Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4060
Gene name
LocationContig_37:45462..49995
Strand-
Gene length (bp)4533
Transcript length (bp)4365
Coding sequence length (bp)4365
Protein length (aa) 1455

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04997 RNA_pol_Rpb1_1 RNA polymerase Rpb1, domain 1 2.3E-83 19 365
PF04998 RNA_pol_Rpb1_5 RNA polymerase Rpb1, domain 5 2.3E-77 852 1370
PF00623 RNA_pol_Rpb1_2 RNA polymerase Rpb1, domain 2 3.7E-71 367 536
PF04983 RNA_pol_Rpb1_3 RNA polymerase Rpb1, domain 3 7.1E-34 539 714
PF05000 RNA_pol_Rpb1_4 RNA polymerase Rpb1, domain 4 8.1E-30 739 845

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P04051|RPC1_YEAST DNA-directed RNA polymerase III subunit RPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO31 PE=1 SV=1 9 1437 0.0E+00
sp|Q6BI69|RPC1_DEBHA DNA-directed RNA polymerase III subunit RPC1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPC1 PE=3 SV=2 9 1437 0.0E+00
sp|O94666|RPC1_SCHPO DNA-directed RNA polymerase III subunit rpc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc1 PE=2 SV=1 9 1437 0.0E+00
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 15 1421 0.0E+00
sp|A4IF62|RPC1_BOVIN DNA-directed RNA polymerase III subunit RPC1 OS=Bos taurus GN=POLR3A PE=2 SV=1 9 1437 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P04051|RPC1_YEAST DNA-directed RNA polymerase III subunit RPC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO31 PE=1 SV=1 9 1437 0.0E+00
sp|Q6BI69|RPC1_DEBHA DNA-directed RNA polymerase III subunit RPC1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RPC1 PE=3 SV=2 9 1437 0.0E+00
sp|O94666|RPC1_SCHPO DNA-directed RNA polymerase III subunit rpc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc1 PE=2 SV=1 9 1437 0.0E+00
sp|Q86AQ5|RPC1_DICDI DNA-directed RNA polymerase III subunit rpc1 OS=Dictyostelium discoideum GN=polr3a PE=3 SV=1 15 1421 0.0E+00
sp|A4IF62|RPC1_BOVIN DNA-directed RNA polymerase III subunit RPC1 OS=Bos taurus GN=POLR3A PE=2 SV=1 9 1437 0.0E+00
sp|Q5ZL98|RPC1_CHICK DNA-directed RNA polymerase III subunit RPC1 OS=Gallus gallus GN=POLR3A PE=2 SV=1 9 1438 0.0E+00
sp|O14802|RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens GN=POLR3A PE=1 SV=2 9 1437 0.0E+00
sp|F4JXF9|NRPC1_ARATH DNA-directed RNA polymerase III subunit 1 OS=Arabidopsis thaliana GN=NRPC1 PE=2 SV=1 10 1421 0.0E+00
sp|P35084|RPB1_DICDI DNA-directed RNA polymerase II subunit rpb1 OS=Dictyostelium discoideum GN=polr2a PE=2 SV=2 19 1418 0.0E+00
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 4 936 0.0E+00
sp|P18616|NRPB1_ARATH DNA-directed RNA polymerase II subunit 1 OS=Arabidopsis thaliana GN=NRPB1 PE=1 SV=3 20 1414 0.0E+00
sp|P16356|RPB1_CAEEL DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis elegans GN=ama-1 PE=1 SV=3 24 1419 0.0E+00
sp|P35074|RPB1_CAEBR DNA-directed RNA polymerase II subunit RPB1 OS=Caenorhabditis briggsae GN=rpb-1 PE=3 SV=2 24 1419 0.0E+00
sp|Q75A34|RPB1_ASHGO DNA-directed RNA polymerase II subunit RPB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPB1 PE=3 SV=2 19 1419 0.0E+00
sp|P04050|RPB1_YEAST DNA-directed RNA polymerase II subunit RPB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPO21 PE=1 SV=2 19 1419 0.0E+00
sp|P11512|RPOA1_SULAC DNA-directed RNA polymerase subunit A' OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoA1 PE=3 SV=2 19 921 0.0E+00
sp|Q980R2|RPOA1_SULSO DNA-directed RNA polymerase subunit A' OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoA1 PE=1 SV=1 19 921 0.0E+00
sp|Q8SSC4|RPB1_ENCCU DNA-directed RNA polymerase II subunit RPB1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RPB1 PE=3 SV=1 16 1419 0.0E+00
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 448 1420 0.0E+00
sp|P31813|RPOA1_THECE DNA-directed RNA polymerase subunit A' OS=Thermococcus celer GN=rpoA1 PE=3 SV=1 17 921 0.0E+00
sp|P41556|RPOA1_METVS DNA-directed RNA polymerase subunit A' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoA1 PE=3 SV=1 17 920 0.0E+00
sp|O27125|RPOA1_METTH DNA-directed RNA polymerase subunit A' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoA1 PE=3 SV=1 19 920 0.0E+00
sp|P17545|RPB1B_TRYBB DNA-directed RNA polymerase II subunit RPB1-B OS=Trypanosoma brucei brucei GN=TRP5.9 PE=1 SV=1 75 1419 0.0E+00
sp|P17546|RPB1A_TRYBB DNA-directed RNA polymerase II subunit RPB1-A OS=Trypanosoma brucei brucei GN=TRP4.8 PE=1 SV=1 75 1419 0.0E+00
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 19 937 0.0E+00
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 19 937 0.0E+00
sp|P0CX02|RPOA1_HALSA DNA-directed RNA polymerase subunit A' OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpoA1 PE=3 SV=1 16 928 0.0E+00
sp|B0R8D4|RPOA1_HALS3 DNA-directed RNA polymerase subunit A' OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpoA1 PE=1 SV=1 16 928 0.0E+00
sp|P36594|RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb1 PE=1 SV=1 19 924 0.0E+00
sp|Q03585|RPOA1_THEAC DNA-directed RNA polymerase subunit A' OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoA1 PE=3 SV=1 17 920 3.0E-175
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 19 918 5.0E-174
sp|P09846|RPOA1_METTW DNA-directed RNA polymerase subunit A' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoA1 PE=3 SV=2 19 920 9.0E-169
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 433 938 5.0E-158
sp|Q7T6X5|RPO1_MIMIV DNA-directed RNA polymerase subunit 1 OS=Acanthamoeba polyphaga mimivirus GN=RPO1 PE=1 SV=2 24 1419 7.0E-158
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 22 1158 5.0E-135
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 258 1154 3.0E-125
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 257 1154 3.0E-119
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 314 1158 7.0E-113
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 162 1173 9.0E-111
sp|Q196X0|RPB1_IIV3 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 3 GN=IIV3-090L PE=3 SV=1 24 1442 2.0E-106
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 19 919 2.0E-102
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 19 614 2.0E-97
sp|Q58445|RPOA1_METJA DNA-directed RNA polymerase subunit A' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoA1 PE=3 SV=2 16 504 2.0E-95
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 320 919 3.0E-95
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 19 571 5.0E-95
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 305 919 3.0E-92
sp|P28364|RPB1_EUPOC DNA-directed RNA polymerase II subunit RPB1 (Fragment) OS=Euplotes octocarinatus GN=RPB1 PE=3 SV=1 19 513 6.0E-89
sp|A5DCV3|RPB1_PICGU DNA-directed RNA polymerase II subunit RPB1 (Fragments) OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RPB1 PE=3 SV=2 791 1419 5.0E-88
sp|P42486|RPB1_ASFB7 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-99 PE=3 SV=1 23 1413 3.0E-87
sp|O55766|RPB1_IIV6 Probable DNA-directed RNA polymerase II subunit RPB1 homolog OS=Invertebrate iridescent virus 6 GN=IIV6-176R PE=3 SV=1 19 934 1.0E-86
sp|Q65215|RPB1_ASFM2 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-107 PE=3 SV=2 23 1413 2.0E-86
sp|P0C989|RPB1_ASFK5 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-111 PE=3 SV=1 23 1413 2.0E-86
sp|P0C987|RPB1_ASFP4 Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-111 PE=3 SV=1 23 1413 3.0E-86
sp|P0C988|RPB1_ASFWA Probable DNA-directed RNA polymerase subunit 1 homolog OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-109 PE=3 SV=1 23 1413 3.0E-85
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 254 920 3.0E-85
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 9 433 9.0E-85
sp|Q58445|RPOA1_METJA DNA-directed RNA polymerase subunit A' OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpoA1 PE=3 SV=2 504 921 7.0E-80
sp|Q6GZW7|RPB1_FRG3G Putative DNA-directed RNA polymerase 008R OS=Frog virus 3 (isolate Goorha) GN=FV3-008R PE=3 SV=1 20 1119 6.0E-76
sp|P08968|RPC1_TRYBB DNA-directed RNA polymerase III subunit RPC1 OS=Trypanosoma brucei brucei PE=3 SV=1 1054 1432 2.0E-58
sp|P15349|RPOA1_HALMO DNA-directed RNA polymerase subunit A' (Fragment) OS=Halococcus morrhuae GN=rpoA1 PE=3 SV=1 649 926 3.0E-55
sp|B1YGU3|RPOC_EXIS2 DNA-directed RNA polymerase subunit beta' OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpoC PE=3 SV=1 204 919 2.0E-53
sp|O28390|RPOA2_ARCFU DNA-directed RNA polymerase subunit A'' OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpoA2 PE=3 SV=1 1049 1423 1.0E-52
sp|A7GK13|RPOC_BACCN DNA-directed RNA polymerase subunit beta' OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpoC PE=3 SV=1 258 899 3.0E-52
sp|B6YT17|RPOA2_THEON DNA-directed RNA polymerase subunit A'' OS=Thermococcus onnurineus (strain NA1) GN=rpoA2 PE=3 SV=1 1020 1426 2.0E-51
sp|Q5WLR9|RPOC_BACSK DNA-directed RNA polymerase subunit beta' OS=Bacillus clausii (strain KSM-K16) GN=rpoC PE=3 SV=1 259 919 3.0E-51
sp|C5A207|RPOA2_THEGJ DNA-directed RNA polymerase subunit A'' OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpoA2 PE=3 SV=1 1041 1426 5.0E-51
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 645 918 8.0E-51
sp|Q8ETY7|RPOC_OCEIH DNA-directed RNA polymerase subunit beta' OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoC PE=3 SV=1 262 921 8.0E-51
sp|P77819|RPOC_BACAN DNA-directed RNA polymerase subunit beta' OS=Bacillus anthracis GN=rpoC PE=3 SV=3 259 899 8.0E-51
sp|A9VP70|RPOC_BACWK DNA-directed RNA polymerase subunit beta' OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpoC PE=3 SV=1 259 899 9.0E-51
sp|Q82Z41|RPOC_ENTFA DNA-directed RNA polymerase subunit beta' OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoC PE=3 SV=1 258 922 9.0E-51
sp|Q9Z9M1|RPOC_BACHD DNA-directed RNA polymerase subunit beta' OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoC PE=3 SV=1 259 899 1.0E-50
sp|A8AZI2|RPOC_STRGC DNA-directed RNA polymerase subunit beta' OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoC PE=3 SV=1 258 922 4.0E-50
sp|A3CKD4|RPOC_STRSV DNA-directed RNA polymerase subunit beta' OS=Streptococcus sanguinis (strain SK36) GN=rpoC PE=3 SV=1 258 922 4.0E-50
sp|Q8U0M5|RPOA2_PYRFU DNA-directed RNA polymerase subunit A'' OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpoA2 PE=1 SV=1 1045 1426 5.0E-50
sp|B9KBJ4|RPOC_THENN DNA-directed RNA polymerase subunit beta' OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpoC PE=3 SV=1 258 1112 6.0E-50
sp|Q9V113|RPOA2_PYRAB DNA-directed RNA polymerase subunit A'' OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpoA2 PE=3 SV=1 1045 1426 6.0E-50
sp|Q8E238|RPOC_STRA5 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoC PE=3 SV=1 258 899 7.0E-50
sp|Q8E7J7|RPOC_STRA3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoC PE=3 SV=1 258 899 7.0E-50
sp|Q3K3L1|RPOC_STRA1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoC PE=3 SV=1 258 899 7.0E-50
sp|Q81J47|RPOC_BACCR DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpoC PE=3 SV=1 259 899 8.0E-50
sp|Q73FA3|RPOC_BACC1 DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpoC PE=3 SV=1 259 899 9.0E-50
sp|Q65PB4|RPOC_BACLD DNA-directed RNA polymerase subunit beta' OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoC PE=3 SV=1 258 899 1.0E-49
sp|Q63H97|RPOC_BACCZ DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ZK / E33L) GN=rpoC PE=3 SV=1 259 899 1.0E-49
sp|O93777|RPOA2_PYRHO DNA-directed RNA polymerase subunit A'' OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpoA2 PE=3 SV=1 1045 1426 1.0E-49
sp|Q6HPR5|RPOC_BACHK DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpoC PE=3 SV=1 259 899 1.0E-49
sp|A0R8H3|RPOC_BACAH DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis (strain Al Hakam) GN=rpoC PE=3 SV=1 259 899 1.0E-49
sp|P36252|RPOC_THEMA DNA-directed RNA polymerase subunit beta' OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpoC PE=3 SV=1 258 1112 1.0E-49
sp|P77882|RPOC_LISGR DNA-directed RNA polymerase subunit beta' (Fragment) OS=Listeria grayi GN=rpoC PE=3 SV=2 259 940 2.0E-49
sp|Q976A6|RPOA2_SULTO DNA-directed RNA polymerase subunit A'' OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpoA2 PE=3 SV=2 1035 1425 2.0E-49
sp|Q5L404|RPOC_GEOKA DNA-directed RNA polymerase subunit beta' OS=Geobacillus kaustophilus (strain HTA426) GN=rpoC PE=3 SV=1 259 899 2.0E-49
sp|A7Z0N0|RPOC_BACMF DNA-directed RNA polymerase subunit beta' OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoC PE=3 SV=1 258 899 2.0E-49
sp|A4XI31|RPOC_CALS8 DNA-directed RNA polymerase subunit beta' OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoC PE=3 SV=2 218 922 3.0E-49
sp|P29158|RPOA2_THECE DNA-directed RNA polymerase subunit A'' OS=Thermococcus celer GN=rpoA2 PE=3 SV=2 1020 1426 4.0E-49
sp|B1L934|RPOC_THESQ DNA-directed RNA polymerase subunit beta' OS=Thermotoga sp. (strain RQ2) GN=rpoC PE=3 SV=1 258 1102 5.0E-49
sp|A4IJI2|RPOC_GEOTN DNA-directed RNA polymerase subunit beta' OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoC PE=3 SV=2 259 899 5.0E-49
sp|A8F977|RPOC_BACP2 DNA-directed RNA polymerase subunit beta' OS=Bacillus pumilus (strain SAFR-032) GN=rpoC PE=3 SV=1 258 899 6.0E-49
sp|Q724E9|RPOC_LISMF DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoC PE=3 SV=1 259 946 6.0E-49
sp|P77879|RPOC_LISIN DNA-directed RNA polymerase subunit beta' OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoC PE=3 SV=3 259 946 6.0E-49
sp|Q9CEN7|RPOC_LACLA DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoC PE=3 SV=2 20 921 7.0E-49
sp|A5IJW2|RPOC_THEP1 DNA-directed RNA polymerase subunit beta' OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpoC PE=3 SV=1 258 1102 1.0E-48
sp|Q8DS47|RPOC_STRMU DNA-directed RNA polymerase subunit beta' OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoC PE=3 SV=2 258 899 1.0E-48
sp|A6UV49|RPOA2_META3 DNA-directed RNA polymerase subunit A'' OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpoA2 PE=3 SV=1 1051 1418 2.0E-48
sp|A2RML8|RPOC_LACLM DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoC PE=3 SV=1 262 921 2.0E-48
sp|Q8YA96|RPOC_LISMO DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoC PE=3 SV=1 259 946 2.0E-48
sp|B0KCJ3|RPOC_THEP3 DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoC PE=3 SV=1 258 919 2.0E-48
sp|Q02X60|RPOC_LACLS DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoC PE=3 SV=1 262 921 2.0E-48
sp|Q2FJ97|RPOC_STAA3 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain USA300) GN=rpoC PE=3 SV=2 258 935 2.0E-48
sp|P37871|RPOC_BACSU DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) GN=rpoC PE=1 SV=4 258 899 3.0E-48
sp|A0AF64|RPOC_LISW6 DNA-directed RNA polymerase subunit beta' OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoC PE=3 SV=1 259 946 3.0E-48
sp|P14247|RPOA2_METVS DNA-directed RNA polymerase subunit A'' OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpoA2 PE=3 SV=2 1054 1418 3.0E-48
sp|Q8R7U7|RPOC_CALS4 DNA-directed RNA polymerase subunit beta' OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoC PE=3 SV=1 258 919 3.0E-48
sp|B0K5G9|RPOC_THEPX DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter sp. (strain X514) GN=rpoC PE=3 SV=2 258 919 4.0E-48
sp|B5E2F2|RPOC_STRP4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoC PE=3 SV=1 218 922 4.0E-48
sp|C1CMQ7|RPOC_STRZP DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain P1031) GN=rpoC PE=3 SV=1 218 922 5.0E-48
sp|Q49V53|RPOC_STAS1 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoC PE=3 SV=1 221 958 6.0E-48
sp|Q03PV0|RPOC_LACBA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpoC PE=3 SV=1 183 921 6.0E-48
sp|Q2YSB8|RPOC_STAAB DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoC PE=3 SV=1 258 920 7.0E-48
sp|Q6GJC5|RPOC_STAAR DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MRSA252) GN=rpoC PE=3 SV=1 258 958 7.0E-48
sp|P60286|RPOC_STAAW DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MW2) GN=rpoC PE=3 SV=1 258 958 7.0E-48
sp|Q6GBU4|RPOC_STAAS DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MSSA476) GN=rpoC PE=3 SV=1 258 958 7.0E-48
sp|P60285|RPOC_STAAN DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain N315) GN=rpoC PE=1 SV=1 258 958 7.0E-48
sp|P60284|RPOC_STAAM DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoC PE=3 SV=1 258 958 7.0E-48
sp|Q5HID2|RPOC_STAAC DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain COL) GN=rpoC PE=3 SV=1 258 958 7.0E-48
sp|Q2G0N5|RPOC_STAA8 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoC PE=3 SV=2 258 958 7.0E-48
sp|Q5JE34|RPOA2_THEKO DNA-directed RNA polymerase subunit A'' OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpoA2 PE=1 SV=1 1045 1426 9.0E-48
sp|C1CTL3|RPOC_STRZT DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoC PE=3 SV=1 218 922 9.0E-48
sp|C1CGP3|RPOC_STRZJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain JJA) GN=rpoC PE=3 SV=1 218 922 9.0E-48
sp|B2IM39|RPOC_STRPS DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain CGSP14) GN=rpoC PE=3 SV=1 218 922 9.0E-48
sp|Q97NQ8|RPOC_STRPN DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoC PE=3 SV=1 218 922 9.0E-48
sp|B1I8R3|RPOC_STRPI DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoC PE=3 SV=1 218 922 9.0E-48
sp|C1CA05|RPOC_STRP7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain 70585) GN=rpoC PE=3 SV=1 218 922 9.0E-48
sp|A4YCR0|RPOA2_METS5 DNA-directed RNA polymerase subunit A'' OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpoA2 PE=3 SV=1 1033 1421 9.0E-48
sp|A9A9U9|RPOA2_METM6 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpoA2 PE=3 SV=1 1054 1418 1.0E-47
sp|B8ZNW6|RPOC_STRPJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoC PE=3 SV=1 218 922 1.0E-47
sp|Q04IK7|RPOC_STRP2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoC PE=3 SV=1 218 922 1.0E-47
sp|Q8DNF1|RPOC_STRR6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoC PE=3 SV=1 218 922 1.0E-47
sp|A6VGV0|RPOA2_METM7 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpoA2 PE=3 SV=1 1054 1418 2.0E-47
sp|P0C1T4|RPOC_STAAU DNA-directed RNA polymerase subunit beta' (Fragment) OS=Staphylococcus aureus GN=rpoC PE=3 SV=1 258 958 2.0E-47
sp|Q1WVA4|RPOC_LACS1 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus salivarius (strain UCC118) GN=rpoC PE=3 SV=1 258 921 2.0E-47
sp|A6LKB7|RPOC_THEM4 DNA-directed RNA polymerase subunit beta' OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=rpoC PE=3 SV=1 255 1123 2.0E-47
sp|A4FWF5|RPOA2_METM5 DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpoA2 PE=3 SV=1 1062 1418 2.0E-47
sp|C0M7R5|RPOC_STRE4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoC PE=3 SV=1 258 899 3.0E-47
sp|P11514|RPOA2_SULAC DNA-directed RNA polymerase subunit A'' OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoA2 PE=3 SV=2 1045 1414 3.0E-47
sp|P58192|RPOA2_SULSO DNA-directed RNA polymerase subunit A'' OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoA2 PE=1 SV=1 1046 1421 3.0E-47
sp|C3N7Q1|RPOA2_SULIY DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpoA2 PE=3 SV=1 1046 1421 3.0E-47
sp|C3NFS2|RPOA2_SULIN DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpoA2 PE=3 SV=1 1046 1421 3.0E-47
sp|C3MYA0|RPOA2_SULIM DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpoA2 PE=3 SV=1 1046 1421 3.0E-47
sp|C3MRK4|RPOA2_SULIL DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpoA2 PE=3 SV=1 1046 1421 3.0E-47
sp|C4KIV9|RPOA2_SULIK DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpoA2 PE=3 SV=1 1046 1421 3.0E-47
sp|C3MZM9|RPOA2_SULIA DNA-directed RNA polymerase subunit A'' OS=Sulfolobus islandicus (strain M.16.27) GN=rpoA2 PE=3 SV=1 1046 1421 3.0E-47
sp|A4VSK3|RPOC_STRSY DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 05ZYH33) GN=rpoC PE=3 SV=2 258 941 4.0E-47
sp|A4VYU4|RPOC_STRS2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 98HAH33) GN=rpoC PE=3 SV=2 258 941 4.0E-47
sp|Q3A9Q8|RPOC_CARHZ DNA-directed RNA polymerase subunit beta' OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoC PE=3 SV=1 258 922 5.0E-47
sp|Q6LXI7|RPOA2_METMP DNA-directed RNA polymerase subunit A'' OS=Methanococcus maripaludis (strain S2 / LL) GN=rpoA2 PE=3 SV=1 1062 1418 7.0E-47
sp|O27126|RPOA2_METTH DNA-directed RNA polymerase subunit A'' OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpoA2 PE=3 SV=1 951 1419 8.0E-47
sp|Q4L3K4|RPOC_STAHJ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoC PE=3 SV=1 259 958 1.0E-46
sp|Q046D1|RPOC_LACGA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpoC PE=3 SV=1 258 921 1.0E-46
sp|P96177|RPOC_WEIHE DNA-directed RNA polymerase subunit beta' (Fragment) OS=Weissella hellenica GN=rpoC PE=3 SV=1 258 899 2.0E-46
sp|B9DSZ6|RPOC_STRU0 DNA-directed RNA polymerase subunit beta' OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoC PE=3 SV=1 258 908 2.0E-46
sp|A2RC52|RPOC_STRPG DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoC PE=3 SV=1 258 899 2.0E-46
sp|C0MEE4|RPOC_STRS7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoC PE=3 SV=1 258 899 2.0E-46
sp|P77839|RPOC_BROTH DNA-directed RNA polymerase subunit beta' (Fragment) OS=Brochothrix thermosphacta GN=rpoC PE=3 SV=2 258 893 2.0E-46
sp|Q5XE96|RPOC_STRP6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoC PE=3 SV=1 258 899 2.0E-46
sp|B2A4D2|RPOC_NATTJ DNA-directed RNA polymerase subunit beta' OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpoC PE=3 SV=1 258 905 2.0E-46
sp|Q1J8X0|RPOC_STRPF DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoC PE=3 SV=1 258 899 3.0E-46
sp|Q48VR0|RPOC_STRPM DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoC PE=3 SV=1 258 899 3.0E-46
sp|Q8CQ83|RPOC_STAES DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoC PE=3 SV=1 259 958 3.0E-46
sp|Q5HRK9|RPOC_STAEQ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoC PE=3 SV=1 259 958 3.0E-46
sp|Q8P2Y2|RPOC_STRP8 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoC PE=3 SV=1 258 899 3.0E-46
sp|P0C0E0|RPOC_STRP1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M1 GN=rpoC PE=3 SV=1 258 899 4.0E-46
sp|Q5UZR5|RPOA2_HALMA DNA-directed RNA polymerase subunit A'' OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpoA2 PE=3 SV=1 1041 1423 7.0E-46
sp|Q1JJ22|RPOC_STRPD DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoC PE=3 SV=1 258 899 8.0E-46
sp|Q5FM96|RPOC_LACAC DNA-directed RNA polymerase subunit beta' OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoC PE=3 SV=1 258 921 8.0E-46
sp|B8G4U8|RPOC_CHLAD DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpoC PE=3 SV=1 258 899 9.0E-46
sp|P0DF33|RPOC_STRPQ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoC PE=3 SV=1 258 899 9.0E-46
sp|Q74L94|RPOC_LACJO DNA-directed RNA polymerase subunit beta' OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpoC PE=3 SV=1 200 921 1.0E-45
sp|Q03IK3|RPOC_STRTD DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoC PE=3 SV=1 218 908 1.0E-45
sp|P0DF32|RPOC_STRP3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoC PE=3 SV=1 258 899 1.0E-45
sp|Q5M2F6|RPOC_STRT2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoC PE=3 SV=1 218 908 1.0E-45
sp|Q5LXV4|RPOC_STRT1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoC PE=3 SV=1 218 908 1.0E-45
sp|A8YXJ9|RPOC_LACH4 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoC PE=3 SV=1 258 921 1.0E-45
sp|Q1JNX6|RPOC_STRPC DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoC PE=3 SV=1 258 899 1.0E-45
sp|Q1JE19|RPOC_STRPB DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoC PE=3 SV=1 258 899 1.0E-45
sp|B9LL90|RPOC_CHLSY DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpoC PE=3 SV=1 258 899 1.0E-45
sp|P36594|RPB1_SCHPO DNA-directed RNA polymerase II subunit rpb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb1 PE=1 SV=1 1061 1418 2.0E-45
sp|Q979F5|RPOA2_THEVO DNA-directed RNA polymerase subunit A'' OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpoA2 PE=3 SV=1 985 1421 2.0E-45
sp|Q8TRB8|RPOA2_METAC DNA-directed RNA polymerase subunit A'' OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rpoA2 PE=3 SV=1 1062 1421 2.0E-45
sp|B2G8Y5|RPOC_LACRJ DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain JCM 1112) GN=rpoC PE=3 SV=1 258 921 3.0E-45
sp|A5VLL3|RPOC_LACRD DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoC PE=3 SV=1 258 921 3.0E-45
sp|Q8PUR2|RPOA2_METMA DNA-directed RNA polymerase subunit A'' OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rpoA2 PE=3 SV=1 1044 1421 3.0E-45
sp|B0TC49|RPOC_HELMI DNA-directed RNA polymerase subunit beta' OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoC PE=3 SV=1 258 893 3.0E-45
sp|P96178|RPOC_WEIPA DNA-directed RNA polymerase subunit beta' (Fragment) OS=Weissella paramesenteroides GN=rpoC PE=3 SV=1 258 921 4.0E-45
sp|B2GDX6|RPOC_LACF3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpoC PE=3 SV=1 258 921 5.0E-45
sp|P09847|RPOA2_METTW DNA-directed RNA polymerase subunit A'' OS=Methanothermobacter thermautotrophicus (strain Winter) GN=rpoA2 PE=1 SV=2 1009 1419 5.0E-45
sp|Q67JT4|RPOC_SYMTH DNA-directed RNA polymerase subunit beta' OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoC PE=3 SV=1 258 905 7.0E-45
sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoC PE=3 SV=1 258 899 8.0E-45
sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoC PE=3 SV=1 258 899 8.0E-45
sp|Q0AUH3|RPOC_SYNWW DNA-directed RNA polymerase subunit beta' OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoC PE=3 SV=1 259 921 1.0E-44
sp|B2UQY1|RPOC_AKKM8 DNA-directed RNA polymerase subunit beta' OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rpoC PE=3 SV=1 251 917 1.0E-44
sp|A9WH11|RPOC_CHLAA DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpoC PE=3 SV=1 258 899 1.0E-44
sp|B4U738|RPOC_HYDS0 DNA-directed RNA polymerase subunit beta' OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpoC PE=3 SV=1 226 898 3.0E-44
sp|Q88XZ2|RPOC_LACPL DNA-directed RNA polymerase subunit beta' OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoC PE=3 SV=1 259 921 3.0E-44
sp|Q034X1|RPOC_LACC3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain ATCC 334) GN=rpoC PE=3 SV=1 215 921 5.0E-44
sp|A5USR6|RPOC_ROSS1 DNA-directed RNA polymerase subunit beta' OS=Roseiflexus sp. (strain RS-1) GN=rpoC PE=3 SV=1 258 899 5.0E-44
sp|Q250N9|RPOC_DESHY DNA-directed RNA polymerase subunit beta' OS=Desulfitobacterium hafniense (strain Y51) GN=rpoC PE=3 SV=1 258 922 7.0E-44
sp|B3WAM7|RPOC_LACCB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain BL23) GN=rpoC PE=3 SV=1 215 921 8.0E-44
sp|Q6FF89|RPOC_ACIAD DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpoC PE=3 SV=2 89 921 9.0E-44
sp|B5RLU8|RPOC_BORDL DNA-directed RNA polymerase subunit beta' OS=Borrelia duttonii (strain Ly) GN=rpoC PE=3 SV=1 258 921 9.0E-44
sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta' OS=Nitratiruptor sp. (strain SB155-2) GN=rpoC PE=3 SV=1 258 970 1.0E-43
sp|B5RRJ6|RPOC_BORRA DNA-directed RNA polymerase subunit beta' OS=Borrelia recurrentis (strain A1) GN=rpoC PE=3 SV=1 258 921 1.0E-43
sp|A7NJM0|RPOC_ROSCS DNA-directed RNA polymerase subunit beta' OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpoC PE=3 SV=1 258 899 2.0E-43
sp|A8MLD3|RPOC_ALKOO DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoC PE=3 SV=1 218 921 2.0E-43
sp|A1QZH6|RPOC_BORT9 DNA-directed RNA polymerase subunit beta' OS=Borrelia turicatae (strain 91E135) GN=rpoC PE=3 SV=1 258 921 2.0E-43
sp|Q03586|RPOA2_THEAC DNA-directed RNA polymerase subunit A'' OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpoA2 PE=1 SV=1 991 1421 3.0E-43
sp|Q01VB2|RPOC_SOLUE DNA-directed RNA polymerase subunit beta' OS=Solibacter usitatus (strain Ellin6076) GN=rpoC PE=3 SV=1 184 905 3.0E-43
sp|P0C0D9|RPOC_STRPY DNA-directed RNA polymerase subunit beta' (Fragment) OS=Streptococcus pyogenes GN=rpoC PE=3 SV=1 258 899 7.0E-43
sp|B1KSN2|RPOC_CLOBM DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoC PE=3 SV=1 258 921 9.0E-43
sp|B2S091|RPOC_BORHD DNA-directed RNA polymerase subunit beta' OS=Borrelia hermsii (strain HS1 / DAH) GN=rpoC PE=3 SV=1 258 921 1.0E-42
sp|B1IGG1|RPOC_CLOBK DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoC PE=3 SV=1 258 921 1.0E-42
sp|B1I1M9|RPOC_DESAP DNA-directed RNA polymerase subunit beta' OS=Desulforudis audaxviator (strain MP104C) GN=rpoC PE=3 SV=1 218 893 1.0E-42
sp|B5YFV7|RPOC_THEYD DNA-directed RNA polymerase subunit beta' OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpoC PE=3 SV=1 258 922 1.0E-42
sp|B0VDH9|RPOC_ACIBY DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain AYE) GN=rpoC PE=3 SV=1 89 921 1.0E-42
sp|A3M1G4|RPOC_ACIBT DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpoC PE=3 SV=2 89 921 1.0E-42
sp|B2I1Z2|RPOC_ACIBC DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain ACICU) GN=rpoC PE=3 SV=1 89 921 1.0E-42
sp|Q890N5|RPOC_CLOTE DNA-directed RNA polymerase subunit beta' OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoC PE=3 SV=2 218 921 1.0E-42
sp|Q03EB0|RPOC_PEDPA DNA-directed RNA polymerase subunit beta' OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoC PE=3 SV=1 259 921 2.0E-42
sp|A7GJ81|RPOC_CLOBL DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoC PE=3 SV=1 258 921 2.0E-42
sp|A5I7L3|RPOC_CLOBH DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoC PE=3 SV=1 258 921 2.0E-42
sp|A7FZ76|RPOC_CLOB1 DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoC PE=3 SV=1 258 921 2.0E-42
sp|B1MVW7|RPOC_LEUCK DNA-directed RNA polymerase subunit beta' OS=Leuconostoc citreum (strain KM20) GN=rpoC PE=3 SV=1 255 893 2.0E-42
sp|B0VLZ5|RPOC_ACIBS DNA-directed RNA polymerase subunit beta' OS=Acinetobacter baumannii (strain SDF) GN=rpoC PE=3 SV=1 89 921 3.0E-42
sp|Q2N5Q5|RPOC_ERYLH DNA-directed RNA polymerase subunit beta' OS=Erythrobacter litoralis (strain HTCC2594) GN=rpoC PE=3 SV=1 203 892 3.0E-42
sp|Q058E6|RPOC_BUCCC DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpoC PE=3 SV=1 89 893 4.0E-42
sp|B0S2E5|RPOC_FINM2 DNA-directed RNA polymerase subunit beta' OS=Finegoldia magna (strain ATCC 29328) GN=rpoC PE=3 SV=2 259 899 4.0E-42
sp|P77917|RPOC_PEDAC DNA-directed RNA polymerase subunit beta' (Fragment) OS=Pediococcus acidilactici GN=rpoC PE=3 SV=2 259 921 5.0E-42
sp|B2UUV9|RPOBC_HELPS Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain Shi470) GN=rpoBC PE=3 SV=1 258 922 7.0E-42
sp|Q5L898|RPOC_BACFN DNA-directed RNA polymerase subunit beta' OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpoC PE=3 SV=1 258 899 7.0E-42
sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoC PE=3 SV=1 258 921 7.0E-42
sp|Q18CF3|RPOC_PEPD6 DNA-directed RNA polymerase subunit beta' OS=Peptoclostridium difficile (strain 630) GN=rpoC PE=3 SV=1 258 893 7.0E-42
sp|Q64NJ8|RPOC_BACFR DNA-directed RNA polymerase subunit beta' OS=Bacteroides fragilis (strain YCH46) GN=rpoC PE=3 SV=1 258 899 7.0E-42
sp|B0SSI3|RPOC_LEPBP DNA-directed RNA polymerase subunit beta' OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rpoC PE=3 SV=1 223 899 7.0E-42
sp|B0SAG0|RPOC_LEPBA DNA-directed RNA polymerase subunit beta' OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rpoC PE=3 SV=1 223 899 7.0E-42
sp|P94892|RPOC_LEUMM DNA-directed RNA polymerase subunit beta' OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoC PE=3 SV=2 215 921 8.0E-42
sp|Q73JJ8|RPOC_TREDE DNA-directed RNA polymerase subunit beta' OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=rpoC PE=3 SV=1 258 905 1.0E-41
sp|Q1H4P3|RPOC_METFK DNA-directed RNA polymerase subunit beta' OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=rpoC PE=3 SV=1 258 921 1.0E-41
sp|Q9J593|RP147_FOWPN DNA-directed RNA polymerase 147 kDa polypeptide OS=Fowlpox virus (strain NVSL) GN=RPO147 PE=3 SV=1 252 1416 2.0E-41
sp|Q9PI30|RPOC_CAMJE DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpoC PE=3 SV=1 71 899 2.0E-41
sp|Q6YQW2|RPOC_ONYPE DNA-directed RNA polymerase subunit beta' OS=Onion yellows phytoplasma (strain OY-M) GN=rpoC PE=3 SV=1 255 908 2.0E-41
sp|Q5HVY8|RPOC_CAMJR DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni (strain RM1221) GN=rpoC PE=3 SV=1 71 899 3.0E-41
sp|A1VYJ5|RPOC_CAMJJ DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpoC PE=3 SV=1 71 899 3.0E-41
sp|A6TWI9|RPOC_ALKMQ DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoC PE=3 SV=1 255 919 3.0E-41
sp|P47582|RPOC_MYCGE DNA-directed RNA polymerase subunit beta' OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpoC PE=3 SV=1 211 910 3.0E-41
sp|Q5LMQ6|RPOC_RUEPO DNA-directed RNA polymerase subunit beta' OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpoC PE=3 SV=1 215 892 4.0E-41
sp|A8FKR4|RPOC_CAMJ8 DNA-directed RNA polymerase subunit beta' OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpoC PE=3 SV=1 71 899 4.0E-41
sp|P94899|RPOC_LEUPS DNA-directed RNA polymerase subunit beta' (Fragment) OS=Leuconostoc pseudomesenteroides GN=rpoC PE=3 SV=1 215 921 4.0E-41
sp|B9KFG8|RPOC_CAMLR DNA-directed RNA polymerase subunit beta' OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpoC PE=3 SV=1 258 899 5.0E-41
sp|P04052|RPB1_DROME DNA-directed RNA polymerase II subunit RPB1 OS=Drosophila melanogaster GN=RpII215 PE=3 SV=4 1033 1428 7.0E-41
sp|Q2NJ16|RPOC_AYWBP DNA-directed RNA polymerase subunit beta' OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpoC PE=3 SV=1 255 908 7.0E-41
sp|Q17VN6|RPOBC_HELAH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter acinonychis (strain Sheeba) GN=rpoBC PE=3 SV=1 258 922 7.0E-41
sp|Q9ZK23|RPOBC_HELPJ Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpoBC PE=3 SV=1 258 922 7.0E-41
sp|Q89B21|RPOC_BUCBP DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=rpoC PE=3 SV=1 255 916 8.0E-41
sp|Q0SNB9|RPOC_BORAP DNA-directed RNA polymerase subunit beta' OS=Borrelia afzelii (strain PKo) GN=rpoC PE=3 SV=1 258 921 8.0E-41
sp|Q8ZYQ7|RPOA2_PYRAE DNA-directed RNA polymerase subunit A'' OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpoA2 PE=3 SV=1 1051 1419 9.0E-41
sp|A1VAJ5|RPOC_DESVV DNA-directed RNA polymerase subunit beta' OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpoC PE=3 SV=1 255 899 1.0E-40
sp|Q727C6|RPOC_DESVH DNA-directed RNA polymerase subunit beta' OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpoC PE=3 SV=1 255 899 1.0E-40
sp|Q87A33|RPOC_XYLFT DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpoC PE=3 SV=1 258 921 1.0E-40
sp|B2IA67|RPOC_XYLF2 DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain M23) GN=rpoC PE=3 SV=1 258 921 1.0E-40
sp|O25806|RPOBC_HELPY Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpoBC PE=1 SV=1 258 922 1.0E-40
sp|A0PXT9|RPOC_CLONN DNA-directed RNA polymerase subunit beta' OS=Clostridium novyi (strain NT) GN=rpoC PE=3 SV=1 258 919 1.0E-40
sp|Q12SW5|RPOC_SHEDO DNA-directed RNA polymerase subunit beta' OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpoC PE=3 SV=1 89 921 1.0E-40
sp|Q1CS68|RPOBC_HELPH Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Helicobacter pylori (strain HPAG1) GN=rpoBC PE=3 SV=1 258 922 1.0E-40
sp|Q8RHI7|RPOC_FUSNN DNA-directed RNA polymerase subunit beta' OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpoC PE=3 SV=1 258 916 2.0E-40
sp|Q5P338|RPOC_AROAE DNA-directed RNA polymerase subunit beta' OS=Aromatoleum aromaticum (strain EbN1) GN=rpoC PE=3 SV=1 258 921 2.0E-40
sp|B4S498|RPOC_PROA2 DNA-directed RNA polymerase subunit beta' OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpoC PE=3 SV=1 258 905 2.0E-40
sp|A3DIZ5|RPOC_CLOTH DNA-directed RNA polymerase subunit beta' OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoC PE=3 SV=1 255 899 2.0E-40
sp|B1GZ76|RPOC_UNCTG DNA-directed RNA polymerase subunit beta' OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=rpoC PE=3 SV=1 222 922 2.0E-40
sp|Q0VSM1|RPOC_ALCBS DNA-directed RNA polymerase subunit beta' OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpoC PE=3 SV=1 259 965 2.0E-40
sp|Q8A470|RPOC_BACTN DNA-directed RNA polymerase subunit beta' OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpoC PE=3 SV=1 258 899 2.0E-40
sp|A5D5I3|RPOC_PELTS DNA-directed RNA polymerase subunit beta' OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpoC PE=3 SV=1 258 922 2.0E-40
sp|Q38UQ3|RPOC_LACSS DNA-directed RNA polymerase subunit beta' OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoC PE=3 SV=1 258 921 2.0E-40
sp|A1JII1|RPOC_YERE8 DNA-directed RNA polymerase subunit beta' OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=rpoC PE=3 SV=1 176 921 2.0E-40
sp|B9M6V1|RPOC_GEODF DNA-directed RNA polymerase subunit beta' OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpoC PE=3 SV=1 89 921 2.0E-40
sp|A9B6J1|RPOC_HERA2 DNA-directed RNA polymerase subunit beta' OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpoC PE=3 SV=1 258 905 3.0E-40
sp|Q1IHH5|RPOC_KORVE DNA-directed RNA polymerase subunit beta' OS=Koribacter versatilis (strain Ellin345) GN=rpoC PE=3 SV=2 207 898 3.0E-40
sp|P15353|RPOA2_HALMO DNA-directed RNA polymerase subunit A'' OS=Halococcus morrhuae GN=rpoA2 PE=1 SV=1 1061 1423 3.0E-40
sp|O33431|RPOC_PORCN DNA-directed RNA polymerase subunit beta' (Fragment) OS=Porphyromonas cangingivalis GN=rpoC PE=3 SV=1 258 914 3.0E-40
sp|P41185|RPOC_BUCAP DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=rpoC PE=3 SV=2 255 921 3.0E-40
sp|B0U5X6|RPOC_XYLFM DNA-directed RNA polymerase subunit beta' OS=Xylella fastidiosa (strain M12) GN=rpoC PE=3 SV=1 258 921 4.0E-40
sp|Q1Q8Q0|RPOC_PSYCK DNA-directed RNA polymerase subunit beta' OS=Psychrobacter cryohalolentis (strain K5) GN=rpoC PE=3 SV=1 255 899 4.0E-40
sp|Q4FQH4|RPOC_PSYA2 DNA-directed RNA polymerase subunit beta' OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpoC PE=3 SV=1 255 899 4.0E-40
sp|A9H3S0|RPOC_GLUDA DNA-directed RNA polymerase subunit beta' OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpoC PE=3 SV=1 255 924 4.0E-40
sp|A5N4P0|RPOC_CLOK5 DNA-directed RNA polymerase subunit beta' OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoC PE=3 SV=1 258 921 5.0E-40
sp|Q9LQ02|NRPD1_ARATH DNA-directed RNA polymerase IV subunit 1 OS=Arabidopsis thaliana GN=NRPD1 PE=1 SV=1 365 927 5.0E-40
sp|Q04E86|RPOC_OENOB DNA-directed RNA polymerase subunit beta' OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoC PE=3 SV=1 258 921 6.0E-40
sp|B7J1W0|RPOC_BORBZ DNA-directed RNA polymerase subunit beta' OS=Borrelia burgdorferi (strain ZS7) GN=rpoC PE=3 SV=1 258 921 6.0E-40
sp|B2FQ39|RPOC_STRMK DNA-directed RNA polymerase subunit beta' OS=Stenotrophomonas maltophilia (strain K279a) GN=rpoC PE=3 SV=1 258 921 7.0E-40
sp|A6Q6I3|RPOC_SULNB DNA-directed RNA polymerase subunit beta' OS=Sulfurovum sp. (strain NBC37-1) GN=rpoC PE=3 SV=1 258 921 9.0E-40
sp|Q5FTX8|RPOC_GLUOX DNA-directed RNA polymerase subunit beta' OS=Gluconobacter oxydans (strain 621H) GN=rpoC PE=3 SV=1 191 892 9.0E-40
sp|A5GAY2|RPOC_GEOUR DNA-directed RNA polymerase subunit beta' OS=Geobacter uraniireducens (strain Rf4) GN=rpoC PE=3 SV=1 89 921 1.0E-39
sp|A1S212|RPOC_SHEAM DNA-directed RNA polymerase subunit beta' OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpoC PE=3 SV=1 218 921 1.0E-39
sp|A4SUV5|RPOC_POLSQ DNA-directed RNA polymerase subunit beta' OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=rpoC PE=3 SV=1 258 905 1.0E-39
sp|B8CNC6|RPOC_SHEPW DNA-directed RNA polymerase subunit beta' OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpoC PE=3 SV=1 218 921 1.0E-39
sp|Q0SQD7|RPOC_CLOPS DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoC PE=3 SV=1 258 919 1.0E-39
sp|P0C2E8|RPOC_CLOPE DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain 13 / Type A) GN=rpoC PE=3 SV=1 258 919 1.0E-39
sp|Q0TMN9|RPOC_CLOP1 DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoC PE=3 SV=1 258 919 1.0E-39
sp|Q1MPW9|RPOC_LAWIP DNA-directed RNA polymerase subunit beta' OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=rpoC PE=3 SV=1 258 916 1.0E-39
sp|O51349|RPOC_BORBU DNA-directed RNA polymerase subunit beta' OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpoC PE=3 SV=1 258 921 1.0E-39
sp|Q92QH6|RPOC_RHIME DNA-directed RNA polymerase subunit beta' OS=Rhizobium meliloti (strain 1021) GN=rpoC PE=3 SV=1 89 899 1.0E-39
sp|B6IRP7|RPOC_RHOCS DNA-directed RNA polymerase subunit beta' OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpoC PE=3 SV=1 244 905 1.0E-39
sp|A8G1F4|RPOC_SHESH DNA-directed RNA polymerase subunit beta' OS=Shewanella sediminis (strain HAW-EB3) GN=rpoC PE=3 SV=1 218 921 2.0E-39
sp|Q9YAU2|RPOA2_AERPE DNA-directed RNA polymerase subunit A'' OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpoA2 PE=3 SV=2 1055 1423 2.0E-39
sp|A0L5W7|RPOC_MAGMM DNA-directed RNA polymerase subunit beta' OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=rpoC PE=3 SV=1 259 919 2.0E-39
sp|B1XSP4|RPOC_POLNS DNA-directed RNA polymerase subunit beta' OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=rpoC PE=3 SV=1 258 905 2.0E-39
sp|Q28UX6|RPOC_JANSC DNA-directed RNA polymerase subunit beta' OS=Jannaschia sp. (strain CCS1) GN=rpoC PE=3 SV=1 215 899 2.0E-39
sp|P43739|RPOC_HAEIN DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpoC PE=3 SV=1 258 921 2.0E-39
sp|A5UH19|RPOC_HAEIG DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain PittGG) GN=rpoC PE=3 SV=1 258 921 2.0E-39
sp|Q0ABI1|RPOC_ALKEH DNA-directed RNA polymerase subunit beta' OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpoC PE=3 SV=1 258 905 2.0E-39
sp|A6U852|RPOC_SINMW DNA-directed RNA polymerase subunit beta' OS=Sinorhizobium medicae (strain WSM419) GN=rpoC PE=3 SV=1 89 899 2.0E-39
sp|A5U9X9|RPOC_HAEIE DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain PittEE) GN=rpoC PE=3 SV=1 258 921 2.0E-39
sp|Q4QN34|RPOC_HAEI8 DNA-directed RNA polymerase subunit beta' OS=Haemophilus influenzae (strain 86-028NP) GN=rpoC PE=3 SV=1 258 921 3.0E-39
sp|Q661N0|RPOC_BORBP DNA-directed RNA polymerase subunit beta' OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=rpoC PE=3 SV=1 258 921 3.0E-39
sp|A9NEL8|RPOC_ACHLI DNA-directed RNA polymerase subunit beta' OS=Acholeplasma laidlawii (strain PG-8A) GN=rpoC PE=3 SV=1 251 910 3.0E-39
sp|P95405|RPOC_OENOE DNA-directed RNA polymerase subunit beta' (Fragment) OS=Oenococcus oeni GN=rpoC PE=3 SV=1 258 921 3.0E-39
sp|B3PW60|RPOC_RHIE6 DNA-directed RNA polymerase subunit beta' OS=Rhizobium etli (strain CIAT 652) GN=rpoC PE=3 SV=1 89 905 3.0E-39
sp|A1ALT5|RPOC_PELPD DNA-directed RNA polymerase subunit beta' OS=Pelobacter propionicus (strain DSM 2379) GN=rpoC PE=3 SV=1 89 921 3.0E-39
sp|B0URZ7|RPOC_HISS2 DNA-directed RNA polymerase subunit beta' OS=Histophilus somni (strain 2336) GN=rpoC PE=3 SV=1 258 916 3.0E-39
sp|Q9X6Y2|RPOC_AQUPY DNA-directed RNA polymerase subunit beta' OS=Aquifex pyrophilus GN=rpoC PE=3 SV=1 205 899 3.0E-39
sp|Q0I5B8|RPOC_HAES1 DNA-directed RNA polymerase subunit beta' OS=Haemophilus somnus (strain 129Pt) GN=rpoC PE=3 SV=1 258 916 3.0E-39
sp|A8GYX0|RPOC_SHEPA DNA-directed RNA polymerase subunit beta' OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpoC PE=3 SV=1 218 921 4.0E-39
sp|A6LPQ5|RPOC_CLOB8 DNA-directed RNA polymerase subunit beta' OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoC PE=3 SV=1 259 919 5.0E-39
sp|Q2K9M3|RPOC_RHIEC DNA-directed RNA polymerase subunit beta' OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpoC PE=3 SV=1 89 905 5.0E-39
sp|Q5QWA4|RPOC_IDILO DNA-directed RNA polymerase subunit beta' OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpoC PE=3 SV=1 258 921 6.0E-39
sp|Q8EWX0|RPOC_MYCPE DNA-directed RNA polymerase subunit beta' OS=Mycoplasma penetrans (strain HF-2) GN=rpoC PE=3 SV=1 252 910 6.0E-39
sp|Q9KWU6|RPOC_THEAQ DNA-directed RNA polymerase subunit beta' OS=Thermus aquaticus GN=rpoC PE=1 SV=2 258 913 7.0E-39
sp|B0TM18|RPOC_SHEHH DNA-directed RNA polymerase subunit beta' OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpoC PE=3 SV=1 258 921 7.0E-39
sp|P57145|RPOC_BUCAI DNA-directed RNA polymerase subunit beta' OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpoC PE=3 SV=1 255 921 9.0E-39
sp|A8EVZ3|RPOC_ARCB4 DNA-directed RNA polymerase subunit beta' OS=Arcobacter butzleri (strain RM4018) GN=rpoC PE=3 SV=1 258 899 9.0E-39
sp|Q8F0S3|RPOC_LEPIN DNA-directed RNA polymerase subunit beta' OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpoC PE=3 SV=1 258 899 1.0E-38
sp|Q72UA7|RPOC_LEPIC DNA-directed RNA polymerase subunit beta' OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpoC PE=3 SV=1 258 899 1.0E-38
sp|Q8D232|RPOC_WIGBR DNA-directed RNA polymerase subunit beta' OS=Wigglesworthia glossinidia brevipalpis GN=rpoC PE=3 SV=1 258 899 1.0E-38
sp|A8LM41|RPOC_DINSH DNA-directed RNA polymerase subunit beta' OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpoC PE=3 SV=1 215 899 1.0E-38
sp|Q6AP77|RPOC_DESPS DNA-directed RNA polymerase subunit beta' OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpoC PE=3 SV=1 258 947 1.0E-38
sp|A1USC9|RPOC_BARBK DNA-directed RNA polymerase subunit beta' OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpoC PE=3 SV=1 89 892 1.0E-38
sp|Q1MIE8|RPOC_RHIL3 DNA-directed RNA polymerase subunit beta' OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpoC PE=3 SV=1 89 905 1.0E-38
sp|Q8UE09|RPOC_AGRFC DNA-directed RNA polymerase subunit beta' OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpoC PE=3 SV=2 89 892 1.0E-38
sp|B1JJK0|RPOC_YERPY DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=rpoC PE=3 SV=1 176 921 1.0E-38
sp|Q66FQ1|RPOC_YERPS DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=rpoC PE=3 SV=1 176 921 1.0E-38
sp|A4TS28|RPOC_YERPP DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis (strain Pestoides F) GN=rpoC PE=3 SV=2 176 921 1.0E-38
sp|Q1CN77|RPOC_YERPN DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=rpoC PE=3 SV=2 176 921 1.0E-38
sp|A9R0H9|RPOC_YERPG DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis bv. Antiqua (strain Angola) GN=rpoC PE=3 SV=1 176 921 1.0E-38
sp|Q8D1H3|RPOC_YERPE DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis GN=rpoC PE=3 SV=2 176 921 1.0E-38
sp|B2K114|RPOC_YERPB DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=rpoC PE=3 SV=1 176 921 1.0E-38
sp|Q1C1U2|RPOC_YERPA DNA-directed RNA polymerase subunit beta' OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=rpoC PE=3 SV=2 176 921 1.0E-38
sp|A7FNI2|RPOC_YERP3 DNA-directed RNA polymerase subunit beta' OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=rpoC PE=3 SV=1 176 921 1.0E-38
sp|Q5E239|RPOC_VIBF1 DNA-directed RNA polymerase subunit beta' OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpoC PE=3 SV=2 89 921 2.0E-38
sp|Q15YB0|RPOC_PSEA6 DNA-directed RNA polymerase subunit beta' OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpoC PE=3 SV=1 258 921 2.0E-38
sp|A1KRG7|RPOC_NEIMF DNA-directed RNA polymerase subunit beta' OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpoC PE=3 SV=1 260 921 2.0E-38
sp|A1TYJ1|RPOC_MARHV DNA-directed RNA polymerase subunit beta' OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpoC PE=3 SV=1 258 921 2.0E-38
sp|A5FZX0|RPOC_ACICJ DNA-directed RNA polymerase subunit beta' OS=Acidiphilium cryptum (strain JF-5) GN=rpoC PE=3 SV=1 258 892 2.0E-38
sp|A9M5Q8|RPOC_BRUC2 DNA-directed RNA polymerase subunit beta' OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpoC PE=3 SV=1 89 892 2.0E-38
sp|Q0ANP4|RPOC_MARMM DNA-directed RNA polymerase subunit beta' OS=Maricaulis maris (strain MCS10) GN=rpoC PE=3 SV=1 258 910 2.0E-38
sp|B1W441|RPOC_STRGG DNA-directed RNA polymerase subunit beta' OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpoC PE=3 SV=1 258 899 2.0E-38
sp|Q04QJ0|RPOC_LEPBJ DNA-directed RNA polymerase subunit beta' OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpoC PE=3 SV=1 258 899 3.0E-38
sp|A9IJ22|RPOC_BORPD DNA-directed RNA polymerase subunit beta' OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpoC PE=3 SV=1 239 921 3.0E-38
sp|C0RJK9|RPOC_BRUMB DNA-directed RNA polymerase subunit beta' OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpoC PE=3 SV=1 89 892 3.0E-38
sp|Q8G070|RPOC_BRUSU DNA-directed RNA polymerase subunit beta' OS=Brucella suis biovar 1 (strain 1330) GN=rpoC PE=3 SV=1 89 892 3.0E-38
sp|B0CH40|RPOC_BRUSI DNA-directed RNA polymerase subunit beta' OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpoC PE=3 SV=1 89 892 3.0E-38
sp|Q1GK48|RPOC_RUEST DNA-directed RNA polymerase subunit beta' OS=Ruegeria sp. (strain TM1040) GN=rpoC PE=3 SV=1 215 892 3.0E-38
sp|Q6MDM0|RPOC_PARUW DNA-directed RNA polymerase subunit beta' OS=Protochlamydia amoebophila (strain UWE25) GN=rpoC PE=3 SV=1 218 921 3.0E-38
sp|O67763|RPOC_AQUAE DNA-directed RNA polymerase subunit beta' OS=Aquifex aeolicus (strain VF5) GN=rpoC PE=3 SV=1 251 899 4.0E-38
sp|A6LE80|RPOC_PARD8 DNA-directed RNA polymerase subunit beta' OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpoC PE=3 SV=1 258 912 4.0E-38
sp|Q8YHP7|RPOC_BRUME DNA-directed RNA polymerase subunit beta' OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpoC PE=3 SV=1 89 892 4.0E-38
sp|A5VR14|RPOC_BRUO2 DNA-directed RNA polymerase subunit beta' OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpoC PE=3 SV=1 89 892 4.0E-38
sp|B3EL62|RPOC_CHLPB DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeobacteroides (strain BS1) GN=rpoC PE=3 SV=1 258 905 5.0E-38
sp|A7HWQ5|RPOC_PARL1 DNA-directed RNA polymerase subunit beta' OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpoC PE=3 SV=1 89 910 5.0E-38
sp|B0KK61|RPOC_PSEPG DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain GB-1) GN=rpoC PE=3 SV=1 259 921 5.0E-38
sp|Q3A6Q3|RPOC_PELCD DNA-directed RNA polymerase subunit beta' OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpoC PE=3 SV=1 89 930 5.0E-38
sp|Q7MA56|RPOBC_WOLSU Bifunctional DNA-directed RNA polymerase subunit beta-beta' OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpoBC PE=3 SV=1 258 922 5.0E-38
sp|Q39Y12|RPOC_GEOMG DNA-directed RNA polymerase subunit beta' OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpoC PE=3 SV=1 89 930 5.0E-38
sp|Q0BYA8|RPOC_HYPNA DNA-directed RNA polymerase subunit beta' OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpoC PE=3 SV=1 255 916 5.0E-38
sp|Q57CP9|RPOC_BRUAB DNA-directed RNA polymerase subunit beta' OS=Brucella abortus biovar 1 (strain 9-941) GN=rpoC PE=3 SV=1 89 892 5.0E-38
sp|Q2YM16|RPOC_BRUA2 DNA-directed RNA polymerase subunit beta' OS=Brucella abortus (strain 2308) GN=rpoC PE=3 SV=1 89 892 5.0E-38
sp|B2S686|RPOC_BRUA1 DNA-directed RNA polymerase subunit beta' OS=Brucella abortus (strain S19) GN=rpoC PE=3 SV=1 89 892 5.0E-38
sp|B5EFP4|RPOC_GEOBB DNA-directed RNA polymerase subunit beta' OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpoC PE=3 SV=1 89 921 6.0E-38
sp|A7HCH6|RPOC_ANADF DNA-directed RNA polymerase subunit beta' OS=Anaeromyxobacter sp. (strain Fw109-5) GN=rpoC PE=3 SV=1 89 898 6.0E-38
sp|Q7VKL8|RPOC_HAEDU DNA-directed RNA polymerase subunit beta' OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpoC PE=3 SV=1 89 916 6.0E-38
sp|Q9CK92|RPOC_PASMU DNA-directed RNA polymerase subunit beta' OS=Pasteurella multocida (strain Pm70) GN=rpoC PE=3 SV=1 258 916 6.0E-38
sp|Q054E1|RPOC_LEPBL DNA-directed RNA polymerase subunit beta' OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpoC PE=3 SV=1 258 899 6.0E-38
sp|Q1IFX2|RPOC_PSEE4 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas entomophila (strain L48) GN=rpoC PE=3 SV=1 259 921 7.0E-38
sp|Q2RQV4|RPOC_RHORT DNA-directed RNA polymerase subunit beta' OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpoC PE=3 SV=1 258 905 7.0E-38
sp|B3QYL5|RPOC_CHLT3 DNA-directed RNA polymerase subunit beta' OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=rpoC PE=3 SV=1 202 905 8.0E-38
sp|B2RL44|RPOC_PORG3 DNA-directed RNA polymerase subunit beta' OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpoC PE=3 SV=1 258 916 8.0E-38
sp|B1JDX0|RPOC_PSEPW DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida (strain W619) GN=rpoC PE=3 SV=1 259 921 9.0E-38
sp|Q63Q04|RPOC_BURPS DNA-directed RNA polymerase subunit beta' OS=Burkholderia pseudomallei (strain K96243) GN=rpoC PE=3 SV=1 88 910 9.0E-38
sp|A3NEI6|RPOC_BURP6 DNA-directed RNA polymerase subunit beta' OS=Burkholderia pseudomallei (strain 668) GN=rpoC PE=3 SV=1 88 910 9.0E-38
sp|Q3JMQ4|RPOC_BURP1 DNA-directed RNA polymerase subunit beta' OS=Burkholderia pseudomallei (strain 1710b) GN=rpoC PE=3 SV=1 88 910 9.0E-38
sp|A3P0C4|RPOC_BURP0 DNA-directed RNA polymerase subunit beta' OS=Burkholderia pseudomallei (strain 1106a) GN=rpoC PE=3 SV=1 88 910 9.0E-38
sp|A1V8B1|RPOC_BURMS DNA-directed RNA polymerase subunit beta' OS=Burkholderia mallei (strain SAVP1) GN=rpoC PE=3 SV=1 88 910 9.0E-38
sp|Q62GJ7|RPOC_BURMA DNA-directed RNA polymerase subunit beta' OS=Burkholderia mallei (strain ATCC 23344) GN=rpoC PE=3 SV=1 88 910 9.0E-38
sp|A2S7G7|RPOC_BURM9 DNA-directed RNA polymerase subunit beta' OS=Burkholderia mallei (strain NCTC 10229) GN=rpoC PE=3 SV=1 88 910 9.0E-38
sp|B0BSF6|RPOC_ACTPJ DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpoC PE=3 SV=1 89 916 1.0E-37
sp|Q2SU20|RPOC_BURTA DNA-directed RNA polymerase subunit beta' OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpoC PE=3 SV=1 88 910 1.0E-37
sp|Q2S906|RPOC_HAHCH DNA-directed RNA polymerase subunit beta' OS=Hahella chejuensis (strain KCTC 2396) GN=rpoC PE=3 SV=1 259 921 1.0E-37
sp|A3MRU6|RPOC_BURM7 DNA-directed RNA polymerase subunit beta' OS=Burkholderia mallei (strain NCTC 10247) GN=rpoC PE=3 SV=1 88 910 1.0E-37
sp|A5WH34|RPOC_PSYWF DNA-directed RNA polymerase subunit beta' OS=Psychrobacter sp. (strain PRwf-1) GN=rpoC PE=3 SV=1 255 899 1.0E-37
sp|P47716|RPOC_MYCGA DNA-directed RNA polymerase subunit beta' OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpoC PE=3 SV=2 262 909 1.0E-37
sp|A9ADI6|RPOC_BURM1 DNA-directed RNA polymerase subunit beta' OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpoC PE=3 SV=1 88 910 1.0E-37
sp|A6X0B0|RPOC_OCHA4 DNA-directed RNA polymerase subunit beta' OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpoC PE=3 SV=1 89 892 1.0E-37
sp|P07392|RP147_VACCW DNA-directed RNA polymerase 147 kDa polypeptide OS=Vaccinia virus (strain Western Reserve) GN=RPO147 PE=3 SV=1 63 893 1.0E-37
sp|P28363|RPA1_EUPOC DNA-directed RNA polymerase I subunit RPA1 (Fragment) OS=Euplotes octocarinatus GN=RPA1 PE=3 SV=1 314 516 1.0E-37
sp|B3GYV5|RPOC_ACTP7 DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpoC PE=3 SV=1 89 916 1.0E-37
sp|Q2GFP4|RPOC_EHRCR DNA-directed RNA polymerase subunit beta' OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpoC PE=3 SV=1 258 910 1.0E-37
sp|Q65W40|RPOC_MANSM DNA-directed RNA polymerase subunit beta' OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpoC PE=3 SV=2 258 917 1.0E-37
sp|A1B017|RPOC_PARDP DNA-directed RNA polymerase subunit beta' OS=Paracoccus denitrificans (strain Pd 1222) GN=rpoC PE=3 SV=1 218 892 1.0E-37
sp|A3N326|RPOC_ACTP2 DNA-directed RNA polymerase subunit beta' OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpoC PE=3 SV=1 89 916 2.0E-37
sp|B4E5B3|RPOC_BURCJ DNA-directed RNA polymerase subunit beta' OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpoC PE=3 SV=1 89 910 2.0E-37
sp|P33053|RP147_VAR67 DNA-directed RNA polymerase 147 kDa polypeptide OS=Variola virus (isolate Human/India/Ind3/1967) GN=RPO147 PE=3 SV=1 63 893 2.0E-37
sp|O57204|RP147_VACCA DNA-directed RNA polymerase 147 kDa polypeptide OS=Vaccinia virus (strain Ankara) GN=RPO147 PE=3 SV=1 63 893 2.0E-37
sp|Q160X8|RPOC_ROSDO DNA-directed RNA polymerase subunit beta' OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpoC PE=3 SV=1 215 892 2.0E-37
sp|A6VKC4|RPOC_ACTSZ DNA-directed RNA polymerase subunit beta' OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpoC PE=3 SV=1 258 921 2.0E-37
sp|P20504|RP147_VACCC DNA-directed RNA polymerase 147 kDa polypeptide OS=Vaccinia virus (strain Copenhagen) GN=RPO147 PE=3 SV=1 63 893 2.0E-37
sp|Q8RQE8|RPOC_THET8 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpoC PE=1 SV=1 258 912 2.0E-37
sp|Q7W0R8|RPOC_BORPE DNA-directed RNA polymerase subunit beta' OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=rpoC PE=3 SV=1 239 921 2.0E-37
sp|Q7W2G8|RPOC_BORPA DNA-directed RNA polymerase subunit beta' OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=rpoC PE=3 SV=1 239 921 2.0E-37
sp|Q7WRD8|RPOC_BORBR DNA-directed RNA polymerase subunit beta' OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=rpoC PE=3 SV=1 239 921 2.0E-37
sp|A1SEK2|RPOC_NOCSJ DNA-directed RNA polymerase subunit beta' OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpoC PE=3 SV=1 258 899 2.0E-37
sp|B3PK31|RPOC_CELJU DNA-directed RNA polymerase subunit beta' OS=Cellvibrio japonicus (strain Ueda107) GN=rpoC PE=3 SV=2 258 921 3.0E-37
sp|Q72HM6|RPOC_THET2 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpoC PE=3 SV=2 258 912 3.0E-37
sp|Q5HC04|RPOC_EHRRW DNA-directed RNA polymerase subunit beta' OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpoC PE=3 SV=1 258 898 4.0E-37
sp|Q1D7U2|RPOC_MYXXD DNA-directed RNA polymerase subunit beta' OS=Myxococcus xanthus (strain DK 1622) GN=rpoC PE=3 SV=1 190 898 4.0E-37
sp|A9BF32|RPOC_PETMO DNA-directed RNA polymerase subunit beta' OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpoC PE=3 SV=1 204 899 4.0E-37
sp|B1MH61|RPOC_MYCA9 DNA-directed RNA polymerase subunit beta' OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=rpoC PE=3 SV=1 233 935 4.0E-37
sp|Q7MX26|RPOC_PORGI DNA-directed RNA polymerase subunit beta' OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpoC PE=3 SV=1 258 916 4.0E-37
sp|Q82T76|RPOC_NITEU DNA-directed RNA polymerase subunit beta' OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpoC PE=3 SV=1 258 910 4.0E-37
sp|A6UZI2|RPOC_PSEA7 DNA-directed RNA polymerase subunit beta' OS=Pseudomonas aeruginosa (strain PA7) GN=rpoC PE=3 SV=1 258 921 5.0E-37
sp|Q1J0P7|RPOC_DEIGD DNA-directed RNA polymerase subunit beta' OS=Deinococcus geothermalis (strain DSM 11300) GN=rpoC PE=3 SV=1 259 887 5.0E-37
sp|B2JIH3|RPOC_BURP8 DNA-directed RNA polymerase subunit beta' OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpoC PE=3 SV=1 258 910 5.0E-37
sp|A0LRL4|RPOC_ACIC1 DNA-directed RNA polymerase subunit beta' OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpoC PE=3 SV=1 183 899 5.0E-37
sp|Q11HB4|RPOC_CHESB DNA-directed RNA polymerase subunit beta' OS=Chelativorans sp. (strain BNC1) GN=rpoC PE=3 SV=1 258 892 5.0E-37
sp|Q2L2L3|RPOC_BORA1 DNA-directed RNA polymerase subunit beta' OS=Bordetella avium (strain 197N) GN=rpoC PE=3 SV=1 239 921 5.0E-37
sp|Q82DQ4|RPOC_STRAW DNA-directed RNA polymerase subunit beta' OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpoC PE=3 SV=1 259 916 6.0E-37
sp|B3EER3|RPOC_CHLL2 DNA-directed RNA polymerase subunit beta' OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpoC PE=3 SV=1 258 905 6.0E-37
sp|Q3YST4|RPOC_EHRCJ DNA-directed RNA polymerase subunit beta' OS=Ehrlichia canis (strain Jake) GN=rpoC PE=3 SV=1 258 910 6.0E-37
sp|Q6G3X4|RPOC_BARHE DNA-directed RNA polymerase subunit beta' OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpoC PE=3 SV=1 89 892 6.0E-37
sp|B2V7L9|RPOC_SULSY DNA-directed RNA polymerase subunit beta' OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpoC PE=3 SV=1 251 912 6.0E-37
sp|Q39KH4|RPOC_BURL3 DNA-directed RNA polymerase subunit beta' OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpoC PE=3 SV=1 89 910 6.0E-37
sp|Q13TG3|RPOC_BURXL DNA-directed RNA polymerase subunit beta' OS=Burkholderia xenovorans (strain LB400) GN=rpoC PE=3 SV=1 258 910 7.0E-37
sp|B2T758|RPOC_BURPP DNA-directed RNA polymerase subunit beta' OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpoC PE=3 SV=1 258 910 7.0E-37
sp|Q1LI21|RPOC_CUPMC DNA-directed RNA polymerase subunit beta' OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=rpoC PE=3 SV=1 89 910 8.0E-37
sp|Q30X04|RPOC_DESAG DNA-directed RNA polymerase subunit beta' OS=Desulfovibrio alaskensis (strain G20) GN=rpoC PE=3 SV=1 255 916 9.0E-37
sp|A0LII5|RPOC_SYNFM DNA-directed RNA polymerase subunit beta' OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpoC PE=3 SV=1 255 893 9.0E-37
sp|A4JAN3|RPOC_BURVG DNA-directed RNA polymerase subunit beta' OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpoC PE=3 SV=1 89 910 9.0E-37
sp|Q46WD5|RPOC_CUPPJ DNA-directed RNA polymerase subunit beta' OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=rpoC PE=3 SV=1 89 910 1.0E-36
sp|Q9Z999|RPOC_CHLPN DNA-directed RNA polymerase subunit beta' OS=Chlamydia pneumoniae GN=rpoC PE=3 SV=2 218 893 1.0E-36
sp|O84316|RPOC_CHLTR DNA-directed RNA polymerase subunit beta' OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=rpoC PE=3 SV=1 218 921 1.0E-36
sp|Q3KM48|RPOC_CHLTA DNA-directed RNA polymerase subunit beta' OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=rpoC PE=3 SV=1 218 921 1.0E-36
sp|Q0BJ53|RPOC_BURCM DNA-directed RNA polymerase subunit beta' OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpoC PE=3 SV=1 89 910 1.0E-36
sp|B1YRC3|RPOC_BURA4 DNA-directed RNA polymerase subunit beta' OS=Burkholderia ambifaria (strain MC40-6) GN=rpoC PE=3 SV=1 89 910 1.0E-36
sp|B0B7N0|RPOC_CHLT2 DNA-directed RNA polymerase subunit beta' OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=rpoC PE=3 SV=1 218 921 1.0E-36
sp|C6E4R3|RPOC_GEOSM DNA-directed RNA polymerase subunit beta' OS=Geobacter sp. (strain M21) GN=rpoC PE=3 SV=1 89 921 1.0E-36
sp|B0BBU5|RPOC_CHLTB DNA-directed RNA polymerase subunit beta' OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=rpoC PE=3 SV=1 218 921 1.0E-36
sp|B4UDT1|RPOC_ANASK DNA-directed RNA polymerase subunit beta' OS=Anaeromyxobacter sp. (strain K) GN=rpoC PE=3 SV=1 88 898 1.0E-36
sp|A6KYK2|RPOC_BACV8 DNA-directed RNA polymerase subunit beta' OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpoC PE=3 SV=1 258 899 1.0E-36
sp|A5FRK6|RPOC_DEHMB DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpoC PE=3 SV=2 255 910 2.0E-36
sp|Q9PK79|RPOC_CHLMU DNA-directed RNA polymerase subunit beta' OS=Chlamydia muridarum (strain MoPn / Nigg) GN=rpoC PE=3 SV=1 218 921 2.0E-36
sp|Q3ZX00|RPOC_DEHMC DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpoC PE=3 SV=1 255 910 2.0E-36
sp|A4T1P3|RPOC_MYCGI DNA-directed RNA polymerase subunit beta' OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpoC PE=3 SV=1 259 918 2.0E-36
sp|Q0K607|RPOC_CUPNH DNA-directed RNA polymerase subunit beta' OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=rpoC PE=3 SV=1 89 910 2.0E-36
sp|Q255E5|RPOC_CHLFF DNA-directed RNA polymerase subunit beta' OS=Chlamydophila felis (strain Fe/C-56) GN=rpoC PE=3 SV=1 218 921 2.0E-36
sp|A5ELN6|RPOC_BRASB DNA-directed RNA polymerase subunit beta' OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpoC PE=3 SV=1 258 899 2.0E-36
sp|A2SLG4|RPOC_METPP DNA-directed RNA polymerase subunit beta' OS=Methylibium petroleiphilum (strain PM1) GN=rpoC PE=3 SV=1 258 899 3.0E-36
sp|Q2II85|RPOC_ANADE DNA-directed RNA polymerase subunit beta' OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=rpoC PE=3 SV=1 89 898 3.0E-36
sp|B4SG10|RPOC_PELPB DNA-directed RNA polymerase subunit beta' OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpoC PE=3 SV=1 258 905 3.0E-36
sp|C5CKF4|RPOC_VARPS DNA-directed RNA polymerase subunit beta' OS=Variovorax paradoxus (strain S110) GN=rpoC PE=3 SV=1 258 910 4.0E-36
sp|Q47LI6|RPOC_THEFY DNA-directed RNA polymerase subunit beta' OS=Thermobifida fusca (strain YX) GN=rpoC PE=3 SV=1 183 893 4.0E-36
sp|Q6FZM0|RPOC_BARQU DNA-directed RNA polymerase subunit beta' OS=Bartonella quintana (strain Toulouse) GN=rpoC PE=3 SV=1 258 892 4.0E-36
sp|Q8XUZ9|RPOC_RALSO DNA-directed RNA polymerase subunit beta' OS=Ralstonia solanacearum (strain GMI1000) GN=rpoC PE=3 SV=1 258 910 4.0E-36
sp|Q822J2|RPOC_CHLCV DNA-directed RNA polymerase subunit beta' OS=Chlamydophila caviae (strain GPIC) GN=rpoC PE=3 SV=1 218 921 4.0E-36
sp|A8Z5T2|RPOC_SULMW DNA-directed RNA polymerase subunit beta' OS=Sulcia muelleri (strain GWSS) GN=rpoC PE=3 SV=2 234 899 5.0E-36
sp|B0UHX5|RPOC_METS4 DNA-directed RNA polymerase subunit beta' OS=Methylobacterium sp. (strain 4-46) GN=rpoC PE=3 SV=1 258 892 7.0E-36
sp|A4XBQ5|RPOC_SALTO DNA-directed RNA polymerase subunit beta' OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rpoC PE=3 SV=1 259 899 8.0E-36
sp|A6GYT9|RPOC_FLAPJ DNA-directed RNA polymerase subunit beta' OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpoC PE=3 SV=1 201 899 8.0E-36
sp|A5FIJ4|RPOC_FLAJ1 DNA-directed RNA polymerase subunit beta' OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rpoC PE=3 SV=1 256 899 1.0E-35
sp|B8IS79|RPOC_METNO DNA-directed RNA polymerase subunit beta' OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpoC PE=3 SV=1 258 892 1.0E-35
sp|A7IKQ1|RPOC_XANP2 DNA-directed RNA polymerase subunit beta' OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpoC PE=3 SV=1 218 892 1.0E-35
sp|Q3Z8V3|RPOC_DEHM1 DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpoC PE=3 SV=1 255 910 1.0E-35
sp|Q2ST47|RPOC_MYCCT DNA-directed RNA polymerase subunit beta' OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpoC PE=3 SV=1 252 905 2.0E-35
sp|A0M3Y8|RPOC_GRAFK DNA-directed RNA polymerase subunit beta' OS=Gramella forsetii (strain KT0803) GN=rpoC PE=3 SV=1 256 899 2.0E-35
sp|B0RB26|RPOC_CLAMS DNA-directed RNA polymerase subunit beta' OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rpoC PE=3 SV=1 136 899 2.0E-35
sp|A5CUC6|RPOC_CLAM3 DNA-directed RNA polymerase subunit beta' OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rpoC PE=3 SV=1 136 899 2.0E-35
sp|A9ISG4|RPOC_BART1 DNA-directed RNA polymerase subunit beta' OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpoC PE=3 SV=1 89 892 3.0E-35
sp|Q5L5I4|RPOC_CHLAB DNA-directed RNA polymerase subunit beta' OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=rpoC PE=3 SV=1 218 921 3.0E-35
sp|B6YPZ6|RPOC_AZOPC DNA-directed RNA polymerase subunit beta' OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=rpoC PE=3 SV=1 256 916 3.0E-35
sp|B3E7S9|RPOC_GEOLS DNA-directed RNA polymerase subunit beta' OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpoC PE=3 SV=1 89 921 3.0E-35
sp|Q0BUQ5|RPOC_GRABC DNA-directed RNA polymerase subunit beta' OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpoC PE=3 SV=1 257 892 4.0E-35
sp|A1BD24|RPOC_CHLPD DNA-directed RNA polymerase subunit beta' OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpoC PE=3 SV=1 182 905 5.0E-35
sp|A1T4J3|RPOC_MYCVP DNA-directed RNA polymerase subunit beta' OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rpoC PE=3 SV=1 259 916 5.0E-35
sp|P19176|RPOC_PSEPU DNA-directed RNA polymerase subunit beta' OS=Pseudomonas putida GN=rpoC PE=3 SV=3 259 921 5.0E-35
sp|P30761|RPOC_MYCLE DNA-directed RNA polymerase subunit beta' OS=Mycobacterium leprae (strain TN) GN=rpoC PE=3 SV=2 259 911 6.0E-35
sp|B8ZSC6|RPOC_MYCLB DNA-directed RNA polymerase subunit beta' OS=Mycobacterium leprae (strain Br4923) GN=rpoC PE=3 SV=1 259 911 6.0E-35
sp|A8F4G1|RPOC_PSELT DNA-directed RNA polymerase subunit beta' OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpoC PE=3 SV=1 258 899 7.0E-35
sp|A8HTZ1|RPOC_AZOC5 DNA-directed RNA polymerase subunit beta' OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpoC PE=3 SV=1 89 892 8.0E-35
sp|A1KGE8|RPOC_MYCBP DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpoC PE=3 SV=1 259 911 9.0E-35
sp|C1AYV8|RPOC_RHOOB DNA-directed RNA polymerase subunit beta' OS=Rhodococcus opacus (strain B4) GN=rpoC PE=3 SV=1 172 893 9.0E-35
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 258 431 1.0E-34
sp|P08775|RPB1_MOUSE DNA-directed RNA polymerase II subunit RPB1 OS=Mus musculus GN=Polr2a PE=1 SV=3 1061 1419 1.0E-34
sp|P9WGY6|RPOC_MYCTO DNA-directed RNA polymerase subunit beta' OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpoC PE=3 SV=1 259 911 1.0E-34
sp|C1AL01|RPOC_MYCBT DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpoC PE=3 SV=1 259 911 1.0E-34
sp|P24928|RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 1061 1419 6.0E-34
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 1051 1199 2.0E-30
sp|P27625|RPC1_PLAFA DNA-directed RNA polymerase III subunit RPC1 OS=Plasmodium falciparum PE=3 SV=1 1280 1419 1.0E-29
sp|P25202|RPC1_GIAIN DNA-directed RNA polymerase III subunit RPC1 OS=Giardia intestinalis GN=RPOA3 PE=3 SV=1 16 284 4.0E-20
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 1031 1181 4.0E-17
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 1061 1158 5.0E-17
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 1038 1158 9.0E-17
sp|P14248|RPB1_PLAFD DNA-directed RNA polymerase II subunit RPB1 OS=Plasmodium falciparum (isolate CDC / Honduras) GN=RPII PE=3 SV=1 1280 1419 2.0E-16
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 1034 1158 7.0E-16
sp|Q250N9|RPOC_DESHY DNA-directed RNA polymerase subunit beta' OS=Desulfitobacterium hafniense (strain Y51) GN=rpoC PE=3 SV=1 1066 1152 5.0E-15
sp|A0PXT9|RPOC_CLONN DNA-directed RNA polymerase subunit beta' OS=Clostridium novyi (strain NT) GN=rpoC PE=3 SV=1 1070 1160 3.0E-13
sp|A9B6J1|RPOC_HERA2 DNA-directed RNA polymerase subunit beta' OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpoC PE=3 SV=1 1067 1414 3.0E-13
sp|Q2FJ97|RPOC_STAA3 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain USA300) GN=rpoC PE=3 SV=2 1067 1126 1.0E-12
sp|Q49V53|RPOC_STAS1 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpoC PE=3 SV=1 1067 1126 1.0E-12
sp|Q2YSB8|RPOC_STAAB DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpoC PE=3 SV=1 1067 1126 1.0E-12
sp|Q6GJC5|RPOC_STAAR DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MRSA252) GN=rpoC PE=3 SV=1 1067 1126 1.0E-12
sp|P60286|RPOC_STAAW DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MW2) GN=rpoC PE=3 SV=1 1067 1126 1.0E-12
sp|Q6GBU4|RPOC_STAAS DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain MSSA476) GN=rpoC PE=3 SV=1 1067 1126 1.0E-12
sp|P60285|RPOC_STAAN DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain N315) GN=rpoC PE=1 SV=1 1067 1126 1.0E-12
sp|P60284|RPOC_STAAM DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpoC PE=3 SV=1 1067 1126 1.0E-12
sp|Q5HID2|RPOC_STAAC DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain COL) GN=rpoC PE=3 SV=1 1067 1126 1.0E-12
sp|Q2G0N5|RPOC_STAA8 DNA-directed RNA polymerase subunit beta' OS=Staphylococcus aureus (strain NCTC 8325) GN=rpoC PE=3 SV=2 1067 1126 1.0E-12
sp|P0C1T4|RPOC_STAAU DNA-directed RNA polymerase subunit beta' (Fragment) OS=Staphylococcus aureus GN=rpoC PE=3 SV=1 1067 1126 1.0E-12
sp|Q4L3K4|RPOC_STAHJ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpoC PE=3 SV=1 1067 1126 1.0E-12
sp|P77839|RPOC_BROTH DNA-directed RNA polymerase subunit beta' (Fragment) OS=Brochothrix thermosphacta GN=rpoC PE=3 SV=2 1065 1126 1.0E-12
sp|Q8CQ83|RPOC_STAES DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpoC PE=3 SV=1 1067 1126 1.0E-12
sp|Q5HRK9|RPOC_STAEQ DNA-directed RNA polymerase subunit beta' OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpoC PE=3 SV=1 1067 1126 1.0E-12
sp|P77819|RPOC_BACAN DNA-directed RNA polymerase subunit beta' OS=Bacillus anthracis GN=rpoC PE=3 SV=3 1067 1149 2.0E-12
sp|A9VP70|RPOC_BACWK DNA-directed RNA polymerase subunit beta' OS=Bacillus weihenstephanensis (strain KBAB4) GN=rpoC PE=3 SV=1 1067 1149 2.0E-12
sp|Q81J47|RPOC_BACCR DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpoC PE=3 SV=1 1067 1149 2.0E-12
sp|Q73FA3|RPOC_BACC1 DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpoC PE=3 SV=1 1067 1149 2.0E-12
sp|Q63H97|RPOC_BACCZ DNA-directed RNA polymerase subunit beta' OS=Bacillus cereus (strain ZK / E33L) GN=rpoC PE=3 SV=1 1067 1149 2.0E-12
sp|Q6HPR5|RPOC_BACHK DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=rpoC PE=3 SV=1 1067 1149 2.0E-12
sp|A0R8H3|RPOC_BACAH DNA-directed RNA polymerase subunit beta' OS=Bacillus thuringiensis (strain Al Hakam) GN=rpoC PE=3 SV=1 1067 1149 2.0E-12
sp|A0AF64|RPOC_LISW6 DNA-directed RNA polymerase subunit beta' OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=rpoC PE=3 SV=1 1031 1126 2.0E-12
sp|A7GK13|RPOC_BACCN DNA-directed RNA polymerase subunit beta' OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpoC PE=3 SV=1 1067 1149 3.0E-12
sp|Q82Z41|RPOC_ENTFA DNA-directed RNA polymerase subunit beta' OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=rpoC PE=3 SV=1 1065 1126 3.0E-12
sp|Q3Z8V3|RPOC_DEHM1 DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpoC PE=3 SV=1 1067 1409 3.0E-12
sp|Q5L404|RPOC_GEOKA DNA-directed RNA polymerase subunit beta' OS=Geobacillus kaustophilus (strain HTA426) GN=rpoC PE=3 SV=1 1067 1151 4.0E-12
sp|Q8YA96|RPOC_LISMO DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=rpoC PE=3 SV=1 1066 1126 4.0E-12
sp|P10964|RPA1_YEAST DNA-directed RNA polymerase I subunit RPA190 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPA190 PE=1 SV=2 1241 1422 5.0E-12
sp|Q724E9|RPOC_LISMF DNA-directed RNA polymerase subunit beta' OS=Listeria monocytogenes serotype 4b (strain F2365) GN=rpoC PE=3 SV=1 1066 1126 5.0E-12
sp|P77879|RPOC_LISIN DNA-directed RNA polymerase subunit beta' OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=rpoC PE=3 SV=3 1066 1126 5.0E-12
sp|P96177|RPOC_WEIHE DNA-directed RNA polymerase subunit beta' (Fragment) OS=Weissella hellenica GN=rpoC PE=3 SV=1 1067 1126 5.0E-12
sp|Q5WLR9|RPOC_BACSK DNA-directed RNA polymerase subunit beta' OS=Bacillus clausii (strain KSM-K16) GN=rpoC PE=3 SV=1 1065 1126 6.0E-12
sp|Q8ETY7|RPOC_OCEIH DNA-directed RNA polymerase subunit beta' OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpoC PE=3 SV=1 1065 1126 6.0E-12
sp|Q9Z9M1|RPOC_BACHD DNA-directed RNA polymerase subunit beta' OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=rpoC PE=3 SV=1 1065 1126 6.0E-12
sp|P96178|RPOC_WEIPA DNA-directed RNA polymerase subunit beta' (Fragment) OS=Weissella paramesenteroides GN=rpoC PE=3 SV=1 1067 1126 6.0E-12
sp|Q18CF3|RPOC_PEPD6 DNA-directed RNA polymerase subunit beta' OS=Peptoclostridium difficile (strain 630) GN=rpoC PE=3 SV=1 1066 1126 7.0E-12
sp|Q8R7U7|RPOC_CALS4 DNA-directed RNA polymerase subunit beta' OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpoC PE=3 SV=1 1067 1126 9.0E-12
sp|O54889|RPA1_RAT DNA-directed RNA polymerase I subunit RPA1 OS=Rattus norvegicus GN=Polr1a PE=1 SV=1 1273 1422 1.0E-11
sp|B1YGU3|RPOC_EXIS2 DNA-directed RNA polymerase subunit beta' OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=rpoC PE=3 SV=1 1034 1126 1.0E-11
sp|P77882|RPOC_LISGR DNA-directed RNA polymerase subunit beta' (Fragment) OS=Listeria grayi GN=rpoC PE=3 SV=2 1066 1126 1.0E-11
sp|B2A4D2|RPOC_NATTJ DNA-directed RNA polymerase subunit beta' OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpoC PE=3 SV=1 1035 1126 1.0E-11
sp|B1KSN2|RPOC_CLOBM DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpoC PE=3 SV=1 1057 1118 1.0E-11
sp|B1IGG1|RPOC_CLOBK DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Okra / Type B1) GN=rpoC PE=3 SV=1 1057 1118 1.0E-11
sp|A5I7L3|RPOC_CLOBH DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpoC PE=3 SV=1 1057 1118 1.0E-11
sp|A7FZ76|RPOC_CLOB1 DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpoC PE=3 SV=1 1057 1118 1.0E-11
sp|A6LPQ5|RPOC_CLOB8 DNA-directed RNA polymerase subunit beta' OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpoC PE=3 SV=1 1067 1139 1.0E-11
sp|A4IJI2|RPOC_GEOTN DNA-directed RNA polymerase subunit beta' OS=Geobacillus thermodenitrificans (strain NG80-2) GN=rpoC PE=3 SV=2 1067 1126 2.0E-11
sp|P37871|RPOC_BACSU DNA-directed RNA polymerase subunit beta' OS=Bacillus subtilis (strain 168) GN=rpoC PE=1 SV=4 1065 1126 2.0E-11
sp|Q3A9Q8|RPOC_CARHZ DNA-directed RNA polymerase subunit beta' OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpoC PE=3 SV=1 1067 1126 2.0E-11
sp|B0TC49|RPOC_HELMI DNA-directed RNA polymerase subunit beta' OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpoC PE=3 SV=1 1067 1126 2.0E-11
sp|A8MLD3|RPOC_ALKOO DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus oremlandii (strain OhILAs) GN=rpoC PE=3 SV=1 1067 1126 2.0E-11
sp|A7GJ81|RPOC_CLOBL DNA-directed RNA polymerase subunit beta' OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpoC PE=3 SV=1 1057 1118 2.0E-11
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 1275 1422 3.0E-11
sp|Q65PB4|RPOC_BACLD DNA-directed RNA polymerase subunit beta' OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpoC PE=3 SV=1 1067 1116 3.0E-11
sp|A7Z0N0|RPOC_BACMF DNA-directed RNA polymerase subunit beta' OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpoC PE=3 SV=1 1067 1116 3.0E-11
sp|A8F977|RPOC_BACP2 DNA-directed RNA polymerase subunit beta' OS=Bacillus pumilus (strain SAFR-032) GN=rpoC PE=3 SV=1 1067 1116 3.0E-11
sp|B0KCJ3|RPOC_THEP3 DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpoC PE=3 SV=1 1067 1126 3.0E-11
sp|A2RC52|RPOC_STRPG DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|Q5XE96|RPOC_STRP6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|Q1J8X0|RPOC_STRPF DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|Q48VR0|RPOC_STRPM DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|Q8P2Y2|RPOC_STRP8 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|P0C0E0|RPOC_STRP1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M1 GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|Q1JJ22|RPOC_STRPD DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|P0DF33|RPOC_STRPQ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|P0DF32|RPOC_STRP3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|Q1JNX6|RPOC_STRPC DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|Q1JE19|RPOC_STRPB DNA-directed RNA polymerase subunit beta' OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|P0C0D9|RPOC_STRPY DNA-directed RNA polymerase subunit beta' (Fragment) OS=Streptococcus pyogenes GN=rpoC PE=3 SV=1 1067 1150 3.0E-11
sp|A6TWI9|RPOC_ALKMQ DNA-directed RNA polymerase subunit beta' OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpoC PE=3 SV=1 1067 1126 3.0E-11
sp|Q0SQD7|RPOC_CLOPS DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain SM101 / Type A) GN=rpoC PE=3 SV=1 1070 1159 3.0E-11
sp|P0C2E8|RPOC_CLOPE DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain 13 / Type A) GN=rpoC PE=3 SV=1 1070 1159 3.0E-11
sp|Q0TMN9|RPOC_CLOP1 DNA-directed RNA polymerase subunit beta' OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpoC PE=3 SV=1 1070 1159 3.0E-11
sp|A5FRK6|RPOC_DEHMB DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpoC PE=3 SV=2 1067 1409 3.0E-11
sp|C0M7R5|RPOC_STRE4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. equi (strain 4047) GN=rpoC PE=3 SV=1 1067 1150 4.0E-11
sp|C0MEE4|RPOC_STRS7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=rpoC PE=3 SV=1 1067 1150 4.0E-11
sp|Q88XZ2|RPOC_LACPL DNA-directed RNA polymerase subunit beta' OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=rpoC PE=3 SV=1 1066 1114 4.0E-11
sp|Q97EH0|RPOC_CLOAB DNA-directed RNA polymerase subunit beta' OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpoC PE=3 SV=1 1070 1118 4.0E-11
sp|A4XBQ5|RPOC_SALTO DNA-directed RNA polymerase subunit beta' OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=rpoC PE=3 SV=1 1067 1128 4.0E-11
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 21 136 5.0E-11
sp|A4XI31|RPOC_CALS8 DNA-directed RNA polymerase subunit beta' OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpoC PE=3 SV=2 1067 1126 5.0E-11
sp|B0K5G9|RPOC_THEPX DNA-directed RNA polymerase subunit beta' OS=Thermoanaerobacter sp. (strain X514) GN=rpoC PE=3 SV=2 1067 1126 5.0E-11
sp|Q67JT4|RPOC_SYMTH DNA-directed RNA polymerase subunit beta' OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=rpoC PE=3 SV=1 1067 1125 5.0E-11
sp|A3DIZ5|RPOC_CLOTH DNA-directed RNA polymerase subunit beta' OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=rpoC PE=3 SV=1 1070 1126 5.0E-11
sp|Q3ZX00|RPOC_DEHMC DNA-directed RNA polymerase subunit beta' OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpoC PE=3 SV=1 1067 1409 5.0E-11
sp|P15398|RPA1_SCHPO DNA-directed RNA polymerase I subunit rpa1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpa1 PE=1 SV=2 1283 1418 6.0E-11
sp|B2G8Y5|RPOC_LACRJ DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain JCM 1112) GN=rpoC PE=3 SV=1 1067 1126 6.0E-11
sp|A5VLL3|RPOC_LACRD DNA-directed RNA polymerase subunit beta' OS=Lactobacillus reuteri (strain DSM 20016) GN=rpoC PE=3 SV=1 1067 1126 6.0E-11
sp|O95602|RPA1_HUMAN DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens GN=POLR1A PE=1 SV=2 1247 1422 7.0E-11
sp|A5D5I3|RPOC_PELTS DNA-directed RNA polymerase subunit beta' OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpoC PE=3 SV=1 1050 1126 8.0E-11
sp|A5N4P0|RPOC_CLOK5 DNA-directed RNA polymerase subunit beta' OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=rpoC PE=3 SV=1 1067 1126 8.0E-11
sp|A8AZI2|RPOC_STRGC DNA-directed RNA polymerase subunit beta' OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=rpoC PE=3 SV=1 1067 1126 1.0E-10
sp|Q9CEN7|RPOC_LACLA DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=rpoC PE=3 SV=2 1067 1126 1.0E-10
sp|A2RML8|RPOC_LACLM DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=rpoC PE=3 SV=1 1067 1126 1.0E-10
sp|Q02X60|RPOC_LACLS DNA-directed RNA polymerase subunit beta' OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=rpoC PE=3 SV=1 1067 1126 1.0E-10
sp|A4VSK3|RPOC_STRSY DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 05ZYH33) GN=rpoC PE=3 SV=2 1067 1126 1.0E-10
sp|A4VYU4|RPOC_STRS2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus suis (strain 98HAH33) GN=rpoC PE=3 SV=2 1067 1126 1.0E-10
sp|Q03IK3|RPOC_STRTD DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=rpoC PE=3 SV=1 1067 1150 1.0E-10
sp|Q5M2F6|RPOC_STRT2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=rpoC PE=3 SV=1 1067 1150 1.0E-10
sp|Q5LXV4|RPOC_STRT1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus thermophilus (strain CNRZ 1066) GN=rpoC PE=3 SV=1 1067 1150 1.0E-10
sp|B2GDX6|RPOC_LACF3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=rpoC PE=3 SV=1 1066 1114 1.0E-10
sp|Q1GBM4|RPOC_LACDA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=rpoC PE=3 SV=1 1066 1126 1.0E-10
sp|Q04C21|RPOC_LACDB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpoC PE=3 SV=1 1066 1126 1.0E-10
sp|Q034X1|RPOC_LACC3 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain ATCC 334) GN=rpoC PE=3 SV=1 1066 1126 1.0E-10
sp|B3WAM7|RPOC_LACCB DNA-directed RNA polymerase subunit beta' OS=Lactobacillus casei (strain BL23) GN=rpoC PE=3 SV=1 1066 1126 1.0E-10
sp|B1I1M9|RPOC_DESAP DNA-directed RNA polymerase subunit beta' OS=Desulforudis audaxviator (strain MP104C) GN=rpoC PE=3 SV=1 1067 1118 1.0E-10
sp|Q890N5|RPOC_CLOTE DNA-directed RNA polymerase subunit beta' OS=Clostridium tetani (strain Massachusetts / E88) GN=rpoC PE=3 SV=2 1070 1126 1.0E-10
sp|B0S2E5|RPOC_FINM2 DNA-directed RNA polymerase subunit beta' OS=Finegoldia magna (strain ATCC 29328) GN=rpoC PE=3 SV=2 1067 1126 1.0E-10
sp|P77917|RPOC_PEDAC DNA-directed RNA polymerase subunit beta' (Fragment) OS=Pediococcus acidilactici GN=rpoC PE=3 SV=2 1067 1116 1.0E-10
sp|A9NEL8|RPOC_ACHLI DNA-directed RNA polymerase subunit beta' OS=Acholeplasma laidlawii (strain PG-8A) GN=rpoC PE=3 SV=1 1067 1116 1.0E-10
sp|Q9KWU6|RPOC_THEAQ DNA-directed RNA polymerase subunit beta' OS=Thermus aquaticus GN=rpoC PE=1 SV=2 1003 1126 1.0E-10
sp|Q8E238|RPOC_STRA5 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=rpoC PE=3 SV=1 1067 1126 2.0E-10
sp|Q8E7J7|RPOC_STRA3 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype III (strain NEM316) GN=rpoC PE=3 SV=1 1067 1126 2.0E-10
sp|Q3K3L1|RPOC_STRA1 DNA-directed RNA polymerase subunit beta' OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=rpoC PE=3 SV=1 1067 1126 2.0E-10
sp|Q8DS47|RPOC_STRMU DNA-directed RNA polymerase subunit beta' OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=rpoC PE=3 SV=2 1067 1126 2.0E-10
sp|B9DSZ6|RPOC_STRU0 DNA-directed RNA polymerase subunit beta' OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=rpoC PE=3 SV=1 1067 1126 2.0E-10
sp|Q5FM96|RPOC_LACAC DNA-directed RNA polymerase subunit beta' OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=rpoC PE=3 SV=1 1066 1116 2.0E-10
sp|A8YXJ9|RPOC_LACH4 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus helveticus (strain DPC 4571) GN=rpoC PE=3 SV=1 1066 1116 2.0E-10
sp|Q0AUH3|RPOC_SYNWW DNA-directed RNA polymerase subunit beta' OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpoC PE=3 SV=1 1066 1126 2.0E-10
sp|A7NJM0|RPOC_ROSCS DNA-directed RNA polymerase subunit beta' OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpoC PE=3 SV=1 1067 1177 2.0E-10
sp|Q03EB0|RPOC_PEDPA DNA-directed RNA polymerase subunit beta' OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=rpoC PE=3 SV=1 1067 1114 2.0E-10
sp|P94899|RPOC_LEUPS DNA-directed RNA polymerase subunit beta' (Fragment) OS=Leuconostoc pseudomesenteroides GN=rpoC PE=3 SV=1 1066 1149 2.0E-10
sp|Q38UQ3|RPOC_LACSS DNA-directed RNA polymerase subunit beta' OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=rpoC PE=3 SV=1 1025 1126 2.0E-10
sp|Q47LI6|RPOC_THEFY DNA-directed RNA polymerase subunit beta' OS=Thermobifida fusca (strain YX) GN=rpoC PE=3 SV=1 1020 1116 2.0E-10
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 1308 1419 3.0E-10
sp|A3CKD4|RPOC_STRSV DNA-directed RNA polymerase subunit beta' OS=Streptococcus sanguinis (strain SK36) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|B5E2F2|RPOC_STRP4 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 19F (strain G54) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|C1CMQ7|RPOC_STRZP DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain P1031) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|C1CTL3|RPOC_STRZT DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|C1CGP3|RPOC_STRZJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain JJA) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|B2IM39|RPOC_STRPS DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain CGSP14) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|Q97NQ8|RPOC_STRPN DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|B1I8R3|RPOC_STRPI DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|C1CA05|RPOC_STRP7 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain 70585) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|B8ZNW6|RPOC_STRPJ DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|Q04IK7|RPOC_STRP2 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|Q8DNF1|RPOC_STRR6 DNA-directed RNA polymerase subunit beta' OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=rpoC PE=3 SV=1 1067 1126 3.0E-10
sp|A5USR6|RPOC_ROSS1 DNA-directed RNA polymerase subunit beta' OS=Roseiflexus sp. (strain RS-1) GN=rpoC PE=3 SV=1 1067 1178 3.0E-10
sp|B1MVW7|RPOC_LEUCK DNA-directed RNA polymerase subunit beta' OS=Leuconostoc citreum (strain KM20) GN=rpoC PE=3 SV=1 1066 1116 3.0E-10
sp|P94892|RPOC_LEUMM DNA-directed RNA polymerase subunit beta' OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=rpoC PE=3 SV=2 1066 1116 3.0E-10
sp|Q6YQW2|RPOC_ONYPE DNA-directed RNA polymerase subunit beta' OS=Onion yellows phytoplasma (strain OY-M) GN=rpoC PE=3 SV=1 1067 1118 3.0E-10
sp|Q2NJ16|RPOC_AYWBP DNA-directed RNA polymerase subunit beta' OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=rpoC PE=3 SV=1 1067 1118 3.0E-10
sp|B1W441|RPOC_STRGG DNA-directed RNA polymerase subunit beta' OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpoC PE=3 SV=1 1067 1116 3.0E-10
sp|Q8RQE8|RPOC_THET8 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpoC PE=1 SV=1 1003 1126 3.0E-10
sp|Q72HM6|RPOC_THET2 DNA-directed RNA polymerase subunit beta' OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpoC PE=3 SV=2 1003 1126 3.0E-10
sp|A9BF32|RPOC_PETMO DNA-directed RNA polymerase subunit beta' OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=rpoC PE=3 SV=1 1057 1123 3.0E-10
sp|Q82DQ4|RPOC_STRAW DNA-directed RNA polymerase subunit beta' OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpoC PE=3 SV=1 1067 1116 3.0E-10
sp|A8F4G1|RPOC_PSELT DNA-directed RNA polymerase subunit beta' OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpoC PE=3 SV=1 1057 1185 4.0E-10
sp|Q1WVA4|RPOC_LACS1 DNA-directed RNA polymerase subunit beta' OS=Lactobacillus salivarius (strain UCC118) GN=rpoC PE=3 SV=1 1066 1126 6.0E-10
sp|B8G4U8|RPOC_CHLAD DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=rpoC PE=3 SV=1 1067 1116 6.0E-10
sp|B9LL90|RPOC_CHLSY DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=rpoC PE=3 SV=1 1067 1116 6.0E-10
sp|A9WH11|RPOC_CHLAA DNA-directed RNA polymerase subunit beta' OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=rpoC PE=3 SV=1 1067 1116 6.0E-10
sp|Q2ST47|RPOC_MYCCT DNA-directed RNA polymerase subunit beta' OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpoC PE=3 SV=1 1067 1223 6.0E-10
sp|P91875|RPA1_DROME DNA-directed RNA polymerase I subunit RPA1 OS=Drosophila melanogaster GN=RpI1 PE=1 SV=2 1270 1422 7.0E-10
sp|A0LRL4|RPOC_ACIC1 DNA-directed RNA polymerase subunit beta' OS=Acidothermus cellulolyticus (strain ATCC 43068 / 11B) GN=rpoC PE=3 SV=1 1067 1116 9.0E-10
sp|C1AYV8|RPOC_RHOOB DNA-directed RNA polymerase subunit beta' OS=Rhodococcus opacus (strain B4) GN=rpoC PE=3 SV=1 1067 1116 9.0E-10
sp|Q046D1|RPOC_LACGA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=rpoC PE=3 SV=1 1067 1116 1.0E-09
sp|Q74L94|RPOC_LACJO DNA-directed RNA polymerase subunit beta' OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=rpoC PE=3 SV=1 1067 1116 1.0E-09
sp|Q04E86|RPOC_OENOB DNA-directed RNA polymerase subunit beta' OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=rpoC PE=3 SV=1 1067 1116 1.0E-09
sp|P95405|RPOC_OENOE DNA-directed RNA polymerase subunit beta' (Fragment) OS=Oenococcus oeni GN=rpoC PE=3 SV=1 1067 1116 1.0E-09
sp|Q03PV0|RPOC_LACBA DNA-directed RNA polymerase subunit beta' OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=rpoC PE=3 SV=1 1066 1114 3.0E-09
sp|Q9SVY0|NRPA1_ARATH DNA-directed RNA polymerase I subunit 1 OS=Arabidopsis thaliana GN=NRPA1 PE=3 SV=1 1306 1424 6.0E-09
sp|A5CUC6|RPOC_CLAM3 DNA-directed RNA polymerase subunit beta' OS=Clavibacter michiganensis subsp. michiganensis (strain NCPPB 382) GN=rpoC PE=3 SV=1 1067 1124 8.0E-09
sp|A1SEK2|RPOC_NOCSJ DNA-directed RNA polymerase subunit beta' OS=Nocardioides sp. (strain BAA-499 / JS614) GN=rpoC PE=3 SV=1 1067 1124 1.0E-08
sp|Q1J0P7|RPOC_DEIGD DNA-directed RNA polymerase subunit beta' OS=Deinococcus geothermalis (strain DSM 11300) GN=rpoC PE=3 SV=1 1067 1125 2.0E-08
sp|B0RB26|RPOC_CLAMS DNA-directed RNA polymerase subunit beta' OS=Clavibacter michiganensis subsp. sepedonicus (strain ATCC 33113 / DSM 20744 / JCM 9667 / LMG 2889 / C-1) GN=rpoC PE=3 SV=1 1067 1124 2.0E-08
sp|A1KGE8|RPOC_MYCBP DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=rpoC PE=3 SV=1 1016 1116 4.0E-08
sp|C1AL01|RPOC_MYCBT DNA-directed RNA polymerase subunit beta' OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=rpoC PE=3 SV=1 1016 1116 4.0E-08
sp|P9WGY6|RPOC_MYCTO DNA-directed RNA polymerase subunit beta' OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=rpoC PE=3 SV=1 1016 1116 5.0E-08
sp|P30761|RPOC_MYCLE DNA-directed RNA polymerase subunit beta' OS=Mycobacterium leprae (strain TN) GN=rpoC PE=3 SV=2 1067 1116 6.0E-08
sp|B8ZSC6|RPOC_MYCLB DNA-directed RNA polymerase subunit beta' OS=Mycobacterium leprae (strain Br4923) GN=rpoC PE=3 SV=1 1067 1116 6.0E-08
sp|P16355|RPA1_TRYBB DNA-directed RNA polymerase I subunit RPA1 OS=Trypanosoma brucei brucei GN=TRP11 PE=1 SV=1 1065 1159 7.0E-08
sp|P28363|RPA1_EUPOC DNA-directed RNA polymerase I subunit RPA1 (Fragment) OS=Euplotes octocarinatus GN=RPA1 PE=3 SV=1 17 121 8.0E-08
sp|A4T1P3|RPOC_MYCGI DNA-directed RNA polymerase subunit beta' OS=Mycobacterium gilvum (strain PYR-GCK) GN=rpoC PE=3 SV=1 1067 1116 1.0E-07
sp|A1T4J3|RPOC_MYCVP DNA-directed RNA polymerase subunit beta' OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=rpoC PE=3 SV=1 1067 1116 1.0E-07
sp|Q86H36|RPA1_DICDI DNA-directed RNA polymerase I subunit rpa1 OS=Dictyostelium discoideum GN=polr1a PE=3 SV=1 17 161 4.0E-07
sp|P47716|RPOC_MYCGA DNA-directed RNA polymerase subunit beta' OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=rpoC PE=3 SV=2 1067 1113 4.0E-07
sp|B1MH61|RPOC_MYCA9 DNA-directed RNA polymerase subunit beta' OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=rpoC PE=3 SV=1 1067 1116 5.0E-07
sp|Q8EWX0|RPOC_MYCPE DNA-directed RNA polymerase subunit beta' OS=Mycoplasma penetrans (strain HF-2) GN=rpoC PE=3 SV=1 1067 1113 7.0E-07
sp|O35134|RPA1_MOUSE DNA-directed RNA polymerase I subunit RPA1 OS=Mus musculus GN=Polr1a PE=1 SV=2 19 118 9.0E-07
sp|P47582|RPOC_MYCGE DNA-directed RNA polymerase subunit beta' OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=rpoC PE=3 SV=1 1067 1113 9.0E-07
sp|B5YFV7|RPOC_THEYD DNA-directed RNA polymerase subunit beta' OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpoC PE=3 SV=1 1028 1107 1.0E-06
sp|Q6AP77|RPOC_DESPS DNA-directed RNA polymerase subunit beta' OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpoC PE=3 SV=1 1019 1106 1.0E-06
sp|A0M3Y8|RPOC_GRAFK DNA-directed RNA polymerase subunit beta' OS=Gramella forsetii (strain KT0803) GN=rpoC PE=3 SV=1 1067 1100 1.0E-06
sp|A8EVZ3|RPOC_ARCB4 DNA-directed RNA polymerase subunit beta' OS=Arcobacter butzleri (strain RM4018) GN=rpoC PE=3 SV=1 1034 1105 2.0E-06
sp|A6Q1M4|RPOC_NITSB DNA-directed RNA polymerase subunit beta' OS=Nitratiruptor sp. (strain SB155-2) GN=rpoC PE=3 SV=1 1067 1102 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0003677 DNA binding Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0008152 metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016740 transferase activity No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0097747 RNA polymerase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034062 5'-3' RNA polymerase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0140098 catalytic activity, acting on RNA No
GO:0090304 nucleic acid metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1785
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4551
Ophiocordyceps australis map64 (Brazil) OphauB2|5424
Ophiocordyceps camponoti-floridani Ophcf2|02492
Ophiocordyceps camponoti-rufipedis Ophun1|4060 (this protein)
Ophiocordyceps kimflemingae Ophio5|8559
Ophiocordyceps subramaniannii Hirsu2|172

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4060
MDPSTGDPVKKQLVDKLPKRFKGIKFGIQSNQDITNQAVLEVSDRLLYDIENNRAPYRHGPLDPRLGTSSKSGRC
ATCHNALQHCTGHFGHVRLPLPAFHVGYLRFVITILQNICKDCGRVLLEESDRQTFLRDLRRPFLDNLRRTQICK
RINEQCRKAKTCPYCGSINGQIRKVGVLKLAHDKFVTYNKSTSAKKVAPESKVKFDESFSEAKRENPELEKHLRK
AMEDLNPLRVLNLFKMISPSDCELLGLDPAEGRPEMFIWQYLPAPPICIRPSVAQDNASTEDDITTKLADIVWVS
GMIRSALQKGSPIQTIMEQWEYLQTQIAMYVNSDVPGLQQPGFGKPSRGFCQRLKGKQGRFRGNLSGKRVDFSGR
TVISPDPNLGVDQVAVPELVAKNLTYPERVNRQNIEKLRECVRNGCDKWPGAKAVLRKEGDEIAKYSLVWVDRER
QARNLAIGDVVERHLEDGDVVLFNRQPSLHKLSIMSHLVKVRPWRTFRLNECVCNPYNADFDGDEMNLHVPQTEE
ARAEAINLMGVKYNLATPKNGEPIIAATQDFITAAFLLSSKDRFFDRKTFTFICTHMLDGKTRLDLPPPAIMAPR
RLWTGKQVFNVLMRPNKSSPVKVNLDAKCRAYKARPGQCPDMDPNDGWLVVRNSEVMCGRMDKSTVGSGKKDSIF
YVILRDFGPDEAVSAMNRLAKLCARHLANRGFSIGVVDVFPTASLNTEKEGLVSMAYKQCDDLIETFKRGQLDKA
PGCNMEQTLENVISGILSKVRQQAGTYCIDTLSRNNAPLIMAQSGSKGSDINVAQMVAVVGQQIIGGQRVPDGFQ
DRSLPHFHKNARQPPSKGFVKNSFYSGLFPTEFLFHAISGREGLVDTAVKTAETGYMSRRLMKTLEDLSTQYDDT
VRTSGGVVVQFQFGADKLDPVDMEGSAEPVHFQRTWTHAENMTRDNTEPTMTPDEVRTFCGSMLDVERRRFPRRG
LLQGEPLDYDDASDYAIDEHEGARRFLKTIETHVEGLASKLERVRTLAGVQDDGFLPTALAEAHVDRTAKVTSTT
LRLFIRMCLEKYKKAHVEPGHAVGAVGAQSIGEPGTQMTLKTFHFAGVAGMSITQGVPRIKEIIGASKKISTPVI
TCPLLNNAQIEAAKMVKGRIEKTYVSDVLHFIEDEWQADEGNVVLQIDRGALSDMHLGIGIFDIAAAICKQRKLK
LQPADLTLEGDRIVIRVRDSSDSTTAKRTAAAGRGKTTGPGGDGDMLLRANFLRRSLPAVPISGYAEATRAIIQT
SEQNTHMVLVEGYGLRECMTTEGVIGTQTRSNHVNECYDILGVEAARSTIANEIGDVMGDMGIDPRHIQLLADVM
TYKGEILGISRFGLQKMRDSVLQLASFEKTPDHLFDAAAGMKTDRIEGVSECIIMGQTMSVGTGAFHVVRRLGIQ
PPDLEPKPTLFEDAWTAEMAVRKGVRRRG*
Coding >Ophun1|4060
ATGGACCCCTCGACGGGCGACCCCGTCAAGAAGCAACTCGTCGATAAGCTTCCAAAGCGCTTCAAGGGCATCAAA
TTCGGGATTCAGTCCAACCAGGATATCACGAATCAAGCCGTCCTCGAAGTCTCCGATCGTCTGCTCTACGATATC
GAAAACAACCGCGCTCCCTACCGCCATGGACCCCTAGATCCCCGACTAGGCACCTCTAGCAAGTCGGGCAGATGC
GCCACTTGCCATAATGCCCTCCAGCATTGTACCGGCCACTTTGGCCACGTCAGGCTTCCTCTACCAGCCTTTCAC
GTCGGATATCTACGCTTCGTCATCACTATTCTGCAGAATATCTGCAAGGATTGTGGCCGCGTTCTTCTCGAAGAG
TCCGATCGACAGACGTTCCTCCGCGATCTTCGTCGTCCCTTTCTAGACAACCTTCGTCGCACTCAAATCTGCAAG
CGTATCAATGAGCAGTGTCGCAAGGCAAAAACATGTCCCTACTGCGGATCCATCAACGGCCAGATCCGCAAGGTA
GGCGTCCTCAAGCTGGCGCACGACAAGTTTGTCACGTACAACAAGTCGACGTCGGCCAAGAAAGTGGCGCCAGAG
AGCAAGGTCAAATTCGACGAGTCCTTCTCCGAGGCCAAGCGCGAGAACCCCGAGCTGGAAAAGCACTTGCGCAAG
GCCATGGAGGACCTCAACCCTCTCCGCGTCTTGAATCTGTTCAAGATGATTAGCCCTTCCGACTGCGAGCTTTTG
GGTCTCGATCCAGCCGAGGGCCGGCCGGAAATGTTCATATGGCAGTATCTGCCGGCGCCCCCGATCTGCATCCGG
CCGTCAGTCGCTCAAGACAATGCGAGTACGGAAGACGATATCACGACCAAGCTCGCCGACATCGTCTGGGTCAGC
GGCATGATTCGCTCTGCGCTGCAAAAAGGCTCTCCCATACAGACCATCATGGAGCAGTGGGAGTACCTCCAGACA
CAGATCGCCATGTACGTCAACAGCGACGTTCCAGGCCTGCAGCAGCCTGGCTTCGGTAAGCCCTCGAGGGGTTTC
TGCCAGCGGCTCAAGGGCAAGCAGGGTCGCTTCCGTGGCAACCTCTCGGGGAAGCGAGTCGACTTTTCCGGCCGC
ACCGTCATCTCGCCGGATCCCAACCTGGGCGTCGACCAGGTAGCGGTGCCTGAGCTGGTGGCCAAGAACCTGACG
TATCCCGAACGGGTCAACAGACAGAACATCGAGAAGCTCCGCGAGTGTGTCCGCAACGGCTGTGACAAGTGGCCG
GGCGCCAAGGCGGTGCTTAGAAAAGAGGGCGACGAGATTGCCAAGTACAGCCTCGTCTGGGTCGACAGGGAGCGA
CAGGCGCGGAATCTGGCAATAGGTGACGTCGTGGAGCGTCACTTGGAGGACGGTGATGTCGTGCTCTTTAACCGG
CAACCGTCGCTGCACAAGCTCAGCATCATGAGTCACTTGGTCAAGGTCCGGCCGTGGAGGACGTTTCGGCTCAAC
GAATGCGTCTGCAACCCATACAATGCCGATTTCGACGGCGACGAGATGAACCTGCACGTCCCTCAGACGGAGGAG
GCCAGGGCCGAAGCCATCAACCTCATGGGCGTCAAGTACAACTTGGCGACGCCCAAGAACGGCGAGCCCATCATC
GCCGCCACGCAGGACTTTATCACGGCCGCCTTCCTTTTGAGCAGCAAGGACCGCTTCTTCGACCGCAAGACGTTT
ACCTTTATCTGCACGCACATGCTGGATGGCAAGACGCGGCTAGACCTCCCGCCGCCTGCCATCATGGCTCCTCGC
CGCCTGTGGACGGGCAAGCAGGTCTTCAACGTGCTGATGCGGCCCAACAAGAGCTCGCCCGTCAAGGTCAATCTC
GACGCCAAGTGTCGAGCCTACAAGGCGCGGCCGGGTCAGTGTCCCGACATGGACCCCAACGACGGCTGGCTTGTC
GTCCGCAACTCCGAAGTCATGTGTGGTCGTATGGACAAGTCGACCGTCGGCTCCGGCAAGAAGGACTCCATATTC
TACGTCATTCTGCGCGACTTTGGGCCGGACGAGGCCGTATCAGCCATGAATAGGCTGGCCAAGCTGTGCGCGCGA
CATTTGGCCAACAGGGGGTTCTCCATCGGCGTCGTCGACGTCTTTCCCACGGCCTCGCTCAACACGGAGAAGGAG
GGTTTGGTGTCGATGGCGTACAAGCAGTGCGACGACCTTATCGAGACTTTTAAGCGCGGCCAGCTCGACAAGGCG
CCCGGTTGCAACATGGAGCAGACGCTCGAGAACGTGATATCGGGCATCCTGAGCAAGGTGCGACAACAAGCCGGC
ACCTACTGTATCGACACGCTGAGCCGGAACAATGCGCCGCTCATCATGGCCCAGTCCGGATCCAAGGGCTCGGAC
ATCAACGTCGCCCAGATGGTGGCCGTCGTCGGCCAGCAGATCATCGGCGGTCAGCGCGTGCCAGACGGCTTCCAG
GACCGCAGTCTGCCGCACTTTCACAAGAACGCACGTCAGCCGCCGTCCAAGGGCTTCGTCAAGAACAGCTTCTAC
TCGGGCCTCTTCCCTACCGAGTTCCTCTTCCACGCCATCTCGGGACGCGAGGGTCTGGTCGACACGGCCGTCAAG
ACGGCAGAGACGGGATACATGTCGCGGAGGCTGATGAAGACGCTCGAGGACCTGTCGACGCAGTATGACGACACG
GTCCGTACCTCGGGCGGCGTCGTCGTCCAGTTCCAGTTCGGCGCCGACAAGCTGGATCCCGTCGACATGGAGGGA
TCCGCCGAGCCGGTGCACTTTCAGCGGACCTGGACTCACGCCGAGAACATGACGCGCGACAATACGGAGCCGACC
ATGACGCCTGACGAGGTGCGGACTTTTTGCGGCTCCATGCTTGACGTCGAGAGGCGACGCTTCCCGCGACGAGGC
CTGCTTCAGGGCGAACCCCTCGACTACGACGACGCGAGCGACTACGCCATCGATGAGCACGAGGGCGCCCGGAGG
TTCCTCAAGACCATCGAGACCCACGTCGAGGGTCTGGCGTCGAAACTGGAGCGCGTGCGAACGCTGGCCGGCGTG
CAGGACGACGGTTTCCTCCCGACAGCCTTGGCGGAGGCACACGTCGACCGCACGGCCAAGGTGACGTCGACGACG
CTACGGCTCTTCATCCGCATGTGCTTGGAAAAGTACAAGAAGGCACACGTCGAGCCGGGCCACGCCGTGGGTGCC
GTGGGTGCCCAGTCCATTGGTGAGCCGGGAACGCAGATGACGCTCAAGACGTTCCATTTTGCCGGTGTGGCCGGT
ATGAGCATCACCCAAGGTGTGCCGCGTATCAAGGAGATTATAGGGGCCTCCAAGAAGATCAGCACGCCTGTCATT
ACGTGTCCGCTGCTCAACAACGCCCAGATCGAGGCGGCCAAGATGGTCAAGGGCCGGATCGAAAAGACGTACGTG
TCAGACGTGCTGCATTTCATAGAGGACGAGTGGCAGGCCGACGAGGGCAACGTGGTGCTGCAAATCGACCGCGGC
GCCCTTTCGGACATGCATCTGGGCATCGGCATCTTCGACATCGCCGCGGCCATCTGCAAGCAGCGCAAGCTGAAG
CTACAGCCAGCCGACCTGACGCTAGAAGGAGACCGCATCGTCATCCGCGTCCGGGACTCTTCCGACTCGACGACG
GCCAAGCGGACCGCCGCTGCCGGCCGGGGCAAGACGACGGGCCCCGGCGGCGACGGCGACATGCTGCTCCGGGCC
AACTTCCTCCGCCGCAGCTTGCCGGCCGTTCCCATCTCGGGCTACGCCGAGGCCACGCGAGCCATCATCCAGACG
TCGGAGCAGAACACGCACATGGTGCTGGTCGAAGGCTACGGCCTACGCGAGTGCATGACAACCGAGGGCGTCATC
GGCACTCAGACGCGCAGCAACCACGTCAACGAGTGCTACGACATCCTCGGCGTCGAAGCCGCCCGCAGCACCATC
GCCAACGAAATCGGCGACGTCATGGGCGACATGGGCATCGACCCTCGTCACATCCAGCTCCTAGCCGACGTCATG
ACCTACAAGGGCGAAATCCTGGGCATCAGCCGCTTCGGTCTCCAAAAGATGCGCGACAGCGTCCTCCAGCTGGCC
TCGTTCGAGAAGACGCCCGACCACCTCTTCGACGCGGCGGCCGGCATGAAGACGGATCGCATCGAGGGCGTCAGC
GAGTGCATCATCATGGGGCAGACCATGTCCGTCGGCACGGGCGCCTTCCACGTCGTTCGCCGTCTGGGCATCCAG
CCTCCGGACCTGGAGCCTAAGCCTACGCTCTTTGAGGATGCGTGGACGGCGGAGATGGCGGTCAGGAAGGGGGTG
AGGCGGAGGGGGTGA
Transcript >Ophun1|4060
ATGGACCCCTCGACGGGCGACCCCGTCAAGAAGCAACTCGTCGATAAGCTTCCAAAGCGCTTCAAGGGCATCAAA
TTCGGGATTCAGTCCAACCAGGATATCACGAATCAAGCCGTCCTCGAAGTCTCCGATCGTCTGCTCTACGATATC
GAAAACAACCGCGCTCCCTACCGCCATGGACCCCTAGATCCCCGACTAGGCACCTCTAGCAAGTCGGGCAGATGC
GCCACTTGCCATAATGCCCTCCAGCATTGTACCGGCCACTTTGGCCACGTCAGGCTTCCTCTACCAGCCTTTCAC
GTCGGATATCTACGCTTCGTCATCACTATTCTGCAGAATATCTGCAAGGATTGTGGCCGCGTTCTTCTCGAAGAG
TCCGATCGACAGACGTTCCTCCGCGATCTTCGTCGTCCCTTTCTAGACAACCTTCGTCGCACTCAAATCTGCAAG
CGTATCAATGAGCAGTGTCGCAAGGCAAAAACATGTCCCTACTGCGGATCCATCAACGGCCAGATCCGCAAGGTA
GGCGTCCTCAAGCTGGCGCACGACAAGTTTGTCACGTACAACAAGTCGACGTCGGCCAAGAAAGTGGCGCCAGAG
AGCAAGGTCAAATTCGACGAGTCCTTCTCCGAGGCCAAGCGCGAGAACCCCGAGCTGGAAAAGCACTTGCGCAAG
GCCATGGAGGACCTCAACCCTCTCCGCGTCTTGAATCTGTTCAAGATGATTAGCCCTTCCGACTGCGAGCTTTTG
GGTCTCGATCCAGCCGAGGGCCGGCCGGAAATGTTCATATGGCAGTATCTGCCGGCGCCCCCGATCTGCATCCGG
CCGTCAGTCGCTCAAGACAATGCGAGTACGGAAGACGATATCACGACCAAGCTCGCCGACATCGTCTGGGTCAGC
GGCATGATTCGCTCTGCGCTGCAAAAAGGCTCTCCCATACAGACCATCATGGAGCAGTGGGAGTACCTCCAGACA
CAGATCGCCATGTACGTCAACAGCGACGTTCCAGGCCTGCAGCAGCCTGGCTTCGGTAAGCCCTCGAGGGGTTTC
TGCCAGCGGCTCAAGGGCAAGCAGGGTCGCTTCCGTGGCAACCTCTCGGGGAAGCGAGTCGACTTTTCCGGCCGC
ACCGTCATCTCGCCGGATCCCAACCTGGGCGTCGACCAGGTAGCGGTGCCTGAGCTGGTGGCCAAGAACCTGACG
TATCCCGAACGGGTCAACAGACAGAACATCGAGAAGCTCCGCGAGTGTGTCCGCAACGGCTGTGACAAGTGGCCG
GGCGCCAAGGCGGTGCTTAGAAAAGAGGGCGACGAGATTGCCAAGTACAGCCTCGTCTGGGTCGACAGGGAGCGA
CAGGCGCGGAATCTGGCAATAGGTGACGTCGTGGAGCGTCACTTGGAGGACGGTGATGTCGTGCTCTTTAACCGG
CAACCGTCGCTGCACAAGCTCAGCATCATGAGTCACTTGGTCAAGGTCCGGCCGTGGAGGACGTTTCGGCTCAAC
GAATGCGTCTGCAACCCATACAATGCCGATTTCGACGGCGACGAGATGAACCTGCACGTCCCTCAGACGGAGGAG
GCCAGGGCCGAAGCCATCAACCTCATGGGCGTCAAGTACAACTTGGCGACGCCCAAGAACGGCGAGCCCATCATC
GCCGCCACGCAGGACTTTATCACGGCCGCCTTCCTTTTGAGCAGCAAGGACCGCTTCTTCGACCGCAAGACGTTT
ACCTTTATCTGCACGCACATGCTGGATGGCAAGACGCGGCTAGACCTCCCGCCGCCTGCCATCATGGCTCCTCGC
CGCCTGTGGACGGGCAAGCAGGTCTTCAACGTGCTGATGCGGCCCAACAAGAGCTCGCCCGTCAAGGTCAATCTC
GACGCCAAGTGTCGAGCCTACAAGGCGCGGCCGGGTCAGTGTCCCGACATGGACCCCAACGACGGCTGGCTTGTC
GTCCGCAACTCCGAAGTCATGTGTGGTCGTATGGACAAGTCGACCGTCGGCTCCGGCAAGAAGGACTCCATATTC
TACGTCATTCTGCGCGACTTTGGGCCGGACGAGGCCGTATCAGCCATGAATAGGCTGGCCAAGCTGTGCGCGCGA
CATTTGGCCAACAGGGGGTTCTCCATCGGCGTCGTCGACGTCTTTCCCACGGCCTCGCTCAACACGGAGAAGGAG
GGTTTGGTGTCGATGGCGTACAAGCAGTGCGACGACCTTATCGAGACTTTTAAGCGCGGCCAGCTCGACAAGGCG
CCCGGTTGCAACATGGAGCAGACGCTCGAGAACGTGATATCGGGCATCCTGAGCAAGGTGCGACAACAAGCCGGC
ACCTACTGTATCGACACGCTGAGCCGGAACAATGCGCCGCTCATCATGGCCCAGTCCGGATCCAAGGGCTCGGAC
ATCAACGTCGCCCAGATGGTGGCCGTCGTCGGCCAGCAGATCATCGGCGGTCAGCGCGTGCCAGACGGCTTCCAG
GACCGCAGTCTGCCGCACTTTCACAAGAACGCACGTCAGCCGCCGTCCAAGGGCTTCGTCAAGAACAGCTTCTAC
TCGGGCCTCTTCCCTACCGAGTTCCTCTTCCACGCCATCTCGGGACGCGAGGGTCTGGTCGACACGGCCGTCAAG
ACGGCAGAGACGGGATACATGTCGCGGAGGCTGATGAAGACGCTCGAGGACCTGTCGACGCAGTATGACGACACG
GTCCGTACCTCGGGCGGCGTCGTCGTCCAGTTCCAGTTCGGCGCCGACAAGCTGGATCCCGTCGACATGGAGGGA
TCCGCCGAGCCGGTGCACTTTCAGCGGACCTGGACTCACGCCGAGAACATGACGCGCGACAATACGGAGCCGACC
ATGACGCCTGACGAGGTGCGGACTTTTTGCGGCTCCATGCTTGACGTCGAGAGGCGACGCTTCCCGCGACGAGGC
CTGCTTCAGGGCGAACCCCTCGACTACGACGACGCGAGCGACTACGCCATCGATGAGCACGAGGGCGCCCGGAGG
TTCCTCAAGACCATCGAGACCCACGTCGAGGGTCTGGCGTCGAAACTGGAGCGCGTGCGAACGCTGGCCGGCGTG
CAGGACGACGGTTTCCTCCCGACAGCCTTGGCGGAGGCACACGTCGACCGCACGGCCAAGGTGACGTCGACGACG
CTACGGCTCTTCATCCGCATGTGCTTGGAAAAGTACAAGAAGGCACACGTCGAGCCGGGCCACGCCGTGGGTGCC
GTGGGTGCCCAGTCCATTGGTGAGCCGGGAACGCAGATGACGCTCAAGACGTTCCATTTTGCCGGTGTGGCCGGT
ATGAGCATCACCCAAGGTGTGCCGCGTATCAAGGAGATTATAGGGGCCTCCAAGAAGATCAGCACGCCTGTCATT
ACGTGTCCGCTGCTCAACAACGCCCAGATCGAGGCGGCCAAGATGGTCAAGGGCCGGATCGAAAAGACGTACGTG
TCAGACGTGCTGCATTTCATAGAGGACGAGTGGCAGGCCGACGAGGGCAACGTGGTGCTGCAAATCGACCGCGGC
GCCCTTTCGGACATGCATCTGGGCATCGGCATCTTCGACATCGCCGCGGCCATCTGCAAGCAGCGCAAGCTGAAG
CTACAGCCAGCCGACCTGACGCTAGAAGGAGACCGCATCGTCATCCGCGTCCGGGACTCTTCCGACTCGACGACG
GCCAAGCGGACCGCCGCTGCCGGCCGGGGCAAGACGACGGGCCCCGGCGGCGACGGCGACATGCTGCTCCGGGCC
AACTTCCTCCGCCGCAGCTTGCCGGCCGTTCCCATCTCGGGCTACGCCGAGGCCACGCGAGCCATCATCCAGACG
TCGGAGCAGAACACGCACATGGTGCTGGTCGAAGGCTACGGCCTACGCGAGTGCATGACAACCGAGGGCGTCATC
GGCACTCAGACGCGCAGCAACCACGTCAACGAGTGCTACGACATCCTCGGCGTCGAAGCCGCCCGCAGCACCATC
GCCAACGAAATCGGCGACGTCATGGGCGACATGGGCATCGACCCTCGTCACATCCAGCTCCTAGCCGACGTCATG
ACCTACAAGGGCGAAATCCTGGGCATCAGCCGCTTCGGTCTCCAAAAGATGCGCGACAGCGTCCTCCAGCTGGCC
TCGTTCGAGAAGACGCCCGACCACCTCTTCGACGCGGCGGCCGGCATGAAGACGGATCGCATCGAGGGCGTCAGC
GAGTGCATCATCATGGGGCAGACCATGTCCGTCGGCACGGGCGCCTTCCACGTCGTTCGCCGTCTGGGCATCCAG
CCTCCGGACCTGGAGCCTAAGCCTACGCTCTTTGAGGATGCGTGGACGGCGGAGATGGCGGTCAGGAAGGGGGTG
AGGCGGAGGGGGTGA
Gene >Ophun1|4060
ATGGACCCCTCGACGGGCGACCCCGTCAAGAAGCAACTCGTCGATAAGCTTCCAAAGCGCTTCAAGGGCATCAAA
TTCGGGATTCAGTGCGTTGTCACGTTCTTTGTTTCACGAGGGTCTCTGACCGAAGACTTCAGGTCCAACCAGGAT
ATCACGAATCAAGCCGTCCTCGAAGTCTCCGATCGTCTGCTCTACGATATCGAAAACAACCGCGCTCCCTACCGC
CATGGACCCCTAGATCCCCGACTAGTGAGCGTCTTGTACCGTCTAGAATTCTGGTTTGGGACGACTGACCTTTGC
TTCCTCCCTCAAGGGCACCTCTAGCAAGTCGGGCAGATGCGCCACTTGCCATAATGCCCTCCAGCATTGTACCGG
CCACTTTGGCCACGTCAGGCTTCCTCTACCAGCCTTTCACGTCGGATATCTACGCTTCGTCATCACTATTCTGCA
GAATATCTGCAAGGTGCCGTCTTTCTAGCTGGCTCCCTTGACACTGTTCTGACTTGGCATTCGCAGGATTGTGGC
CGCGTTCTTCTCGAAGAGTCCGATCGACAGACGTTCCTCCGCGATCTTCGTCGTCCCTTTCTAGACAACCTTCGT
CGCACTCAAATCTGCAAGCGTATCAATGAGCAGTGTCGCAAGGCAAAAACATGTCCCTACTGCGGATCCATCAAC
GGCCAGATCCGCAAGGTAGGCGTCCTCAAGCTGGCGCACGACAAGTTTGTCACGTACAACAAGTCGACGTCGGCC
AAGAAAGTGGCGCCAGAGAGCAAGGTCAAATTCGACGAGTCCTTCTCCGAGGCCAAGCGCGAGAACCCCGAGCTG
GAAAAGCACTTGCGCAAGGCCATGGAGGACCTCAACCCTCTCCGCGTCTTGAATCTGTTCAAGATGATTAGCCCT
TCCGACTGCGAGCTTTTGGGTCTCGATCCAGCCGAGGGCCGGCCGGAAATGTTCATATGGCAGTATCTGCCGGCG
CCCCCGATCTGCATCCGGCCGTCAGTCGCTCAAGACAATGCGAGTACGGAAGACGATATCACGACCAAGCTCGCC
GACATCGTCTGGGTCAGCGGCATGATTCGCTCTGCGCTGCAAAAAGGCTCTCCCATACAGACCATCATGGAGCAG
TGGGAGTACCTCCAGACACAGATCGCCATGTACGTCAACAGCGACGTTCCAGGCCTGCAGCAGCCTGGCTTCGGT
AAGCCCTCGAGGGGTTTCTGCCAGCGGCTCAAGGGCAAGCAGGGTCGCTTCCGTGGCAACCTCTCGGGGAAGCGA
GTCGACTTTTCCGGCCGCACCGTCATCTCGCCGGATCCCAACCTGGGCGTCGACCAGGTAGCGGTGCCTGAGCTG
GTGGCCAAGAACCTGACGTATCCCGAACGGGTCAACAGACAGAACATCGAGAAGCTCCGCGAGTGTGTCCGCAAC
GGCTGTGACAAGTGGCCGGGCGCCAAGGCGGTGCTTAGAAAAGAGGGCGACGAGATTGCCAAGTACAGCCTCGTC
TGGGTCGACAGGGAGCGACAGGCGCGGAATCTGGCAATAGGTGACGTCGTGGAGCGTCACTTGGAGGACGGTGAT
GTCGTGCTCTTTAACCGGCAACCGTCGCTGCACAAGCTCAGCATCATGAGTCACTTGGTCAAGGTCCGGCCGTGG
AGGACGTTTCGGCTCAACGAATGCGTCTGCAACCCATACAATGCCGATTTCGACGGCGACGAGATGAACCTGCAC
GTCCCTCAGACGGAGGAGGCCAGGGCCGAAGCCATCAACCTCATGGGCGTCAAGTACAACTTGGCGACGCCCAAG
AACGGCGAGCCCATCATCGCCGCCACGCAGGACTTTATCACGGCCGCCTTCCTTTTGAGCAGCAAGGACCGCTTC
TTCGACCGCAAGACGTTTACCTTTATCTGCACGCACATGCTGGATGGCAAGACGCGGCTAGACCTCCCGCCGCCT
GCCATCATGGCTCCTCGCCGCCTGTGGACGGGCAAGCAGGTCTTCAACGTGCTGATGCGGCCCAACAAGAGCTCG
CCCGTCAAGGTCAATCTCGACGCCAAGTGTCGAGCCTACAAGGCGCGGCCGGGTCAGTGTCCCGACATGGACCCC
AACGACGGCTGGCTTGTCGTCCGCAACTCCGAAGTCATGTGTGGTCGTATGGACAAGTCGACCGTCGGCTCCGGC
AAGAAGGACTCCATATTCTACGTCATTCTGCGCGACTTTGGGCCGGACGAGGCCGTATCAGCCATGAATAGGCTG
GCCAAGCTGTGCGCGCGACATTTGGCCAACAGGGGGTTCTCCATCGGCGTCGTCGACGTCTTTCCCACGGCCTCG
CTCAACACGGAGAAGGAGGGTTTGGTGTCGATGGCGTACAAGCAGTGCGACGACCTTATCGAGACTTTTAAGCGC
GGCCAGCTCGACAAGGCGCCCGGTTGCAACATGGAGCAGACGCTCGAGAACGTGATATCGGGCATCCTGAGCAAG
GTGCGACAACAAGCCGGCACCTACTGTATCGACACGCTGAGCCGGAACAATGCGCCGCTCATCATGGCCCAGTCC
GGATCCAAGGGCTCGGACATCAACGTCGCCCAGATGGTGGCCGTCGTCGGCCAGCAGATCATCGGCGGTCAGCGC
GTGCCAGACGGCTTCCAGGACCGCAGTCTGCCGCACTTTCACAAGAACGCACGTCAGCCGCCGTCCAAGGGCTTC
GTCAAGAACAGCTTCTACTCGGGCCTCTTCCCTACCGAGTTCCTCTTCCACGCCATCTCGGGACGCGAGGGTCTG
GTCGACACGGCCGTCAAGACGGCAGAGACGGGATACATGTCGCGGAGGCTGATGAAGACGCTCGAGGACCTGTCG
ACGCAGTATGACGACACGGTCCGTACCTCGGGCGGCGTCGTCGTCCAGTTCCAGTTCGGCGCCGACAAGCTGGAT
CCCGTCGACATGGAGGGATCCGCCGAGCCGGTGCACTTTCAGCGGACCTGGACTCACGCCGAGAACATGACGCGC
GACAATACGGAGCCGACCATGACGCCTGACGAGGTGCGGACTTTTTGCGGCTCCATGCTTGACGTCGAGAGGCGA
CGCTTCCCGCGACGAGGCCTGCTTCAGGGCGAACCCCTCGACTACGACGACGCGAGCGACTACGCCATCGATGAG
CACGAGGGCGCCCGGAGGTTCCTCAAGACCATCGAGACCCACGTCGAGGGTCTGGCGTCGAAACTGGAGCGCGTG
CGAACGCTGGCCGGCGTGCAGGACGACGGTTTCCTCCCGACAGCCTTGGCGGAGGCACACGTCGACCGCACGGCC
AAGGTGACGTCGACGACGCTACGGCTCTTCATCCGCATGTGCTTGGAAAAGTACAAGAAGGCACACGTCGAGCCG
GGCCACGCCGTGGGTGCCGTGGGTGCCCAGTCCATTGGTGAGCCGGGAACGCAGATGACGCTCAAGACGTTCCAT
TTTGCCGGTGTGGCCGGTATGAGCATCACCCAAGGTGTGCCGCGTATCAAGGAGATTATAGGGGCCTCCAAGAAG
ATCAGCACGCCTGTCATTACGTGTCCGCTGCTCAACAACGCCCAGATCGAGGCGGCCAAGATGGTCAAGGGCCGG
ATCGAAAAGACGTACGTGTCAGACGTGCTGCATTTCATAGAGGACGAGTGGCAGGCCGACGAGGGCAACGTGGTG
CTGCAAATCGACCGCGGCGCCCTTTCGGACATGCATCTGGGCATCGGCATCTTCGACATCGCCGCGGCCATCTGC
AAGCAGCGCAAGCTGAAGCTACAGCCAGCCGACCTGACGCTAGAAGGAGACCGCATCGTCATCCGCGTCCGGGAC
TCTTCCGACTCGACGACGGCCAAGCGGACCGCCGCTGCCGGCCGGGGCAAGACGACGGGCCCCGGCGGCGACGGC
GACATGCTGCTCCGGGCCAACTTCCTCCGCCGCAGCTTGCCGGCCGTTCCCATCTCGGGCTACGCCGAGGCCACG
CGAGCCATCATCCAGACGTCGGAGCAGAACACGCACATGGTGCTGGTCGAAGGCTACGGCCTACGCGAGTGCATG
ACAACCGAGGGCGTCATCGGCACTCAGACGCGCAGCAACCACGTCAACGAGTGCTACGACATCCTCGGCGTCGAA
GCCGCCCGCAGCACCATCGCCAACGAAATCGGCGACGTCATGGGCGACATGGGCATCGACCCTCGTCACATCCAG
CTCCTAGCCGACGTCATGACCTACAAGGGCGAAATCCTGGGCATCAGCCGCTTCGGTCTCCAAAAGATGCGCGAC
AGCGTCCTCCAGCTGGCCTCGTTCGAGAAGACGCCCGACCACCTCTTCGACGCGGCGGCCGGCATGAAGACGGAT
CGCATCGAGGGCGTCAGCGAGTGCATCATCATGGGGCAGACCATGTCCGTCGGCACGGGCGCCTTCCACGTCGTT
CGCCGTCTGGGCATCCAGCCTCCGGACCTGGAGCCTAAGCCTACGCTCTTTGAGGATGCGTGGACGGCGGAGATG
GCGGTCAGGAAGGGGGTGAGGCGGAGGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail