GLPK_THEAQ Glycerol kinase OS=Thermus aquaticus GN=glpK PE=1 SV=1 17 110 6.0E-08
sp|O66131|GLPK_THETH Glycerol kinase OS=Thermus thermophilus GN=glpK PE=1 SV=1 19 110 6.0E-08
sp|B2A2C4|GLPK_NATTJ Glycerol kinase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=glpK PE=3 SV=1 18 172 7.0E-08
sp|O86033|GLPK_RHIME Glycerol kinase OS=Rhizobium meliloti (strain 1021) GN=glpK PE=1 SV=2 19 172 7.0E-08
sp|A0KAA1|GLPK_BURCH Glycerol kinase OS=Burkholderia cenocepacia (strain HI2424) GN=glpK PE=3 SV=1 18 173 7.0E-08
sp|B1JY43|GLPK_BURCC Glycerol kinase OS=Burkholderia cenocepacia (strain MC0-3) GN=glpK PE=3 SV=1 18 173 7.0E-08
sp|Q1BTT7|GLPK_BURCA Glycerol kinase OS=Burkholderia cenocepacia (strain AU 1054) GN=glpK PE=3 SV=1 18 173 7.0E-08
sp|Q1QVQ3|GLPK_CHRSD Glycerol kinase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=glpK PE=3 SV=1 19 173 7.0E-08
sp|B1YWB2|GLPK_BURA4 Glycerol kinase OS=Burkholderia ambifaria (strain MC40-6) GN=glpK PE=3 SV=1 18 173 8.0E-08
sp|A9AFH2|GLPK_BURM1 Glycerol kinase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=glpK PE=3 SV=1 18 173 8.0E-08
sp|Q0BC36|GLPK_BURCM Glycerol kinase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=glpK PE=3 SV=1 18 173 8.0E-08
sp|Q12GA2|GLPK_POLSJ Glycerol kinase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=glpK PE=3 SV=1 17 173 9.0E-08
sp|A4JHM8|GLPK_BURVG Glycerol kinase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=glpK PE=3 SV=1 18 173 9.0E-08
sp|A7Z2U3|GLPK_BACMF Glycerol kinase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=glpK PE=3 SV=1 19 110 1.0E-07
sp|B1LFA4|LSRK_ECOSM Autoinducer-2 kinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lsrK PE=3 SV=1 19 554 1.0E-07
sp|Q7P1G2|GLPK_CHRVO Glycerol kinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=glpK PE=3 SV=1 18 173 1.0E-07
sp|C5C1C4|GLPK_BEUC1 Glycerol kinase OS=Beutenbergia cavernae (strain ATCC BAA-8 / DSM 12333 / NBRC 16432) GN=glpK PE=3 SV=1 18 172 2.0E-07
sp|Q5L091|GLPK_GEOKA Glycerol kinase OS=Geobacillus kaustophilus (strain HTA426) GN=glpK PE=3 SV=1 17 110 2.0E-07
sp|P57928|LYXK_PASMU Probable L-xylulose kinase OS=Pasteurella multocida (strain Pm70) GN=lyx PE=3 SV=1 17 110 2.0E-07
sp|C6E1L8|GLPK_GEOSM Glycerol kinase OS=Geobacter sp. (strain M21) GN=glpK PE=3 SV=1 17 142 3.0E-07
sp|Q03DS8|GLPK_PEDPA Glycerol kinase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=glpK PE=3 SV=1 18 110 5.0E-07
sp|D4GYI5|GLPK_HALVD Glycerol kinase OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=glpK PE=2 SV=1 20 187 6.0E-07
sp|Q1WVJ0|GLPK_LACS1 Glycerol kinase OS=Lactobacillus salivarius (strain UCC118) GN=glpK PE=3 SV=1 18 110 6.0E-07
sp|Q2RST6|GLPK_RHORT Glycerol kinase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=glpK PE=3 SV=1 21 173 8.0E-07
sp|Q9V207|GLPK_PYRAB Glycerol kinase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=glpK PE=3 SV=2 19 173 8.0E-07
sp|O66746|GLPK_AQUAE Glycerol kinase OS=Aquifex aeolicus (strain VF5) GN=glpK PE=3 SV=1 416 569 8.0E-07
sp|Q9CFG8|XYLB_LACLA Xylulose kinase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=xylB PE=3 SV=1 17 181 1.0E-06
sp|Q5V4I4|GLPK_HALMA Glycerol kinase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=glpK PE=3 SV=1 18 185 1.0E-06
sp|C5CSQ9|GLPK_VARPS Glycerol kinase OS=Variovorax paradoxus (strain S110) GN=glpK PE=3 SV=1 17 173 1.0E-06
sp|A1TJR8|GLPK_ACIAC Glycerol kinase OS=Acidovorax citrulli (strain AAC00-1) GN=glpK PE=3 SV=1 17 173 1.0E-06
sp|A8GE05|ARAB_SERP5 Ribulokinase OS=Serratia proteamaculans (strain 568) GN=araB PE=3 SV=1 87 478 1.0E-06
sp|Q4J7A3|GLPK2_SULAC Glycerol kinase 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=glpK2 PE=3 SV=1 19 173 1.0E-06
sp|B0CB70|GLPK_ACAM1 Glycerol kinase OS=Acaryochloris marina (strain MBIC 11017) GN=glpK PE=3 SV=1 421 568 1.0E-06
sp|Q8ENK7|GLPK_OCEIH Glycerol kinase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=glpK PE=3 SV=1 21 110 1.0E-06
sp|Q8XAY5|LSRK_ECO57 Autoinducer-2 kinase OS=Escherichia coli O157:H7 GN=lsrK PE=3 SV=1 19 554 2.0E-06
sp|Q9X1E4|GLPK2_THEMA Glycerol kinase 2 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=glpK2 PE=3 SV=2 17 110 2.0E-06
sp|B2JD95|GLPK_BURP8 Glycerol kinase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=glpK PE=3 SV=1 18 133 2.0E-06
sp|A1K962|GLPK_AZOSB Glycerol kinase OS=Azoarcus sp. (strain BH72) GN=glpK PE=3 SV=1 17 173 2.0E-06
sp|Q63X50|GLPK_BURPS Glycerol kinase OS=Burkholderia pseudomallei (strain K96243) GN=glpK PE=3 SV=1 18 133 2.0E-06
sp|B0TWZ7|GLPK_FRAP2 Glycerol kinase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=glpK PE=3 SV=1 21 172 2.0E-06
sp|Q2T0Z3|GLPK_BURTA Glycerol kinase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=glpK PE=3 SV=1 18 133 2.0E-06
sp|B2SYH7|GLPK_BURPP Glycerol kinase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=glpK PE=3 SV=1 18 133 3.0E-06
sp|Q57HE4|LSRK_SALCH Autoinducer-2 kinase OS=Salmonella choleraesuis (strain SC-B67) GN=lsrK PE=3 SV=1 19 535 3.0E-06
sp|Q13UE3|GLPK_BURXL Glycerol kinase OS=Burkholderia xenovorans (strain LB400) GN=glpK PE=3 SV=1 18 133 3.0E-06
sp|Q8ZKQ6|LSRK_SALTY Autoinducer-2 kinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lsrK PE=1 SV=1 19 535 3.0E-06
sp|A9MZF8|LSRK_SALPB Autoinducer-2 kinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lsrK PE=3 SV=1 19 535 4.0E-06
sp|B5EB79|GLPK_GEOBB Glycerol kinase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=glpK PE=3 SV=1 17 142 4.0E-06
sp|Q8Z2X3|LSRK_SALTI Autoinducer-2 kinase OS=Salmonella typhi GN=lsrK PE=3 SV=1 19 535 4.0E-06
sp|Q0VRN6|GLPK_ALCBS Glycerol kinase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=glpK PE=3 SV=1 17 173 4.0E-06
sp|Q1IMB2|GLPK_KORVE Glycerol kinase OS=Koribacter versatilis (strain Ellin345) GN=glpK PE=3 SV=1 17 173 4.0E-06
sp|Q5E0Z0|GLPK_VIBF1 Glycerol kinase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=glpK PE=3 SV=1 432 594 5.0E-06
sp|Q5PJE9|LSRK_SALPA Autoinducer-2 kinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lsrK PE=3 SV=1 19 535 5.0E-06
sp|B2UF87|GLPK_RALPJ Glycerol kinase OS=Ralstonia pickettii (strain 12J) GN=glpK PE=3 SV=1 17 172 5.0E-06
sp|Q10Y19|GLPK_TRIEI Glycerol kinase OS=Trichodesmium erythraeum (strain IMS101) GN=glpK PE=3 SV=1 421 558 6.0E-06
sp|Q316D5|GLPK_DESAG Glycerol kinase OS=Desulfovibrio alaskensis (strain G20) GN=glpK PE=3 SV=1 19 173 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016773 phosphotransferase activity, alcohol group as acceptor Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0003674 molecular_function No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0071704 organic substance metabolic process No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4064
MHHAFKAIKAMEPPNVLDHYIGVDVGTGSARACIIDQTGDIKALASRDIRLWQPETGYYEQSTTDIWNCVCECVR
RVVSESGVNAANIKGIGFDATCSLAVFSRDTDEPISVTGPDFKRESHDRNVILWLDHRPVAETRTVNATNHPLLK
YVGGKMSIEMEIPKVLWLKNNMPPELFARCKFYDLADALTHLATGSEARSYCSTVCKQGFVPVGVDGSVRGWQKD
FYEAVGLADLVEGDFERMGGVHNLNGTFHSAGDLVGTLSRQAAQQLGLPENVAVGSGVIDAYAGWVGTVGAKVHL
GQDELTAGVPLNDVSQAFTRLAAVAGTSTCHLAMSEAPVLVPGVWGPYRDVLLPGFWMAEGGQSATGELLRHVLD
IHPAYNETCALAKAEDKHVYDFLNTHLEFMAEKRGVRSVPYLARHLFFYGDLWGNRSPIADADMKGAVVGLDSDK
STDNMALWYYATMEFIAMQTRQIIDQMNRSGHAISSIFMSGSQCQNAVLMSLMATTCGMPVLIPRYVHAAVVHGA
AMLGAKAAVGHESLWSIMDRMSKPGRLVQPNGDEADKALLDAKYAVFLEMCSAQQTYRQRVDKAVEAWA*
Coding >Ophun1|4064
ATGCACCACGCATTCAAGGCCATCAAGGCCATGGAGCCGCCCAATGTGTTGGACCATTATATTGGTGTTGATGTT
GGGACGGGGTCGGCGAGGGCTTGCATCATTGACCAGACGGGCGATATCAAGGCTTTGGCCTCGCGGGATATCAGG
CTCTGGCAGCCGGAGACGGGCTACTACGAACAATCGACGACGGACATCTGGAACTGCGTGTGCGAATGCGTCCGC
CGCGTCGTCAGCGAGTCGGGCGTCAACGCTGCCAACATCAAGGGCATAGGCTTCGACGCCACCTGCTCCCTCGCC
GTCTTCTCCCGCGACACCGACGAGCCCATCTCCGTAACGGGCCCGGACTTCAAGAGAGAGAGCCACGACCGCAAC
GTCATCCTCTGGCTCGACCACCGCCCCGTCGCCGAGACCCGCACCGTCAACGCTACGAACCACCCGCTGCTCAAG
TACGTGGGCGGCAAGATGAGCATCGAGATGGAGATCCCCAAGGTGCTGTGGCTCAAGAACAATATGCCGCCGGAG
CTCTTCGCCCGCTGCAAGTTCTACGATCTTGCCGACGCCTTGACCCATCTGGCTACCGGGTCCGAGGCTCGTAGC
TACTGCAGTACCGTCTGTAAGCAGGGGTTTGTGCCTGTCGGGGTGGATGGGAGTGTTAGGGGTTGGCAGAAGGAC
TTTTATGAGGCGGTTGGTTTGGCGGATTTGGTCGAGGGGGACTTTGAGCGCATGGGGGGCGTCCACAACTTGAAC
GGCACGTTTCATAGCGCCGGAGACCTCGTCGGTACCCTCAGTCGTCAGGCCGCCCAGCAGCTCGGCCTCCCCGAA
AACGTAGCCGTGGGCAGCGGCGTCATCGACGCATACGCCGGCTGGGTCGGCACCGTCGGCGCAAAGGTCCATCTC
GGACAGGACGAGCTGACGGCGGGCGTCCCGCTCAACGACGTATCGCAGGCCTTTACCCGTCTGGCTGCCGTGGCT
GGCACCTCGACCTGTCACCTCGCCATGTCCGAGGCTCCCGTCCTGGTGCCGGGCGTCTGGGGGCCGTACCGCGAT
GTCTTGCTTCCGGGATTCTGGATGGCTGAGGGCGGGCAGTCGGCTACGGGGGAGCTGCTGCGCCACGTGCTGGAT
ATCCATCCGGCTTACAACGAGACGTGCGCGCTGGCCAAGGCTGAGGATAAGCATGTCTATGATTTCCTCAACACT
CACCTTGAGTTCATGGCCGAGAAGCGTGGGGTCCGCAGCGTGCCGTATCTGGCGCGTCATCTGTTCTTCTACGGC
GACCTCTGGGGGAACCGGTCGCCTATTGCCGATGCCGATATGAAGGGCGCCGTCGTCGGTCTCGACAGCGATAAG
AGCACCGACAACATGGCCTTGTGGTATTACGCCACCATGGAGTTCATCGCCATGCAGACGCGACAGATCATCGAC
CAGATGAACCGCTCGGGCCACGCCATCTCATCCATCTTCATGTCCGGCTCGCAGTGTCAGAACGCGGTCCTCATG
AGCCTCATGGCCACCACCTGCGGCATGCCCGTTCTGATCCCGCGATACGTCCACGCTGCTGTCGTTCACGGGGCT
GCCATGCTGGGCGCAAAGGCTGCCGTCGGCCACGAGTCTCTGTGGAGTATCATGGATCGCATGAGCAAGCCGGGT
AGGCTGGTTCAGCCGAATGGTGATGAGGCTGACAAGGCGTTGCTCGATGCAAAGTATGCTGTTTTTCTCGAGATG
TGCTCCGCTCAGCAGACGTATCGACAAAGGGTGGACAAGGCGGTCGAGGCTTGGGCTTAG
Transcript >Ophun1|4064
ATGCACCACGCATTCAAGGCCATCAAGGCCATGGAGCCGCCCAATGTGTTGGACCATTATATTGGTGTTGATGTT
GGGACGGGGTCGGCGAGGGCTTGCATCATTGACCAGACGGGCGATATCAAGGCTTTGGCCTCGCGGGATATCAGG
CTCTGGCAGCCGGAGACGGGCTACTACGAACAATCGACGACGGACATCTGGAACTGCGTGTGCGAATGCGTCCGC
CGCGTCGTCAGCGAGTCGGGCGTCAACGCTGCCAACATCAAGGGCATAGGCTTCGACGCCACCTGCTCCCTCGCC
GTCTTCTCCCGCGACACCGACGAGCCCATCTCCGTAACGGGCCCGGACTTCAAGAGAGAGAGCCACGACCGCAAC
GTCATCCTCTGGCTCGACCACCGCCCCGTCGCCGAGACCCGCACCGTCAACGCTACGAACCACCCGCTGCTCAAG
TACGTGGGCGGCAAGATGAGCATCGAGATGGAGATCCCCAAGGTGCTGTGGCTCAAGAACAATATGCCGCCGGAG
CTCTTCGCCCGCTGCAAGTTCTACGATCTTGCCGACGCCTTGACCCATCTGGCTACCGGGTCCGAGGCTCGTAGC
TACTGCAGTACCGTCTGTAAGCAGGGGTTTGTGCCTGTCGGGGTGGATGGGAGTGTTAGGGGTTGGCAGAAGGAC
TTTTATGAGGCGGTTGGTTTGGCGGATTTGGTCGAGGGGGACTTTGAGCGCATGGGGGGCGTCCACAACTTGAAC
GGCACGTTTCATAGCGCCGGAGACCTCGTCGGTACCCTCAGTCGTCAGGCCGCCCAGCAGCTCGGCCTCCCCGAA
AACGTAGCCGTGGGCAGCGGCGTCATCGACGCATACGCCGGCTGGGTCGGCACCGTCGGCGCAAAGGTCCATCTC
GGACAGGACGAGCTGACGGCGGGCGTCCCGCTCAACGACGTATCGCAGGCCTTTACCCGTCTGGCTGCCGTGGCT
GGCACCTCGACCTGTCACCTCGCCATGTCCGAGGCTCCCGTCCTGGTGCCGGGCGTCTGGGGGCCGTACCGCGAT
GTCTTGCTTCCGGGATTCTGGATGGCTGAGGGCGGGCAGTCGGCTACGGGGGAGCTGCTGCGCCACGTGCTGGAT
ATCCATCCGGCTTACAACGAGACGTGCGCGCTGGCCAAGGCTGAGGATAAGCATGTCTATGATTTCCTCAACACT
CACCTTGAGTTCATGGCCGAGAAGCGTGGGGTCCGCAGCGTGCCGTATCTGGCGCGTCATCTGTTCTTCTACGGC
GACCTCTGGGGGAACCGGTCGCCTATTGCCGATGCCGATATGAAGGGCGCCGTCGTCGGTCTCGACAGCGATAAG
AGCACCGACAACATGGCCTTGTGGTATTACGCCACCATGGAGTTCATCGCCATGCAGACGCGACAGATCATCGAC
CAGATGAACCGCTCGGGCCACGCCATCTCATCCATCTTCATGTCCGGCTCGCAGTGTCAGAACGCGGTCCTCATG
AGCCTCATGGCCACCACCTGCGGCATGCCCGTTCTGATCCCGCGATACGTCCACGCTGCTGTCGTTCACGGGGCT
GCCATGCTGGGCGCAAAGGCTGCCGTCGGCCACGAGTCTCTGTGGAGTATCATGGATCGCATGAGCAAGCCGGGT
AGGCTGGTTCAGCCGAATGGTGATGAGGCTGACAAGGCGTTGCTCGATGCAAAGTATGCTGTTTTTCTCGAGATG
TGCTCCGCTCAGCAGACGTATCGACAAAGGGTGGACAAGGCGGTCGAGGCTTGGGCTTAG
Gene >Ophun1|4064
ATGCACCACGCATTCAAGGCCATCAAGGCCATGGAGTGAGTCGCTGCCTCTTATTGATACCTGTTTGATCTGCGC
CGTTTTGCTGGGATTCCGCCATGGCGAATTTCGAAGGCTCGATGCCGGCTGACGACCTGTCGTCTCTGAACAGGC
CGCCCAATGTGTTGGTGGGTGTTCCGTACCAGGTTTTACTGGTTGCTTGATGGCTGATGCTCTGGAAGGACCATT
ATATTGGTGTTGATGTTGGGACGGGGTCGGCGAGGGCTTGCATCATTGACCAGACGGGCGATATCAAGGCTTTGG
CCTCGCGGGATATCAGGCTCTGGCAGCCGGAGACGGGCTACTACGTACGACTCTCTTATACCCCGTGATACGAAT
GCACATACATCTATATCAAACGAAGCTCACAAAGTCTACAGGAACAATCGACGACGGACATCTGGAACTGCGTGT
GCGAATGCGTCCGCCGCGTCGTCAGCGAGTCGGGCGTCAACGCTGCCAACATCAAGGGCATAGGCTTCGACGCCA
CCTGCTCCCTCGCCGTCTTCTCCCGCGACACCGACGAGCCCATCTCCGTAACGGGCCCGGACTTCAAGAGAGAGA
GCCACGACCGCAACGTCATCCTCTGGCTCGACCACCGCCCCGTCGCCGAGACCCGCACCGTCAACGCTACGAACC
ACCCGCTGCTCAAGTACGTGGGCGGCAAGATGAGCATCGAGATGGAGATCCCCAAGGTGCTGTGGCTCAAGAACA
ATATGCCGCCGGAGCTCTTCGCCCGCTGCAAGTTCTACGATCTTGCCGACGCCTTGACCCATCTGGCTACCGGGT
CCGAGGCTCGTAGCTACTGCAGTACCGTCTGTAAGCAGGGGTTTGTGCCTGTCGGGGTGGATGGGAGTGTTAGGG
GTTGGCAGAAGGACTTTTATGAGGCGGTTGGTTTGGCGGATTTGGTCGAGGGGGACTTTGAGCGCATGGGGGGCG
TCCACAACTTGGTAACCACCGTGCCTGACCCTTTTCTCTTTTGTTTTCTTCTCTTGTTCCTCTGATGATCTGCTG
ACGATGTGGTAGAACGGCACGTTTCATAGCGCCGGAGACCTCGTCGGTACCCTCAGTCGTCAGGCCGCCCAGCAG
CTCGGCCTCCCCGAAAACGTAGCCGTGGGCAGCGGCGTCATCGACGCATACGCCGGCTGGGTCGGCACCGTCGGC
GCAAAGGTCCATCTCGGACAGGACGAGCTGACGGCGGGCGTCCCGCTCAACGACGTATCGCAGGCCTTTACCCGT
CTGGCTGCCGTGGCTGGCACCTCGACCTGTCACCTCGCCATGTCCGAGGCTCCCGTCCTGGTGCCGGGCGTCTGG
GGGCCGTACCGCGATGTCTTGCTTCCGGGATTCTGGATGGCTGAGGGCGGGCAGTCGGCTACGGGGGAGCTGCTG
CGCCACGTGCTGGATATCCATCCGGCTTACAACGAGACGTGCGCGCTGGCCAAGGCTGAGGATAAGCATGTCTAT
GATTTCCTCAACACTCACCTTGAGTTCATGGCCGAGAAGCGTGGGGTCCGCAGCGTGCCGTATCTGGCGCGTCAT
CTGTTCTTCTACGGCGACCTCTGGGGGAACCGGTCGCCTATTGCCGATGCCGATATGAAGGGCGCCGTCGTCGGT
CTCGACAGCGATAAGAGCACCGACAACATGGCCTTGTGGTATTACGCCACCATGGAGTTCATCGCCATGCAGACG
CGACAGATCATCGACCAGATGAACCGCTCGGGCCACGCCATCTCATCCATCTTCATGTCCGGCTCGCAGTGTCAG
AACGCGGTCCTCATGAGCCTCATGGCCACCACCTGCGGCATGCCCGTTCTGATCCCGCGATACGTCCACGCTGCT
GTCGTTCACGGGGCTGCCATGCTGGGCGCAAAGGCTGCCGTCGGCCACGAGTCTCTGTGGAGTATCATGGATCGC
ATGAGCAAGCCGGGTAGGCTGGTTCAGCCGAATGGTGATGAGGCTGACAAGGCGTTGCTCGATGCAAAGTATGCT
GTTTTTCTCGAGATGTGCTCCGCTCAGCAGACGTATCGACAAAGGGTGGACAAGGCGGTCGAGGCTTGGGCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail