Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|405
Gene name
LocationContig_111:30687..32583
Strand-
Gene length (bp)1896
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00487 FA_desaturase Fatty acid desaturase 4.6E-29 234 507
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.2E-07 18 77

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CMK7|SLD1_KLULA Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SLD PE=3 SV=1 5 544 1.0E-156
sp|Q8NKG8|SLD1_KLULC Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis GN=SLD PE=1 SV=1 5 544 7.0E-155
sp|Q8NKG9|SLD1_LACK1 Delta 8-(E)-sphingolipid desaturase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SLD PE=1 SV=1 4 544 1.0E-151
sp|Q5AEK8|SLD1_CANAL Delta 8-(E)-sphingolipid desaturase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLD1 PE=1 SV=1 5 537 1.0E-147
sp|C4QVU3|SLD1_PICPG Delta 8-(E)-sphingolipid desaturase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr1-1_0013 PE=3 SV=1 6 544 1.0E-139
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6CMK7|SLD1_KLULA Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SLD PE=3 SV=1 5 544 1.0E-156
sp|Q8NKG8|SLD1_KLULC Delta 8-(E)-sphingolipid desaturase OS=Kluyveromyces lactis GN=SLD PE=1 SV=1 5 544 7.0E-155
sp|Q8NKG9|SLD1_LACK1 Delta 8-(E)-sphingolipid desaturase OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=SLD PE=1 SV=1 4 544 1.0E-151
sp|Q5AEK8|SLD1_CANAL Delta 8-(E)-sphingolipid desaturase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLD1 PE=1 SV=1 5 537 1.0E-147
sp|C4QVU3|SLD1_PICPG Delta 8-(E)-sphingolipid desaturase OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAS_chr1-1_0013 PE=3 SV=1 6 544 1.0E-139
sp|Q43469|SLD1_HELAN Delta(8)-fatty-acid desaturase OS=Helianthus annuus GN=sld1 PE=1 SV=1 166 528 1.0E-61
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 183 528 8.0E-57
sp|Q9FR82|SLD1_BOROF Delta(8)-fatty-acid desaturase OS=Borago officinalis GN=sld1 PE=1 SV=1 183 528 4.0E-51
sp|Q9ZRP7|SLD1_ARATH Delta(8)-fatty-acid desaturase 1 OS=Arabidopsis thaliana GN=SLD1 PE=1 SV=1 238 528 2.0E-49
sp|Q23221|FAT3_CAEEL Delta(6)-fatty-acid desaturase fat-3 OS=Caenorhabditis elegans GN=fat-3 PE=2 SV=2 158 533 5.0E-38
sp|G5EG11|FAT4_CAEEL Delta(5) fatty acid desaturase fat-4 OS=Caenorhabditis elegans GN=fat-4 PE=2 SV=1 150 540 3.0E-28
sp|Q9SWQ9|SLD1_EUGGR Delta(8)-fatty-acid desaturase OS=Euglena gracilis GN=efd1 PE=1 SV=1 163 506 2.0E-23
sp|Q4G2T3|DESAT_THAPS Sphingolipid 10-desaturase OS=Thalassiosira pseudonana GN=desA PE=1 SV=2 237 530 6.0E-17
sp|A4KDP0|D5FAD_REBSA Acyl-lipid (8-3)-desaturase OS=Rebecca salina GN=D5Des PE=1 SV=1 181 526 1.0E-16
sp|Q9Z122|FADS2_RAT Fatty acid desaturase 2 OS=Rattus norvegicus GN=Fads2 PE=2 SV=1 174 506 1.0E-15
sp|Q9JJE7|FADS3_MOUSE Fatty acid desaturase 3 OS=Mus musculus GN=Fads3 PE=2 SV=2 172 527 2.0E-15
sp|Q9Z0R9|FADS2_MOUSE Fatty acid desaturase 2 OS=Mus musculus GN=Fads2 PE=1 SV=1 174 506 2.0E-15
sp|Q9Y5Q0|FADS3_HUMAN Fatty acid desaturase 3 OS=Homo sapiens GN=FADS3 PE=2 SV=1 172 527 3.0E-15
sp|Q0VAX3|FS2P1_MOUSE Fatty acid desaturase 2-like protein FADS2P1 OS=Mus musculus GN=Fads2p1 PE=2 SV=1 172 506 6.0E-15
sp|Q9DEX7|FADS2_DANRE Fatty acid desaturase 2 OS=Danio rerio GN=fads2 PE=2 SV=1 174 524 1.0E-14
sp|Q8K1P9|FADS3_RAT Fatty acid desaturase 3 OS=Rattus norvegicus GN=Fads3 PE=2 SV=1 172 527 4.0E-14
sp|A4IFP3|FADS3_BOVIN Fatty acid desaturase 3 OS=Bos taurus GN=FADS3 PE=2 SV=1 172 511 8.0E-14
sp|A4KDP1|D8FAD_REBSA Acyl-lipid 8-desaturase OS=Rebecca salina GN=D8Des PE=2 SV=1 168 506 1.0E-13
sp|A4FV48|FADS2_BOVIN Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=2 SV=1 174 537 3.0E-13
sp|Q4R749|FADS2_MACFA Fatty acid desaturase 2 OS=Macaca fascicularis GN=FADS2 PE=2 SV=1 174 506 6.0E-12
sp|O60427|FADS1_HUMAN Fatty acid desaturase 1 OS=Homo sapiens GN=FADS1 PE=1 SV=3 172 524 9.0E-12
sp|Q5REA7|FADS2_PONAB Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 PE=2 SV=1 174 506 1.0E-11
sp|O95864|FADS2_HUMAN Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 PE=1 SV=1 174 506 1.0E-11
sp|A4UVI1|FADS1_PAPAN Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=1 SV=1 172 524 1.0E-11
sp|Q8S3C1|D5FAD_THRSP Acyl-lipid (8-3)-desaturase OS=Thraustochytrium sp. GN=Fad5 PE=1 SV=1 156 536 5.0E-11
sp|Q6DDK2|FADS2_XENLA Fatty acid desaturase 2 OS=Xenopus laevis GN=fads2 PE=2 SV=1 244 537 3.0E-10
sp|Q920R3|FADS1_RAT Fatty acid desaturase 1 OS=Rattus norvegicus GN=Fads1 PE=2 SV=1 172 506 2.0E-09
sp|Q920L1|FADS1_MOUSE Fatty acid desaturase 1 OS=Mus musculus GN=Fads1 PE=1 SV=1 172 506 2.0E-09
sp|Q6VPV2|D4FAD_DIALT Acyl-lipid (7-3)-desaturase OS=Diacronema lutheri GN=Plesd1 PE=1 SV=1 232 506 2.0E-07
sp|Q08871|LLCD_SYNY3 Acyl-CoA 6-desaturase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=des6 PE=4 SV=1 248 508 4.0E-07
sp|O74212|D5FAD_MORAP Acyl-lipid (8-3)-desaturase OS=Mortierella alpina GN=DES1 PE=1 SV=1 250 508 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

Domain # Start End Length
1 224 246 22
2 261 283 22
3 344 366 22
4 379 401 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|405
MDRDKVLSQAAVDALIADGQTIVIFQDHVLRLDSWLSRHPGGSLAILHMIGRDATDEITVHHAAPTLRTMSAFRI
GRKPPGLWTNRTPPIRQGPLPVLEPALSDDSLPDDDTNSSPSTAPTSPPTSSYGDDKVDEHQLRRRKGRDVVTTV
LDDPASVIDAAVQSRLDRDVRDYPSVDPAVQQDIVAKYRQLHQKIIDEGLYDCPYREVAKDLVRFLILFSAFMVA
LRYEWYLTSSFFLGLFWHQIMFTAHDAGHRAITHNFVVDTLIGMFIADFCCGLSIGWWKSSHNVHHLITNQPEHD
PDIQNVPLFATCPSFFKSITSTYYPNFVIVWDAAADLLVPYQKYTYYPVLAIARFNLYILSWLHVLSSKSSSLAG
TKAWWIRPGEISFMCCYWFLFGYCLLWRSLPTWTARVVYTLVSHIVTMPLHVQINLSHWGMSTSDLGPSESFPQR
QLRATMDVDCPTWLDFYHGGLQFQAVHHLFPRLPRHNLRKAQAFVKEFCQSTGIPYTILTFTDGNRKVLGRLQEV
TDQLAVLAKCQKSLAESGTYDLH*
Coding >Ophun1|405
ATGGATCGCGACAAAGTCCTCTCTCAGGCCGCCGTCGACGCCCTCATCGCCGACGGACAGACCATCGTCATCTTC
CAAGACCACGTCTTGCGCCTCGACTCGTGGCTCTCCCGCCATCCCGGAGGCTCTCTCGCGATATTGCACATGATT
GGTCGAGATGCCACGGACGAGATTACAGTACACCACGCTGCCCCGACCTTGCGTACCATGTCCGCCTTTCGCATC
GGCCGCAAGCCACCCGGCCTCTGGACCAACAGGACACCGCCCATCAGGCAGGGCCCGCTGCCAGTCCTTGAGCCC
GCCCTCTCGGACGACTCCCTCCCCGACGACGACACCAACAGCAGCCCGTCCACGGCGCCAACCTCTCCGCCCACC
AGCTCCTATGGCGACGATAAGGTCGACGAGCACCAGCTTCGGAGACGAAAGGGCAGGGACGTCGTCACGACCGTA
TTGGATGACCCTGCCAGCGTCATCGACGCGGCTGTTCAGTCTCGTCTCGACCGCGATGTCCGCGATTATCCATCG
GTCGACCCCGCCGTGCAGCAGGACATCGTGGCCAAGTATCGTCAGTTGCACCAAAAGATTATCGACGAGGGCCTT
TACGATTGCCCGTACCGTGAGGTTGCAAAGGATCTTGTCCGCTTCCTGATTCTGTTCAGCGCCTTCATGGTCGCT
CTCCGCTATGAGTGGTACCTGACCTCGTCCTTTTTCCTGGGGCTCTTTTGGCACCAAATCATGTTCACCGCCCAC
GATGCCGGTCACCGAGCCATCACCCACAACTTCGTCGTCGATACCCTCATCGGCATGTTCATTGCCGATTTTTGC
TGCGGCCTGTCCATCGGCTGGTGGAAGAGCAGCCACAATGTCCACCACCTTATCACCAATCAACCTGAGCACGAC
CCGGACATCCAGAATGTTCCCCTTTTCGCCACATGCCCGTCCTTCTTCAAGTCGATAACCTCGACGTACTACCCC
AACTTCGTCATTGTCTGGGACGCCGCCGCCGACTTGCTGGTGCCCTATCAAAAGTACACTTACTATCCGGTCCTG
GCCATTGCCCGCTTCAATCTCTATATCTTGTCGTGGCTGCACGTCCTCTCTTCCAAGTCGTCTTCGCTGGCAGGG
ACCAAGGCCTGGTGGATTCGTCCCGGCGAGATCAGCTTCATGTGTTGCTACTGGTTCCTCTTCGGCTATTGCCTG
CTCTGGCGCTCGCTTCCGACTTGGACGGCACGCGTCGTCTATACGCTCGTGTCCCACATCGTCACCATGCCCCTG
CACGTCCAGATCAACCTGTCTCACTGGGGCATGTCGACGTCCGACTTGGGCCCGTCCGAGTCCTTTCCCCAGCGA
CAACTACGGGCCACCATGGACGTCGACTGCCCAACCTGGCTCGACTTTTACCACGGAGGACTGCAGTTCCAGGCG
GTCCACCACCTGTTCCCTCGTCTGCCGCGGCACAACCTCCGCAAGGCGCAGGCCTTTGTCAAGGAGTTTTGCCAG
TCGACGGGCATCCCCTACACCATCCTGACCTTTACGGATGGAAACCGCAAGGTGCTGGGCCGGCTGCAGGAGGTG
ACGGACCAGCTGGCCGTGCTGGCCAAGTGCCAAAAGTCGCTGGCTGAGAGCGGGACGTACGACCTGCACTGA
Transcript >Ophun1|405
ATGGATCGCGACAAAGTCCTCTCTCAGGCCGCCGTCGACGCCCTCATCGCCGACGGACAGACCATCGTCATCTTC
CAAGACCACGTCTTGCGCCTCGACTCGTGGCTCTCCCGCCATCCCGGAGGCTCTCTCGCGATATTGCACATGATT
GGTCGAGATGCCACGGACGAGATTACAGTACACCACGCTGCCCCGACCTTGCGTACCATGTCCGCCTTTCGCATC
GGCCGCAAGCCACCCGGCCTCTGGACCAACAGGACACCGCCCATCAGGCAGGGCCCGCTGCCAGTCCTTGAGCCC
GCCCTCTCGGACGACTCCCTCCCCGACGACGACACCAACAGCAGCCCGTCCACGGCGCCAACCTCTCCGCCCACC
AGCTCCTATGGCGACGATAAGGTCGACGAGCACCAGCTTCGGAGACGAAAGGGCAGGGACGTCGTCACGACCGTA
TTGGATGACCCTGCCAGCGTCATCGACGCGGCTGTTCAGTCTCGTCTCGACCGCGATGTCCGCGATTATCCATCG
GTCGACCCCGCCGTGCAGCAGGACATCGTGGCCAAGTATCGTCAGTTGCACCAAAAGATTATCGACGAGGGCCTT
TACGATTGCCCGTACCGTGAGGTTGCAAAGGATCTTGTCCGCTTCCTGATTCTGTTCAGCGCCTTCATGGTCGCT
CTCCGCTATGAGTGGTACCTGACCTCGTCCTTTTTCCTGGGGCTCTTTTGGCACCAAATCATGTTCACCGCCCAC
GATGCCGGTCACCGAGCCATCACCCACAACTTCGTCGTCGATACCCTCATCGGCATGTTCATTGCCGATTTTTGC
TGCGGCCTGTCCATCGGCTGGTGGAAGAGCAGCCACAATGTCCACCACCTTATCACCAATCAACCTGAGCACGAC
CCGGACATCCAGAATGTTCCCCTTTTCGCCACATGCCCGTCCTTCTTCAAGTCGATAACCTCGACGTACTACCCC
AACTTCGTCATTGTCTGGGACGCCGCCGCCGACTTGCTGGTGCCCTATCAAAAGTACACTTACTATCCGGTCCTG
GCCATTGCCCGCTTCAATCTCTATATCTTGTCGTGGCTGCACGTCCTCTCTTCCAAGTCGTCTTCGCTGGCAGGG
ACCAAGGCCTGGTGGATTCGTCCCGGCGAGATCAGCTTCATGTGTTGCTACTGGTTCCTCTTCGGCTATTGCCTG
CTCTGGCGCTCGCTTCCGACTTGGACGGCACGCGTCGTCTATACGCTCGTGTCCCACATCGTCACCATGCCCCTG
CACGTCCAGATCAACCTGTCTCACTGGGGCATGTCGACGTCCGACTTGGGCCCGTCCGAGTCCTTTCCCCAGCGA
CAACTACGGGCCACCATGGACGTCGACTGCCCAACCTGGCTCGACTTTTACCACGGAGGACTGCAGTTCCAGGCG
GTCCACCACCTGTTCCCTCGTCTGCCGCGGCACAACCTCCGCAAGGCGCAGGCCTTTGTCAAGGAGTTTTGCCAG
TCGACGGGCATCCCCTACACCATCCTGACCTTTACGGATGGAAACCGCAAGGTGCTGGGCCGGCTGCAGGAGGTG
ACGGACCAGCTGGCCGTGCTGGCCAAGTGCCAAAAGTCGCTGGCTGAGAGCGGGACGTACGACCTGCACTGA
Gene >Ophun1|405
ATGGATCGCGACAAAGTCCTCTCTCAGGCCGCCGTCGACGCCCTCATCGCCGACGGACAGACCATCGTCATCTTC
CAAGACCACGTCTTGCGCCTCGACTCGTGGCTCTCCCGCCATCCCGGAGGCTCTCTCGCGATATTGCACATGATT
GGTCGAGATGCCACGGACGAGATTACAGTGTAAATGGCCCGCTCCAAGCACAAAAAGGAAAAAATCAGAAGCCAA
AGACCCTTCTTTAGGATCGGTCCGGTCCGTGCTAAGCCCAATGGGCTCAGACCACGATGAAACATACCTTGGGCT
AACATCTTTGGCACTTGCAGACACCACGCTGCCCCGACCTTGCGTACCATGTCCGCCTTTCGCATCGGCCGCAAG
CCACCCGGCCTCTGGACCAACAGGACACCGCCCATCAGGCAGGGCCCGCTGCCAGTCCTTGAGCCCGCCCTCTCG
GACGACTCCCTCCCCGACGACGACACCAACAGCAGCCCGTCCACGGCGCCAACCTCTCCGCCCACCAGCTCCTAT
GGCGACGATAAGGTCGACGAGCACCAGCTTCGGAGACGAAAGGGCAGGGACGTCGTCACGACCGTATTGGATGAC
CCTGCCAGCGTCATCGACGCGGCTGTTCAGTCTCGTCTCGACCGCGATGTCCGCGATTATCCATCGGTCGACCCC
GCCGTGCAGCAGGACATCGTGGCCAAGTATCGTCAGTTGCACCAAAAGATTATCGACGAGGGCCTTTACGATTGC
CCGTACCGTGAGGTTGCAAAGGATCTTGTCCGCTTCCTGATTCTGTTCAGCGCCTTCATGGTCGCTCTCCGCTAT
GAGTGGTACCTGACCTCGTCCTTTTTCCTGGGGCTCTTTTGGGTACGTCGTCCTTCTACTACTCGACGAGGCTAC
GCTCATGTTTGGGTGCAGCACCAAATCATGTTCACCGCCCACGATGCCGGTCACCGAGCCATCACCCACAACTTC
GTCGTCGATACCCTCATCGGCATGTTCATTGCCGATTTTTGCTGCGGCCTGTCCATCGGCTGGTGGAAGAGCAGC
CACAATGTCCACCACCTTATCACCAATCAACCTGTCGGTCCTTGCCCTTCTCCCCTAGATGCTACTGCTGCTGAC
GCCGTCGTGTTGCAGGAGCACGACCCGGACATCCAGAATGTTCCCCTTTTCGCCACATGCCCGTCCTTCTTCAAG
TCGATAACCTCGACGTACTACCCCAACTTCGTCATTGTCTGGGACGCCGCCGCCGACTTGCTGGTGCCCTATCAA
AAGTACACTTACTATCCGGTCCTGGCCATTGCCCGCTTCAATCTCTATATCTTGTCGTGGCTGCACGTCCTCTCT
TCCAAGTCGTCTTCGCTGGCAGGGACCAAGGCCTGGTGGATTCGTCCCGGCGAGATCAGCTTCATGTGTTGCTAC
TGGTTCCTCTTCGGCTATTGCCTGCTCTGGCGCTCGCTTCCGACTTGGACGGCACGCGTCGTCTATACGCTCGTG
TCCCACATCGTCACCATGCCCCTGCACGTCCAGATCAACCTGTCTCACTGGGGCATGTCGACGTCCGACTTGGGC
CCGTCCGAGTCCTTTCCCCAGCGACAACTACGGGCCACCATGGACGTCGACTGCCCAACCTGGCTCGACTTTTAC
CACGGAGGACTGCAGTTCCAGGCGGTCCACCACCTGTTCCCTCGTCTGCCGCGGCACAACCTCCGCAAGGCGCAG
GCCTTTGTCAAGGAGTTTTGCCAGTCGACGGGCATCCCCTACACCATCCTGACCTTTACGGATGGAAACCGCAAG
GTGCTGGGCCGGCTGCAGGAGGTGACGGACCAGCTGGCCGTGCTGGCCAAGTGCCAAAAGTCGCTGGCTGAGAGC
GGGACGTACGACCTGCACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail