Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4054
Gene name
LocationContig_37:23160..24541
Strand-
Gene length (bp)1381
Transcript length (bp)1071
Coding sequence length (bp)1071
Protein length (aa) 357

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02453 Reticulon Reticulon 8.0E-29 88 236

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53694|RTN1_SCHPO Reticulon-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rtn1 PE=1 SV=1 86 231 5.0E-14

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 84 106 22
2 116 138 22
3 176 198 22
4 202 224 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4054
MSDLHDAPAAANGGGTLEAARARKFSLSCSPDESSPRFLPAESAAAYEAITNGPVAQSVRDNSEKVSSELSSLAA
SRKTPANPTATGASAIAYVTIVSSIFAARYLDVVRWAFKLSWMALAVTVSAEVAGKMALNHGLATQMRPRKYYTV
SRATIDNMIGDVHELANFFVIEGQRILFAENPVASAAACVAAFIAYHLSKLVPYWGLAVIATTIAFAAPLIYINN
QELIDHHLKNASDIIGSQTAQVRDVAQKQAGQLASMSKQYAGDYTGKVQEMLRGRGTSPVSSKKPEPVSKPEPVS
KPEPFSKPAPVIKPAPVNKPVDLPSPPTEEPLKVSEPVVQVPEAPVVPEPEPLIAS*
Coding >Ophun1|4054
ATGTCTGACCTTCACGATGCGCCCGCCGCGGCCAACGGCGGTGGAACGCTCGAGGCGGCCAGAGCTCGTAAGTTC
TCACTCTCTTGCTCCCCTGATGAAAGCTCACCTCGTTTTCTTCCCGCAGAGTCGGCTGCTGCATACGAAGCGATA
ACCAACGGACCTGTTGCACAGAGCGTCAGGGACAACTCTGAAAAGGTCTCGTCCGAGCTGTCCAGCCTGGCAGCC
TCTCGCAAGACACCCGCCAACCCGACTGCCACCGGTGCCAGCGCCATTGCCTATGTGACCATCGTCTCTTCCATA
TTCGCTGCTAGATACCTCGATGTCGTTCGTTGGGCGTTTAAGCTGTCGTGGATGGCCCTGGCCGTCACTGTCAGC
GCCGAGGTCGCCGGCAAAATGGCGCTGAACCATGGCCTCGCCACCCAGATGAGGCCTCGCAAGTATTACACCGTC
TCGCGAGCGACCATCGACAATATGATTGGCGATGTCCACGAGTTGGCCAACTTCTTCGTCATCGAGGGCCAGCGC
ATTCTCTTCGCGGAGAACCCTGTTGCCTCGGCCGCGGCTTGTGTCGCCGCCTTCATTGCCTATCATCTTTCCAAG
CTCGTCCCGTACTGGGGTCTTGCCGTGATCGCGACGACGATTGCCTTCGCTGCTCCTCTGATCTACATCAACAAC
CAGGAGCTCATCGATCACCACCTCAAGAACGCGTCGGACATCATCGGTTCCCAGACGGCTCAGGTCCGAGACGTG
GCCCAGAAGCAGGCTGGTCAGCTGGCCTCCATGAGCAAGCAGTACGCCGGTGACTACACTGGCAAGGTCCAGGAG
ATGCTCCGTGGCCGTGGGACTTCTCCCGTCTCGTCCAAGAAGCCCGAGCCTGTTTCGAAGCCGGAGCCCGTGTCC
AAGCCGGAGCCGTTTTCTAAGCCGGCACCCGTCATCAAGCCGGCTCCCGTCAACAAGCCCGTCGATCTCCCCTCT
CCGCCTACCGAGGAGCCTCTCAAGGTGTCGGAGCCGGTGGTGCAGGTTCCCGAGGCGCCCGTGGTGCCGGAGCCG
GAGCCCTTGATCGCCTCCTAG
Transcript >Ophun1|4054
ATGTCTGACCTTCACGATGCGCCCGCCGCGGCCAACGGCGGTGGAACGCTCGAGGCGGCCAGAGCTCGTAAGTTC
TCACTCTCTTGCTCCCCTGATGAAAGCTCACCTCGTTTTCTTCCCGCAGAGTCGGCTGCTGCATACGAAGCGATA
ACCAACGGACCTGTTGCACAGAGCGTCAGGGACAACTCTGAAAAGGTCTCGTCCGAGCTGTCCAGCCTGGCAGCC
TCTCGCAAGACACCCGCCAACCCGACTGCCACCGGTGCCAGCGCCATTGCCTATGTGACCATCGTCTCTTCCATA
TTCGCTGCTAGATACCTCGATGTCGTTCGTTGGGCGTTTAAGCTGTCGTGGATGGCCCTGGCCGTCACTGTCAGC
GCCGAGGTCGCCGGCAAAATGGCGCTGAACCATGGCCTCGCCACCCAGATGAGGCCTCGCAAGTATTACACCGTC
TCGCGAGCGACCATCGACAATATGATTGGCGATGTCCACGAGTTGGCCAACTTCTTCGTCATCGAGGGCCAGCGC
ATTCTCTTCGCGGAGAACCCTGTTGCCTCGGCCGCGGCTTGTGTCGCCGCCTTCATTGCCTATCATCTTTCCAAG
CTCGTCCCGTACTGGGGTCTTGCCGTGATCGCGACGACGATTGCCTTCGCTGCTCCTCTGATCTACATCAACAAC
CAGGAGCTCATCGATCACCACCTCAAGAACGCGTCGGACATCATCGGTTCCCAGACGGCTCAGGTCCGAGACGTG
GCCCAGAAGCAGGCTGGTCAGCTGGCCTCCATGAGCAAGCAGTACGCCGGTGACTACACTGGCAAGGTCCAGGAG
ATGCTCCGTGGCCGTGGGACTTCTCCCGTCTCGTCCAAGAAGCCCGAGCCTGTTTCGAAGCCGGAGCCCGTGTCC
AAGCCGGAGCCGTTTTCTAAGCCGGCACCCGTCATCAAGCCGGCTCCCGTCAACAAGCCCGTCGATCTCCCCTCT
CCGCCTACCGAGGAGCCTCTCAAGGTGTCGGAGCCGGTGGTGCAGGTTCCCGAGGCGCCCGTGGTGCCGGAGCCG
GAGCCCTTGATCGCCTCCTAG
Gene >Ophun1|4054
ATGTCTGACCTTCACGATGCGCCCGCCGCGGCCAACGGCGGTGGAACGCTCGAGGCGGCCAGAGCTCGTAAGGTA
TGTGGTTTTGGTCGTCTTTCTTATCCCTCTGCCAGCTCGTGGTACCTCGGAAATTGGCAAACGCTGACAGGGATC
TTTAGTTCTCACTCTCTTGCTCCCCTGATGAAAGCTCACCTCGTTTTCTTCCCGCAGAGTCGGCTGCTGCATACG
AAGCGATAACCAACGGTGAGCTTACCCCGGCTTCCTCTGCCTGCTCGACACGACTGACGTCACCCCCTTCAGGAC
CTGTTGCACAGAGCGTCAGGGACAACTCTGAAAAGGTCTCGTCCGAGCTGTCCAGCCTGGCAGCCTCTCGCAAGA
CACCCGCCAACCCGACTGCCACCGGTCAGCCCCTAACACACTACCACTCCTTCTTCTCGGAGCTCCTGTCGTGGA
AGAACCCTCGTATCTACTCCCCCGCCCTCTGGACGTGGCGTTGATGGACGCTGACATGCTACAGGTGCCAGCGCC
ATTGCCTATGTGACCATCGTCTCTTCCATATTCGCTGCTAGATACCTCGATGTCGTTCGTTGGGCGTTTAAGCTG
TCGTGGATGGCCCTGGCCGTCACTGTCAGCGCCGAGGTCGCCGGCAAAATGGCGCTGAACCATGGCCTCGCCACC
CAGATGAGGCCTCGCAAGTATTACACCGTCTCGCGAGCGACCATCGACAATATGATTGGCGATGTCCACGAGTTG
GCCAACTTCTTCGTCATCGAGGGCCAGCGCATTCTCTTCGCGGAGAACCCTGTTGCCTCGGCCGCGGTGAGTGGC
GTTTATTTCCGGGCAAGCGGAATATATCTCGGCTAACCATGTGCAGGCTTGTGTCGCCGCCTTCATTGCCTATCA
TCTTTCCAAGCTCGTCCCGTACTGGGGTCTTGCCGTGATCGCGACGACGATTGCCTTCGCTGCTCCTCTGATCTA
CATCAACAACCAGGAGCTCATCGATCACCACCTCAAGAACGCGTCGGACATCATCGGTTCCCAGACGGCTCAGGT
CCGAGACGTGGCCCAGAAGCAGGCTGGTCAGCTGGCCTCCATGAGCAAGCAGTACGCCGGTGACTACACTGGCAA
GGTCCAGGAGATGCTCCGTGGCCGTGGGACTTCTCCCGTCTCGTCCAAGAAGCCCGAGCCTGTTTCGAAGCCGGA
GCCCGTGTCCAAGCCGGAGCCGTTTTCTAAGCCGGCACCCGTCATCAAGCCGGCTCCCGTCAACAAGCCCGTCGA
TCTCCCCTCTCCGCCTACCGAGGAGCCTCTCAAGGTGTCGGAGCCGGTGGTGCAGGTTCCCGAGGCGCCCGTGGT
GCCGGAGCCGGAGCCCTTGATCGCCTCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail