Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4051
Gene name
LocationContig_37:11437..17677
Strand+
Gene length (bp)6240
Transcript length (bp)5151
Coding sequence length (bp)5151
Protein length (aa) 1717

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 3.5E-64 957 1288
PF03839 Sec62 Translocation protein Sec62 1.0E-59 126 308
PF08655 DASH_Ask1 DASH complex subunit Ask1 1.2E-29 1311 1374
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 6.2E-25 560 813

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99161|SEC62_YARLI Translocation protein SEC62 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC62 PE=3 SV=2 108 312 1.0E-46
sp|O13787|SEC62_SCHPO Translocation protein sec62 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec62 PE=3 SV=1 126 351 3.0E-43
sp|Q5AI21|SEC62_CANAL Translocation protein SEC62 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC62 PE=3 SV=1 122 307 2.0E-26
sp|Q6CLZ9|SEC62_KLULA Translocation protein SEC62 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC62 PE=3 SV=1 127 327 2.0E-26
sp|Q9P6S5|ASK1_SCHPO DASH complex subunit ask1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ask1 PE=1 SV=1 1305 1378 8.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99161|SEC62_YARLI Translocation protein SEC62 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SEC62 PE=3 SV=2 108 312 1.0E-46
sp|O13787|SEC62_SCHPO Translocation protein sec62 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec62 PE=3 SV=1 126 351 3.0E-43
sp|Q5AI21|SEC62_CANAL Translocation protein SEC62 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC62 PE=3 SV=1 122 307 2.0E-26
sp|Q6CLZ9|SEC62_KLULA Translocation protein SEC62 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SEC62 PE=3 SV=1 127 327 2.0E-26
sp|Q9P6S5|ASK1_SCHPO DASH complex subunit ask1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ask1 PE=1 SV=1 1305 1378 8.0E-26
sp|P21825|SEC62_YEAST Translocation protein SEC62 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC62 PE=1 SV=2 127 309 5.0E-21
sp|Q6FRU9|SEC62_CANGA Translocation protein SEC62 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC62 PE=3 SV=1 127 307 6.0E-21
sp|Q8BU14|SEC62_MOUSE Translocation protein SEC62 OS=Mus musculus GN=Sec62 PE=1 SV=1 210 325 6.0E-17
sp|Q5R4Q3|SEC62_PONAB Translocation protein SEC62 OS=Pongo abelii GN=SEC62 PE=2 SV=1 210 325 1.0E-16
sp|Q99442|SEC62_HUMAN Translocation protein SEC62 OS=Homo sapiens GN=SEC62 PE=1 SV=1 210 325 2.0E-16
sp|Q6BI99|SEC62_DEBHA Translocation protein SEC62 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC62 PE=3 SV=1 127 309 1.0E-14
sp|Q5F3A1|SEC62_CHICK Translocation protein SEC62 OS=Gallus gallus GN=SEC62 PE=2 SV=1 210 309 1.0E-14
sp|Q75D26|SEC62_ASHGO Translocation protein SEC62 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC62 PE=3 SV=2 119 310 4.0E-12
[Show less]

GO

GO Term Description Terminal node
GO:0030176 integral component of endoplasmic reticulum membrane Yes
GO:0072686 mitotic spindle Yes
GO:0042729 DASH complex Yes
GO:0043015 gamma-tubulin binding Yes
GO:0015031 protein transport Yes
GO:0008608 attachment of spindle microtubules to kinetochore Yes
GO:0043226 organelle No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0043229 intracellular organelle No
GO:0008092 cytoskeletal protein binding No
GO:0005819 spindle No
GO:0140513 nuclear protein-containing complex No
GO:0031301 integral component of organelle membrane No
GO:0032991 protein-containing complex No
GO:0051234 establishment of localization No
GO:0022402 cell cycle process No
GO:0008104 protein localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0015631 tubulin binding No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No
GO:0051641 cellular localization No
GO:0031300 intrinsic component of organelle membrane No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0016021 integral component of membrane No
GO:0045184 establishment of protein localization No
GO:0031227 intrinsic component of endoplasmic reticulum membrane No
GO:0003674 molecular_function No
GO:0071705 nitrogen compound transport No
GO:0005515 protein binding No
GO:0070727 cellular macromolecule localization No
GO:0043228 non-membrane-bounded organelle No
GO:0110165 cellular anatomical entity No
GO:0051179 localization No
GO:0033036 macromolecule localization No
GO:0071702 organic substance transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 223 245 22
2 252 274 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4051
MSAQGPPFPPGQGPTPEQIAEMQRRVAEDAQKAGMTVPEFIAHIKKQTLQQQRMRFHQQQQQHSHDGHHCCDHDH
DHDHDHDDDDDDDHHHQHHHQGHSQPITPGPPNPKAIAVAKFLKGQELKPLKRALRALQSPAYEKARKKNPLLPE
ITDQASLENTFKLLPLSMLALRVSKIETELGPNGKKPKRVKGQWNVRVEQQQEAHEEMYYVWLWEGSQIKRQIYA
ALALVVIFIVVLYPLWPLKLRQGVYYLSWGLLGLLGLFFLMAIFRVILFCVTYFAVAPGLWLYPNLWEDVSFMDS
FRPVWAWHETAEEKKLKKKSKKKARVAGSGGGTNATFAAATGQVAPTTATTTGTDTQIKTGDMHQRTYVAPKVEE
LADDDMHDSDEPHVFAIPNLWQKSSLVESDEGFNDESLFFTPSLGVDASRGLIALDPVSLEDHGFFRLPALGSSK
RQPGDRSGQSEDSELETREDTEHEFTGLVDADSRSDDSMSQVWAETQKASRPQVGFRTWDTFQSGAFEAHRPTLV
SEAGPAAYDAVLRLTTDSDVAVVQTRAYYSSLSALAVGRDSIFFIKDDKAQTFRPSLPKIRISGFSRQVLGGIQD
LALRSGTCVLQLRAFVQAAYVRNSCRCEVALASSIAQVLQAVERKFTSDHMRPGSLLQLQASIREAWATLKPLEK
LVSRLPRSVSDEDLVSLVFHTASAVDDGQDFTGAIMRDILQRVSAPWIEFVEQWIGTKPDKGIFATKPDKRGSEG
FVKAEVDEDSDVVNFRLDRAKVPDFIPDDLMKMIFEAGRNLRFIRYFHPLHALSRQSIIESARPPRAQWLFEWSS
VLKLRAQTCQYRENLRRALREGGRDPKSGIGPEAPRAVDFFGLDQDGMEAIILASMEQLDQVMVEPSPRDSLDEI
LHERFFHRRHDVDENRAAITPHWSLLPALSFGGIAAAQAQIINRESLRLLFQAHDIRRHLRLQRDFQLLGNGVFC
SRLSHALFDPDLQSAERRAGVARQGGAMGLRLGGRDTWPPASSELRLVLIGVLSESYTSQSGAKLDDNGALPGEL
SFAVRELSTTEIEKCMDADSVEALDFLRLLYTTPAALSGIITPSSLANYDDIFRLLLRVLRVLYVVNQQWSWARQ
GIDNEPSRFARESHHFMTSLASYFLDTAVAIPWEAFERRLDQMHTEVESEHETTVTTGGPEQLREAHDGALERIT
QALFLAEGQKPVLGLLKSLFSSILGHAKLAKLRALGEGAAWNEAELYADFREKMRAFVKACRRLSEEGGSLEHDC
VGQLLVKLDANYFAITLSMARPSTAAARNLSSMEELEKLEQSITLTLQEIDHNFSKAHRIVTTSILPVVEKYGEH
SRAVWEASKFWKQFFEASANVSLSGYEELAHEDVDGSSELRHGDSSMAEDSSTMRHDATAEFTPRRADGEPTRTP
EADQSTLHSLLDDGDVTGSTPRPPATKTIHAQLSSLESPYEAMRREMKEEEAKPQDEQEDSSVLFAQHTARLPDM
SMAPRGSRESPSPEKSVQRHPDPLLHRVLDKNYRLQATPHKPPYRISPLKRAGGGGDDDKTRTHAWEDSPMSSPE
MAVPTLRSEVFMSPLKTTTNARQRLAAAARGPRTPGLSVQTPVAAASRDALASAGETRRQRYEIDWESDGEGEDE
DIYAGMSPPKTIQFALPPSKLLQTPAREASRRIVGDILLDAGADPASSEYSPTMVKMNEDILNDSF*
Coding >Ophun1|4051
ATGTCTGCCCAGGGGCCTCCGTTCCCGCCTGGCCAGGGCCCGACGCCCGAGCAGATCGCCGAAATGCAGCGAAGG
GTCGCCGAGGATGCGCAAAAGGCGGGCATGACGGTGCCCGAGTTCATCGCGCACATCAAGAAGCAGACATTGCAG
CAACAGCGCATGCGCTTTCACCAGCAGCAACAGCAGCATTCGCACGACGGACACCACTGCTGCGATCACGATCAC
GACCATGACCACGATCACGACGATGACGATGACGATGACCACCATCATCAGCATCACCATCAAGGTCACTCTCAG
CCCATCACGCCGGGTCCTCCGAATCCCAAGGCTATCGCCGTTGCTAAGTTCCTCAAGGGCCAAGAGTTGAAGCCA
CTGAAACGTGCTCTTCGGGCTTTGCAGTCGCCTGCCTACGAAAAAGCCCGTAAGAAGAACCCCTTGCTACCGGAG
ATCACCGACCAGGCCTCGCTCGAGAACACCTTTAAATTACTACCTCTTAGCATGCTCGCCCTACGTGTGTCCAAG
ATCGAGACGGAGTTGGGACCCAACGGAAAAAAGCCCAAGCGCGTAAAGGGCCAGTGGAATGTTCGCGTCGAGCAG
CAACAAGAGGCTCATGAAGAGATGTACTACGTCTGGCTGTGGGAGGGCAGCCAGATCAAACGTCAGATTTATGCG
GCCCTGGCCCTCGTCGTCATCTTCATCGTCGTCCTGTATCCGCTCTGGCCGTTGAAGCTGCGCCAAGGCGTCTAC
TACCTCAGCTGGGGTCTTCTGGGTCTTCTGGGTCTGTTCTTCCTCATGGCCATCTTCCGCGTTATCCTCTTCTGT
GTCACTTATTTCGCCGTCGCACCTGGTCTATGGCTCTACCCCAACCTGTGGGAAGATGTTTCATTCATGGACAGT
TTCAGACCCGTCTGGGCCTGGCACGAGACTGCCGAGGAAAAGAAGTTGAAGAAGAAGTCCAAGAAGAAGGCCAGA
GTAGCTGGCTCTGGAGGTGGCACCAACGCCACGTTCGCCGCCGCCACCGGCCAGGTCGCGCCGACGACAGCTACG
ACGACGGGCACCGACACTCAGATCAAGACGGGTGACATGCACCAGCGGACTTATGTCGCGCCCAAGGTCGAGGAG
CTGGCGGATGACGATATGCACGACTCCGACGAACCGCACGTCTTCGCGATCCCGAACCTGTGGCAGAAATCTTCT
CTCGTCGAGAGCGACGAAGGCTTCAACGATGAGTCACTGTTCTTCACGCCCAGCCTCGGCGTCGATGCTTCACGC
GGTCTGATAGCCCTCGACCCTGTTTCGCTCGAGGACCATGGCTTCTTTCGACTCCCCGCCCTTGGCTCGTCGAAG
CGGCAACCTGGAGACCGAAGTGGGCAGTCAGAAGATTCCGAACTTGAAACTCGAGAAGACACCGAACATGAATTC
ACCGGTCTCGTGGACGCCGACTCGAGAAGTGACGATTCCATGAGCCAAGTTTGGGCCGAGACGCAGAAGGCGTCG
CGTCCTCAAGTCGGCTTCAGGACTTGGGATACCTTTCAGTCTGGGGCTTTTGAGGCTCACCGACCTACGCTCGTC
AGCGAGGCTGGACCAGCCGCCTACGATGCCGTGCTGCGACTTACTACGGACAGCGACGTGGCAGTCGTTCAGACC
AGGGCGTACTACTCGTCACTTTCTGCCCTCGCTGTCGGCAGAGACTCCATATTCTTCATCAAAGATGACAAGGCG
CAGACATTTCGACCCTCCCTTCCGAAAATCCGCATCTCGGGCTTTTCCAGACAGGTCCTCGGCGGTATCCAGGAC
CTGGCTCTCCGGAGCGGAACGTGCGTCTTGCAGCTGAGGGCATTCGTGCAGGCTGCCTACGTCAGGAACTCTTGT
CGTTGCGAGGTGGCTCTCGCCAGCAGCATTGCCCAAGTTCTGCAAGCCGTGGAGCGGAAGTTTACATCGGATCAC
ATGAGGCCCGGCTCTCTCCTTCAGCTTCAAGCCTCCATTAGAGAGGCATGGGCGACATTGAAACCGCTCGAGAAG
CTCGTCTCGCGGCTGCCCCGGTCAGTCTCAGACGAGGATCTGGTGAGCCTTGTCTTCCACACGGCATCTGCCGTA
GACGATGGCCAGGACTTCACGGGGGCCATTATGCGCGACATTCTGCAACGAGTGTCTGCTCCGTGGATCGAGTTC
GTGGAGCAATGGATCGGAACCAAGCCTGACAAGGGCATCTTTGCGACCAAACCTGACAAGAGGGGAAGCGAGGGA
TTCGTCAAGGCAGAGGTGGATGAAGATTCAGATGTAGTGAACTTTCGACTGGACCGCGCCAAGGTACCCGACTTC
ATACCGGACGACTTGATGAAGATGATCTTCGAGGCCGGTAGAAACCTGCGATTCATCCGGTACTTTCACCCGCTT
CATGCCCTGTCAAGGCAAAGCATCATCGAGTCGGCACGTCCCCCCAGAGCCCAATGGCTTTTTGAATGGTCATCG
GTTTTGAAGCTCAGGGCTCAGACCTGTCAGTATCGAGAAAACCTCCGCCGTGCTTTGCGAGAGGGTGGCCGTGAC
CCCAAGTCTGGCATCGGACCTGAGGCCCCCAGGGCTGTCGACTTTTTCGGGCTCGATCAAGATGGCATGGAAGCC
ATAATCTTGGCATCGATGGAGCAACTGGATCAGGTCATGGTCGAGCCCAGTCCCAGAGACTCTCTGGATGAAATC
TTGCACGAGCGGTTCTTTCACAGGCGTCATGATGTCGACGAAAACCGGGCCGCCATCACTCCCCATTGGTCATTG
CTACCAGCCCTCTCTTTCGGCGGCATAGCTGCCGCTCAAGCTCAGATAATCAACCGCGAGAGTCTGCGGCTTCTT
TTCCAAGCGCACGACATCCGCAGACACCTGAGGCTGCAGCGGGACTTTCAACTCCTCGGCAATGGTGTCTTCTGC
AGCCGTCTATCCCACGCGCTATTCGACCCGGATCTGCAGTCCGCAGAGAGGCGAGCTGGCGTTGCCCGACAGGGG
GGAGCTATGGGACTCCGTCTCGGAGGTCGGGACACTTGGCCGCCGGCCAGTTCGGAGCTGCGACTTGTCCTGATC
GGTGTGTTGAGCGAGAGCTACACGTCACAATCAGGGGCGAAACTGGACGACAACGGTGCTCTGCCGGGCGAACTC
AGCTTCGCGGTCCGCGAGCTGTCGACCACGGAAATTGAAAAGTGCATGGACGCAGACTCGGTCGAGGCGCTGGAC
TTTCTGCGTCTGTTATATACCACGCCCGCGGCGCTATCTGGCATCATCACTCCCAGCAGCCTGGCGAACTACGAT
GACATCTTCAGACTGCTTCTGCGGGTATTGCGAGTGCTTTACGTGGTCAACCAACAGTGGTCATGGGCCAGACAA
GGTATAGACAACGAGCCGTCCCGCTTCGCGAGGGAATCACATCATTTCATGACGAGCCTGGCGTCATACTTTCTG
GACACTGCCGTTGCCATTCCTTGGGAGGCCTTTGAGCGGAGGCTTGACCAGATGCATACTGAAGTCGAGAGCGAG
CACGAAACGACGGTGACAACTGGAGGTCCCGAACAGCTACGGGAAGCCCACGATGGGGCTCTCGAGAGGATTACT
CAGGCCCTATTTCTCGCAGAGGGGCAGAAGCCGGTGCTGGGTCTCCTGAAGTCCCTTTTCAGCTCGATACTTGGC
CACGCCAAGCTCGCGAAACTCCGGGCTCTCGGGGAAGGCGCAGCATGGAACGAGGCGGAGCTTTACGCGGACTTT
AGGGAAAAGATGAGGGCGTTTGTGAAGGCGTGTCGCCGGCTGTCTGAAGAGGGCGGCTCGTTGGAACACGATTGC
GTCGGGCAGCTGCTGGTGAAGCTGGACGCGAATTATTTTGCAATTACGCTCAGCATGGCTCGTCCCAGCACCGCG
GCAGCCCGCAACTTGTCGTCTATGGAGGAGCTGGAGAAGCTAGAGCAATCCATCACGCTGACGCTGCAAGAGATC
GATCACAACTTTAGCAAAGCTCACCGAATCGTGACGACGAGCATCCTACCCGTAGTGGAGAAGTACGGCGAACAC
TCGCGGGCGGTGTGGGAGGCGTCCAAGTTCTGGAAGCAATTCTTCGAGGCTTCGGCCAACGTCTCCCTTTCGGGC
TACGAGGAGCTCGCCCACGAAGATGTGGATGGCAGCTCGGAATTGAGGCACGGGGACTCGTCGATGGCTGAGGAC
AGCTCGACCATGAGGCATGATGCCACGGCGGAGTTCACGCCACGGCGTGCCGACGGCGAACCCACTCGGACGCCC
GAGGCAGACCAGTCGACGCTGCACTCGCTTCTGGATGATGGAGACGTCACGGGCAGCACGCCTCGCCCACCTGCT
ACCAAGACGATTCATGCGCAACTCTCCAGCCTCGAGTCTCCGTACGAGGCCATGAGGCGCGAGATGAAGGAGGAG
GAGGCCAAGCCCCAAGACGAGCAAGAGGACTCATCCGTCTTATTCGCTCAACATACGGCCCGCCTGCCCGACATG
TCCATGGCGCCAAGAGGATCTCGCGAAAGCCCCAGTCCGGAGAAGTCGGTGCAGAGGCACCCCGACCCTCTCCTC
CACCGCGTCCTCGACAAGAATTACCGGCTGCAGGCTACACCCCACAAGCCTCCATACCGTATATCCCCGCTCAAG
CGGGCCGGCGGCGGCGGCGACGACGACAAGACAAGGACACACGCGTGGGAAGATTCGCCCATGTCGTCGCCTGAG
ATGGCAGTTCCCACGCTGAGAAGCGAGGTTTTCATGTCGCCGCTGAAGACGACGACCAACGCCCGCCAGCGCCTG
GCCGCGGCTGCTCGAGGTCCCCGTACGCCGGGTCTAAGCGTGCAGACGCCCGTGGCCGCGGCTTCTCGGGACGCC
TTGGCGTCGGCGGGGGAAACGCGCCGGCAAAGGTACGAGATTGACTGGGAGAGCGACGGGGAAGGCGAGGATGAG
GACATCTACGCCGGTATGAGCCCGCCCAAGACGATACAGTTCGCCCTACCGCCTTCGAAGCTGCTGCAGACGCCT
GCGAGGGAGGCAAGCAGAAGGATTGTGGGCGACATCCTCCTCGACGCCGGGGCGGATCCGGCATCATCCGAGTAC
AGCCCTACAATGGTCAAGATGAACGAGGACATTCTCAACGACAGCTTCTGA
Transcript >Ophun1|4051
ATGTCTGCCCAGGGGCCTCCGTTCCCGCCTGGCCAGGGCCCGACGCCCGAGCAGATCGCCGAAATGCAGCGAAGG
GTCGCCGAGGATGCGCAAAAGGCGGGCATGACGGTGCCCGAGTTCATCGCGCACATCAAGAAGCAGACATTGCAG
CAACAGCGCATGCGCTTTCACCAGCAGCAACAGCAGCATTCGCACGACGGACACCACTGCTGCGATCACGATCAC
GACCATGACCACGATCACGACGATGACGATGACGATGACCACCATCATCAGCATCACCATCAAGGTCACTCTCAG
CCCATCACGCCGGGTCCTCCGAATCCCAAGGCTATCGCCGTTGCTAAGTTCCTCAAGGGCCAAGAGTTGAAGCCA
CTGAAACGTGCTCTTCGGGCTTTGCAGTCGCCTGCCTACGAAAAAGCCCGTAAGAAGAACCCCTTGCTACCGGAG
ATCACCGACCAGGCCTCGCTCGAGAACACCTTTAAATTACTACCTCTTAGCATGCTCGCCCTACGTGTGTCCAAG
ATCGAGACGGAGTTGGGACCCAACGGAAAAAAGCCCAAGCGCGTAAAGGGCCAGTGGAATGTTCGCGTCGAGCAG
CAACAAGAGGCTCATGAAGAGATGTACTACGTCTGGCTGTGGGAGGGCAGCCAGATCAAACGTCAGATTTATGCG
GCCCTGGCCCTCGTCGTCATCTTCATCGTCGTCCTGTATCCGCTCTGGCCGTTGAAGCTGCGCCAAGGCGTCTAC
TACCTCAGCTGGGGTCTTCTGGGTCTTCTGGGTCTGTTCTTCCTCATGGCCATCTTCCGCGTTATCCTCTTCTGT
GTCACTTATTTCGCCGTCGCACCTGGTCTATGGCTCTACCCCAACCTGTGGGAAGATGTTTCATTCATGGACAGT
TTCAGACCCGTCTGGGCCTGGCACGAGACTGCCGAGGAAAAGAAGTTGAAGAAGAAGTCCAAGAAGAAGGCCAGA
GTAGCTGGCTCTGGAGGTGGCACCAACGCCACGTTCGCCGCCGCCACCGGCCAGGTCGCGCCGACGACAGCTACG
ACGACGGGCACCGACACTCAGATCAAGACGGGTGACATGCACCAGCGGACTTATGTCGCGCCCAAGGTCGAGGAG
CTGGCGGATGACGATATGCACGACTCCGACGAACCGCACGTCTTCGCGATCCCGAACCTGTGGCAGAAATCTTCT
CTCGTCGAGAGCGACGAAGGCTTCAACGATGAGTCACTGTTCTTCACGCCCAGCCTCGGCGTCGATGCTTCACGC
GGTCTGATAGCCCTCGACCCTGTTTCGCTCGAGGACCATGGCTTCTTTCGACTCCCCGCCCTTGGCTCGTCGAAG
CGGCAACCTGGAGACCGAAGTGGGCAGTCAGAAGATTCCGAACTTGAAACTCGAGAAGACACCGAACATGAATTC
ACCGGTCTCGTGGACGCCGACTCGAGAAGTGACGATTCCATGAGCCAAGTTTGGGCCGAGACGCAGAAGGCGTCG
CGTCCTCAAGTCGGCTTCAGGACTTGGGATACCTTTCAGTCTGGGGCTTTTGAGGCTCACCGACCTACGCTCGTC
AGCGAGGCTGGACCAGCCGCCTACGATGCCGTGCTGCGACTTACTACGGACAGCGACGTGGCAGTCGTTCAGACC
AGGGCGTACTACTCGTCACTTTCTGCCCTCGCTGTCGGCAGAGACTCCATATTCTTCATCAAAGATGACAAGGCG
CAGACATTTCGACCCTCCCTTCCGAAAATCCGCATCTCGGGCTTTTCCAGACAGGTCCTCGGCGGTATCCAGGAC
CTGGCTCTCCGGAGCGGAACGTGCGTCTTGCAGCTGAGGGCATTCGTGCAGGCTGCCTACGTCAGGAACTCTTGT
CGTTGCGAGGTGGCTCTCGCCAGCAGCATTGCCCAAGTTCTGCAAGCCGTGGAGCGGAAGTTTACATCGGATCAC
ATGAGGCCCGGCTCTCTCCTTCAGCTTCAAGCCTCCATTAGAGAGGCATGGGCGACATTGAAACCGCTCGAGAAG
CTCGTCTCGCGGCTGCCCCGGTCAGTCTCAGACGAGGATCTGGTGAGCCTTGTCTTCCACACGGCATCTGCCGTA
GACGATGGCCAGGACTTCACGGGGGCCATTATGCGCGACATTCTGCAACGAGTGTCTGCTCCGTGGATCGAGTTC
GTGGAGCAATGGATCGGAACCAAGCCTGACAAGGGCATCTTTGCGACCAAACCTGACAAGAGGGGAAGCGAGGGA
TTCGTCAAGGCAGAGGTGGATGAAGATTCAGATGTAGTGAACTTTCGACTGGACCGCGCCAAGGTACCCGACTTC
ATACCGGACGACTTGATGAAGATGATCTTCGAGGCCGGTAGAAACCTGCGATTCATCCGGTACTTTCACCCGCTT
CATGCCCTGTCAAGGCAAAGCATCATCGAGTCGGCACGTCCCCCCAGAGCCCAATGGCTTTTTGAATGGTCATCG
GTTTTGAAGCTCAGGGCTCAGACCTGTCAGTATCGAGAAAACCTCCGCCGTGCTTTGCGAGAGGGTGGCCGTGAC
CCCAAGTCTGGCATCGGACCTGAGGCCCCCAGGGCTGTCGACTTTTTCGGGCTCGATCAAGATGGCATGGAAGCC
ATAATCTTGGCATCGATGGAGCAACTGGATCAGGTCATGGTCGAGCCCAGTCCCAGAGACTCTCTGGATGAAATC
TTGCACGAGCGGTTCTTTCACAGGCGTCATGATGTCGACGAAAACCGGGCCGCCATCACTCCCCATTGGTCATTG
CTACCAGCCCTCTCTTTCGGCGGCATAGCTGCCGCTCAAGCTCAGATAATCAACCGCGAGAGTCTGCGGCTTCTT
TTCCAAGCGCACGACATCCGCAGACACCTGAGGCTGCAGCGGGACTTTCAACTCCTCGGCAATGGTGTCTTCTGC
AGCCGTCTATCCCACGCGCTATTCGACCCGGATCTGCAGTCCGCAGAGAGGCGAGCTGGCGTTGCCCGACAGGGG
GGAGCTATGGGACTCCGTCTCGGAGGTCGGGACACTTGGCCGCCGGCCAGTTCGGAGCTGCGACTTGTCCTGATC
GGTGTGTTGAGCGAGAGCTACACGTCACAATCAGGGGCGAAACTGGACGACAACGGTGCTCTGCCGGGCGAACTC
AGCTTCGCGGTCCGCGAGCTGTCGACCACGGAAATTGAAAAGTGCATGGACGCAGACTCGGTCGAGGCGCTGGAC
TTTCTGCGTCTGTTATATACCACGCCCGCGGCGCTATCTGGCATCATCACTCCCAGCAGCCTGGCGAACTACGAT
GACATCTTCAGACTGCTTCTGCGGGTATTGCGAGTGCTTTACGTGGTCAACCAACAGTGGTCATGGGCCAGACAA
GGTATAGACAACGAGCCGTCCCGCTTCGCGAGGGAATCACATCATTTCATGACGAGCCTGGCGTCATACTTTCTG
GACACTGCCGTTGCCATTCCTTGGGAGGCCTTTGAGCGGAGGCTTGACCAGATGCATACTGAAGTCGAGAGCGAG
CACGAAACGACGGTGACAACTGGAGGTCCCGAACAGCTACGGGAAGCCCACGATGGGGCTCTCGAGAGGATTACT
CAGGCCCTATTTCTCGCAGAGGGGCAGAAGCCGGTGCTGGGTCTCCTGAAGTCCCTTTTCAGCTCGATACTTGGC
CACGCCAAGCTCGCGAAACTCCGGGCTCTCGGGGAAGGCGCAGCATGGAACGAGGCGGAGCTTTACGCGGACTTT
AGGGAAAAGATGAGGGCGTTTGTGAAGGCGTGTCGCCGGCTGTCTGAAGAGGGCGGCTCGTTGGAACACGATTGC
GTCGGGCAGCTGCTGGTGAAGCTGGACGCGAATTATTTTGCAATTACGCTCAGCATGGCTCGTCCCAGCACCGCG
GCAGCCCGCAACTTGTCGTCTATGGAGGAGCTGGAGAAGCTAGAGCAATCCATCACGCTGACGCTGCAAGAGATC
GATCACAACTTTAGCAAAGCTCACCGAATCGTGACGACGAGCATCCTACCCGTAGTGGAGAAGTACGGCGAACAC
TCGCGGGCGGTGTGGGAGGCGTCCAAGTTCTGGAAGCAATTCTTCGAGGCTTCGGCCAACGTCTCCCTTTCGGGC
TACGAGGAGCTCGCCCACGAAGATGTGGATGGCAGCTCGGAATTGAGGCACGGGGACTCGTCGATGGCTGAGGAC
AGCTCGACCATGAGGCATGATGCCACGGCGGAGTTCACGCCACGGCGTGCCGACGGCGAACCCACTCGGACGCCC
GAGGCAGACCAGTCGACGCTGCACTCGCTTCTGGATGATGGAGACGTCACGGGCAGCACGCCTCGCCCACCTGCT
ACCAAGACGATTCATGCGCAACTCTCCAGCCTCGAGTCTCCGTACGAGGCCATGAGGCGCGAGATGAAGGAGGAG
GAGGCCAAGCCCCAAGACGAGCAAGAGGACTCATCCGTCTTATTCGCTCAACATACGGCCCGCCTGCCCGACATG
TCCATGGCGCCAAGAGGATCTCGCGAAAGCCCCAGTCCGGAGAAGTCGGTGCAGAGGCACCCCGACCCTCTCCTC
CACCGCGTCCTCGACAAGAATTACCGGCTGCAGGCTACACCCCACAAGCCTCCATACCGTATATCCCCGCTCAAG
CGGGCCGGCGGCGGCGGCGACGACGACAAGACAAGGACACACGCGTGGGAAGATTCGCCCATGTCGTCGCCTGAG
ATGGCAGTTCCCACGCTGAGAAGCGAGGTTTTCATGTCGCCGCTGAAGACGACGACCAACGCCCGCCAGCGCCTG
GCCGCGGCTGCTCGAGGTCCCCGTACGCCGGGTCTAAGCGTGCAGACGCCCGTGGCCGCGGCTTCTCGGGACGCC
TTGGCGTCGGCGGGGGAAACGCGCCGGCAAAGGTACGAGATTGACTGGGAGAGCGACGGGGAAGGCGAGGATGAG
GACATCTACGCCGGTATGAGCCCGCCCAAGACGATACAGTTCGCCCTACCGCCTTCGAAGCTGCTGCAGACGCCT
GCGAGGGAGGCAAGCAGAAGGATTGTGGGCGACATCCTCCTCGACGCCGGGGCGGATCCGGCATCATCCGAGTAC
AGCCCTACAATGGTCAAGATGAACGAGGACATTCTCAACGACAGCTTCTGA
Gene >Ophun1|4051
ATGTCTGCCCAGGGGCCTCCGTTCCCGCCTGGCCAGGGCCCGACGCCCGAGCAGATCGCCGAAATGCAGCGAAGG
GTCGCCGAGGATGCGCAAAAGGCGGGCATGACGGTGCCCGAGTTCATCGCGCACATCAAGAAGCAGACATTGCAG
CAACAGCGCATGCGCTTTCACCAGCAGCAACAGCAGCATTCGCACGACGGACACCACTGCTGCGATCACGATCAC
GACCATGACCACGATCACGACGATGACGATGACGATGACCACCATCATCAGCATCACCATCAAGGTCACTCTCAG
CCCATCACGCCGGGTCCTCCGAATCCCAAGGCTATCGCCGTTGCTAAGTTCCTCAAGGGCCAAGAGTTGAAGCCA
CGTACCTGCATTCTGAATGGGGAGCGAAAGGACATGTTTAAAGGCATGAACTCTGATACCCTTCTGCCGGAGTCT
CGCTAACAGATCAAATAGTGAAACGTGCTCTTCGGGCTTTGCAGTCGCCTGCCTACGAAAAAGCCCGTAAGAAGA
ACCCCTTGCTACCGGAGATCACCGACCAGGCCTCGCTCGAGAACACCTTTAAATTACTACCTCTTAGCATGCTCG
CCCTACGTGTGTCCAAGATCGAGACGGAGTTGGGACCCAACGGAAAAAAGCCCAAGCGCGTAAAGGGCCAGTGGA
ATGTTCGCGTCGAGCAGCAACAAGAGGCTCATGAAGAGATGTACTACGTCTGGCTGTGGGAGGGCAGCCAGATCA
AACGTCAGATTTATGCGGCCCTGGCCCTCGTCGTCATCTTCATCGTCGTCCTGTATCCGCTCTGGCCGTTGAAGC
TGCGCCAAGGCGTCTACTACCTCAGCTGGGGTCTTCTGGGTCTTCTGGGTCTGTTCTTCCTCATGGCCATCTTCC
GCGTTATCCTCTTCTGTGTCACTTATTTCGCCGTCGCACCTGGTCTATGGCTCTACCCCAACCTGTGGGAAGATG
TTTCATTCATGGACAGTTTCAGACCCGTCTGGGCCTGGCACGAGGTAAGCTCGAGCGCTCAATCCGTCTCGTCCC
GACTAACAATGTCGCCAGACTGCCGAGGAAAAGAAGTTGAAGAAGAAGTCCAAGAAGAAGGCCAGAGTAGCTGGC
TCTGGAGGTGGCACCAACGCCACGTTCGCCGCCGCCACCGGCCAGGTCGCGCCGACGACAGCTACGACGACGGGC
ACCGACACTCAGATCAAGACGGGTGACATGCACCAGCGGACTTATGTCGCGCCCAAGGTCGAGGAGCTGGCGGAT
GACGAGTGAGTGAACTGAGTAGGTGACGCGATGATGCGGACCACTTGAATGCTATCGAGCGAGATTTTGCATGGA
TGGAGGACGGGAGGGAATATGTGGGTTTCGTCTAGAGCCAGCGCCAAAACTGAAGATGCTTGCGGTGATGAGCAA
GATTGGGAGAAAAGCTTGACTCGTTGATCAATGGCTAGGTAGGCAGGAAATCACTGTGTGATGCAGGTAGATGGT
AGTTTTCGACTTCCGGAGCGGGCATCAAGCAGGGACTGAGGATGTTGGCGGTTGTCAGTGCAGCCTTGTAGGCGA
TATCGGTGATCACGTGATCCGGCAGACATGCGCGAAGACGTGGGCTGGCTCAGATTCGACCAGCGTCTGAGAAAT
CTGGCCATGAAATGCATTGTCACAGATCCCATGGACCAATCTGTTCCGCCTAGCAGTTGAGATTTTTCTCTTGCG
TCCCAAAAGATGCAATGGGAGCAGTCGCCATTTCCCCAAGAGCATTGACGCGCAGGAAAGACGCGCCGCGATTAT
CACAGCCTCAGTATGCACGACTCCGACGAACCGCACGTCTTCGCGATCCCGAACCTGTGGCAGAAATCTTCTCTC
GTCGAGAGCGACGAAGGCTTCAACGATGAGTCACTGTTCTTCACGCCCAGCCTCGGCGTCGATGCTTCACGCGGT
CTGATAGCCCTCGACCCTGTTTCGCTCGAGGACCATGGCTTCTTTCGACTCCCCGCCCTTGGCTCGTCGAAGCGG
CAACCTGGAGACCGAAGTGGGCAGTCAGAAGATTCCGAACTTGAAACTCGAGAAGACACCGAACATGAATTCACC
GGTCTCGTGGACGCCGACTCGAGAAGTGACGATTCCATGAGCCAAGTTTGGGCCGAGACGCAGAAGGCGTCGCGT
CCTCAAGTCGGCTTCAGGACTTGGGATACCTTTCAGTCTGGGGCTTTTGAGGCTCACCGACCTACGCTCGTCAGC
GAGGCTGGACCAGCCGCCTACGATGCCGTGCTGCGACTTACTACGGACAGCGACGTGGCAGTCGTTCAGACCAGG
GCGTACTACTCGTCACTTTCTGCCCTCGCTGTCGGCAGAGACTCCATATTCTTCATCAAAGATGACAAGGCGCAG
ACATTTCGACCCTCCCTTCCGAAAATCCGCATCTCGGGCTTTTCCAGACAGGTCCTCGGCGGTATCCAGGACCTG
GCTCTCCGGAGCGGAACGTGCGTCTTGCAGCTGAGGGCATTCGTGCAGGCTGCCTACGTCAGGAACTCTTGTCGT
TGCGAGGTGGCTCTCGCCAGCAGCATTGCCCAAGTTCTGCAAGCCGTGGAGCGGAAGTTTACATCGGATCACATG
AGGCCCGGCTCTCTCCTTCAGCTTCAAGCCTCCATTAGAGAGGCATGGGCGACATTGAAACCGCTCGAGAAGCTC
GTCTCGCGGCTGCCCCGGTCAGTCTCAGACGAGGATCTGGTGAGCCTTGTCTTCCACACGGCATCTGCCGTAGAC
GATGGCCAGGACTTCACGGGGGCCATTATGCGCGACATTCTGCAACGAGTGTCTGCTCCGTGGATCGAGTTCGTG
GAGCAATGGATCGGAACCAAGCCTGACAAGGGCATCTTTGCGACCAAACCTGACAAGAGGGGAAGCGAGGGATTC
GTCAAGGCAGAGGTGGATGAAGATTCAGATGTAGTGAACTTTCGACTGGACCGCGCCAAGGTACCCGACTTCATA
CCGGACGACTTGATGAAGATGATCTTCGAGGCCGGTAGAAACCTGCGATTCATCCGGTACTTTCACCCGCTTCAT
GCCCTGTCAAGGCAAAGCATCATCGAGTCGGCACGTCCCCCCAGAGCCCAATGGCTTTTTGAATGGTCATCGGTT
TTGAAGCTCAGGGCTCAGACCTGTCAGTATCGAGAAAACCTCCGCCGTGCTTTGCGAGAGGGTGGCCGTGACCCC
AAGTCTGGCATCGGACCTGAGGCCCCCAGGGCTGTCGACTTTTTCGGGCTCGATCAAGATGGCATGGAAGCCATA
ATCTTGGCATCGATGGAGCAACTGGATCAGGTCATGGTCGAGCCCAGTCCCAGAGACTCTCTGGATGAAATCTTG
CACGAGCGGTTCTTTCACAGGCGTCATGATGTCGACGAAAACCGGGCCGCCATCACTCCCCATTGGTCATTGCTA
CCAGCCCTCTCTTTCGGCGGCATAGCTGCCGCTCAAGCTCAGATAATCAACCGCGAGAGTCTGCGGCTTCTTTTC
CAAGCGCACGACATCCGCAGACACCTGAGGCTGCAGCGGGACTTTCAACTCCTCGGCAATGGTGTCTTCTGCAGC
CGTCTATCCCACGCGCTATTCGACCCGGATCTGCAGTCCGCAGAGAGGCGAGCTGGCGTTGCCCGACAGGGGGGA
GCTATGGGACTCCGTCTCGGAGGTCGGGACACTTGGCCGCCGGCCAGTTCGGAGCTGCGACTTGTCCTGATCGGT
GTGTTGAGCGAGAGCTACACGTCACAATCAGGGGCGAAACTGGACGACAACGGTGCTCTGCCGGGCGAACTCAGC
TTCGCGGTCCGCGAGCTGTCGACCACGGAAATTGAAAAGTGCATGGACGCAGACTCGGTCGAGGCGCTGGACTTT
CTGCGTCTGTTATATACCACGCCCGCGGCGCTATCTGGCATCATCACTCCCAGCAGCCTGGCGAACTACGATGAC
ATCTTCAGACTGCTTCTGCGGGTATTGCGAGTGCTTTACGTGGTCAACCAACAGTGGTCATGGGCCAGACAAGGT
ATAGACAACGAGCCGTCCCGCTTCGCGAGGGAATCACATCATTTCATGACGAGCCTGGCGTCATACTTTCTGGAC
ACTGCCGTTGCCATTCCTTGGGAGGCCTTTGAGCGGAGGCTTGACCAGATGCATACTGAAGTCGAGAGCGAGCAC
GAAACGACGGTGACAACTGGAGGTCCCGAACAGCTACGGGAAGCCCACGATGGGGCTCTCGAGAGGATTACTCAG
GCCCTATTTCTCGCAGAGGGGCAGAAGCCGGTGCTGGGTCTCCTGAAGTCCCTTTTCAGCTCGATACTTGGCCAC
GCCAAGCTCGCGAAACTCCGGGCTCTCGGGGAAGGCGCAGCATGGAACGAGGCGGAGCTTTACGCGGACTTTAGG
GAAAAGATGAGGGCGTTTGTGAAGGCGTGTCGCCGGCTGTCTGAAGAGGGCGGCTCGTTGGAACACGATTGCGTC
GGGCAGCTGCTGGTGAAGCTGGACGCGAATTATTTTGCGTAGGAAGTAAGGACAGTTTCTCGGCTTCTTTGGTTT
GCCTAAAGCCGCTTGGGGCATTTTGGTAGAAGGCGAGTTGTAGTCTTTGTTCATTGAGTTGGCCGAGTTTATCGG
TGTTTGCAACTGGAAGCCAGAGTAAGGGATCCAGGGTAGGTAGGTTGGTGGTTTTTGGATTAGCCGATAAAGTGC
CGATCCCCTTAGCCGAGTGACGCGTCTTGACGCGCTCTTTTGTCTCAAGATTGACGTCGCCGTCAGAATTACGCT
CAGCATGGCTCGTCCCAGCACCGCGGCAGCCCGCAACTTGTCGTCTATGGAGGAGCTGGAGAAGCTAGAGCAATC
CATCACGCTGACGCTGCAAGGTGAGAGGCCATAACGTCGATGATTGTCCCCCCCACCACTAAGACCGCGGCAGAG
ATCGATCACAACTTTAGCAAAGCTCACCGAATCGTGACGACGAGCATCCTACCCGTAGTGGAGAAGTACGGCGAA
CACTCGCGGGCGGTGTGGGAGGCGTCCAAGGTGCGTCTTTGTCGCGCAAAAAGGGGCCACAGGTTGACTCATGGA
ACCAGTTCTGGAAGCAATTCTTCGAGGCTTCGGCCAACGTCTCCCTTTCGGGCTACGAGGAGCTCGCCCACGAAG
ATGTGGATGGCAGCTCGGAATTGAGGCACGGGGACTCGTCGATGGCTGAGGACAGCTCGACCATGAGGCATGATG
CCACGGCGGAGTTCACGCCACGGCGTGCCGACGGCGAACCCACTCGGACGCCCGAGGCAGACCAGTCGACGCTGC
ACTCGCTTCTGGATGATGGAGACGTCACGGGCAGCACGCCTCGCCCACCTGCTACCAAGACGATTCATGCGCAAC
TCTCCAGCCTCGAGTCTCCGTACGAGGCCATGAGGCGCGAGATGAAGGAGGAGGAGGCCAAGCCCCAAGACGAGC
AAGAGGACTCATCCGTCTTATTCGCTCAACATACGGCCCGCCTGCCCGACATGTCCATGGCGCCAAGAGGATCTC
GCGAAAGCCCCAGTCCGGAGAAGTCGGTGCAGAGGCACCCCGACCCTCTCCTCCACCGCGTCCTCGACAAGAATT
ACCGGCTGCAGGCTACACCCCACAAGCCTCCATACCGTATATCCCCGCTCAAGCGGGCCGGCGGCGGCGGCGACG
ACGACAAGACAAGGACACACGCGTGGGAAGATTCGCCCATGTCGTCGCCTGAGATGGCAGTTCCCACGCTGAGAA
GCGAGGTTTTCATGTCGCCGCTGAAGACGACGACCAACGCCCGCCAGCGCCTGGCCGCGGCTGCTCGAGGTCCCC
GTACGCCGGGTCTAAGCGTGCAGACGCCCGTGGCCGCGGCTTCTCGGGACGCCTTGGCGTCGGCGGGGGAAACGC
GCCGGCAAAGGTACGAGATTGACTGGGAGAGCGACGGGGAAGGCGAGGATGAGGACATCTACGCCGGTATGAGCC
CGCCCAAGACGATACAGTTCGCCCTACCGCCTTCGAAGCTGCTGCAGACGCCTGGTAAGTTGACAAGGTTGCCCA
TGGCTTATTGACCGGAGCTGACGATGGTGTTGTTTGACAGCGAGGGAGGCAAGCAGAAGGATTGTGGGCGACATC
CTCCTCGACGCCGGGGCGGATCCGGCATCATCCGAGTACAGCCCTACAATGGTCAAGATGAACGAGGACATTCTC
AACGACAGCTTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail