Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4044
Gene name
LocationContig_369:11855..13443
Strand-
Gene length (bp)1588
Transcript length (bp)1524
Coding sequence length (bp)1524
Protein length (aa) 508

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00144 Beta-lactamase Beta-lactamase 2.6E-51 9 338
PF11954 DUF3471 Domain of unknown function (DUF3471) 4.1E-12 404 504

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P24735|AMPC_PSEAE Beta-lactamase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ampC PE=1 SV=2 11 358 7.0E-12
sp|Q06317|PBP4_AMYLA Penicillin-binding protein 4 OS=Amycolatopsis lactamdurans GN=pbp PE=3 SV=1 4 354 1.0E-10
sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase OS=Streptomyces sp. (strain R61) PE=1 SV=2 23 321 2.0E-09
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 17 335 3.0E-09
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 17 335 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P24735|AMPC_PSEAE Beta-lactamase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ampC PE=1 SV=2 11 358 7.0E-12
sp|Q06317|PBP4_AMYLA Penicillin-binding protein 4 OS=Amycolatopsis lactamdurans GN=pbp PE=3 SV=1 4 354 1.0E-10
sp|P15555|DAC_STRSR D-alanyl-D-alanine carboxypeptidase OS=Streptomyces sp. (strain R61) PE=1 SV=2 23 321 2.0E-09
sp|Q8NUZ4|FLP_STAAW Protein flp OS=Staphylococcus aureus (strain MW2) GN=flp PE=3 SV=1 17 335 3.0E-09
sp|Q6G6M9|FLP_STAAS Protein flp OS=Staphylococcus aureus (strain MSSA476) GN=flp PE=3 SV=1 17 335 1.0E-08
sp|P85302|AMPC_PSEFL Beta-lactamase OS=Pseudomonas fluorescens GN=ampC PE=1 SV=1 13 337 1.0E-08
sp|P32959|PBPE_BACSU Penicillin-binding protein 4* OS=Bacillus subtilis (strain 168) GN=pbpE PE=1 SV=1 16 318 1.0E-08
sp|P00811|AMPC_ECOLI Beta-lactamase OS=Escherichia coli (strain K12) GN=ampC PE=1 SV=1 13 258 2.0E-08
sp|Q5HDB2|FLP_STAAC Protein flp OS=Staphylococcus aureus (strain COL) GN=flp PE=4 SV=1 17 335 3.0E-08
sp|O31773|PBPX_BACSU Putative penicillin-binding protein PbpX OS=Bacillus subtilis (strain 168) GN=pbpX PE=2 SV=1 29 257 3.0E-08
sp|Q6GDZ1|FLP_STAAR Protein flp OS=Staphylococcus aureus (strain MRSA252) GN=flp PE=3 SV=1 17 335 3.0E-08
sp|C0RM93|DAP_BRUMB D-aminopeptidase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=dap PE=3 SV=1 11 335 8.0E-08
sp|Q8FV99|DAP_BRUSU D-aminopeptidase OS=Brucella suis biovar 1 (strain 1330) GN=dap PE=3 SV=1 11 335 9.0E-08
sp|B2SD81|DAP_BRUA1 D-aminopeptidase OS=Brucella abortus (strain S19) GN=dap PE=3 SV=1 11 335 9.0E-08
sp|Q2YLB4|DAP_BRUA2 D-aminopeptidase OS=Brucella abortus (strain 2308) GN=dap PE=3 SV=1 11 335 9.0E-08
sp|Q579G4|DAP_BRUAB D-aminopeptidase OS=Brucella abortus biovar 1 (strain 9-941) GN=dap PE=3 SV=1 11 335 9.0E-08
sp|A9MCM7|DAP_BRUC2 D-aminopeptidase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=dap PE=3 SV=1 11 335 9.0E-08
sp|A9WVV8|DAP_BRUSI D-aminopeptidase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=dap PE=3 SV=1 11 335 9.0E-08
sp|Q8YD27|DAP_BRUME D-aminopeptidase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=dap PE=3 SV=1 11 335 9.0E-08
sp|Q7A3Q5|FLP_STAAN Protein flp OS=Staphylococcus aureus (strain N315) GN=flp PE=1 SV=1 17 335 1.0E-07
sp|Q99RJ0|FLP_STAAM Protein flp OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=flp PE=3 SV=1 17 335 1.0E-07
sp|Q9KJ74|FLP_STAAU Protein flp OS=Staphylococcus aureus GN=flp PE=4 SV=1 17 335 3.0E-07
sp|Q2FVH6|FLP_STAA8 Protein flp OS=Staphylococcus aureus (strain NCTC 8325) GN=flp PE=4 SV=1 17 335 3.0E-07
sp|P18539|AMPC_SERMA Beta-lactamase OS=Serratia marcescens GN=ampC PE=3 SV=1 8 119 3.0E-07
sp|P05193|AMPC_CITFR Beta-lactamase OS=Citrobacter freundii GN=ampC PE=1 SV=1 13 354 4.0E-07
sp|P45460|AMPC_YEREN Beta-lactamase OS=Yersinia enterocolitica GN=ampC PE=3 SV=1 16 317 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup111
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|115
Ophiocordyceps camponoti-floridani Ophcf2|03858
Ophiocordyceps camponoti-floridani Ophcf2|05282
Ophiocordyceps camponoti-rufipedis Ophun1|4044 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7452
Ophiocordyceps kimflemingae Ophio5|1649
Ophiocordyceps kimflemingae Ophio5|4067
Ophiocordyceps subramaniannii Hirsu2|1745
Ophiocordyceps subramaniannii Hirsu2|1988
Ophiocordyceps subramaniannii Hirsu2|230
Ophiocordyceps subramaniannii Hirsu2|2822
Ophiocordyceps subramaniannii Hirsu2|5585

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4044
MDLFRSADFAAYVKKLIERHHVPGLSIAIVQDGKVASAAYGKASLDPPRDCSPDTLFYVGSLVKSLTAASAGLLV
EYDKYPDVQFDAPMAKLLPGDFVMPGDEHDDVTLEDVLCHRTGMAPHEYSILGPKAKKPDTPQSVTRNLRNLSVM
APNRAEHNYCNMLYTVVTYLIERVSGMGFYDFLRKNIFDPLDMKSTFALRDNVRQAGLENKLATGYTWEKTGGKN
RKVVVDDSPEAQGAGQMYSTVLDYAKWIKAMLQHEGPLTEKLATTLVTKRIQQDPEDDPEQETCVFYALGWLVQQ
YSGYKIVSHEGNEPGFKCNSFFLPELNFGGVIFTNSDLADTVVSLLMYRMIDEVVQKGSNGRAIREEGLGSESES
ESESVTDDDEDDDGLEDELREELSPGLEKPEPQKLPLSTYTATYSHPGYHDFTVQVKDDALFIDATDRSYGFTLT
FKHICEQTKYICYMLLSTDPRDTPIKAEFRLEDDKAVKMGLNLQDWNDEYVWFERVE*
Coding >Ophun1|4044
ATGGATCTCTTCCGCTCTGCCGACTTTGCGGCCTACGTCAAGAAGCTGATCGAGCGCCACCACGTGCCTGGTCTG
TCCATTGCCATCGTCCAAGATGGAAAGGTGGCTTCGGCTGCTTATGGCAAGGCATCGCTTGATCCCCCGCGAGAC
TGCAGCCCCGACACGCTCTTCTACGTCGGCTCGTTAGTCAAGTCGTTGACGGCTGCGTCCGCGGGCTTGCTAGTG
GAATACGACAAGTATCCGGATGTGCAGTTCGACGCTCCCATGGCGAAGCTCTTGCCTGGCGACTTTGTCATGCCC
GGGGACGAACACGACGATGTCACGCTTGAAGATGTTCTCTGCCACCGGACCGGCATGGCTCCCCACGAGTACTCC
ATCCTCGGCCCCAAGGCCAAGAAGCCGGACACGCCGCAATCCGTGACAAGGAACCTCCGGAACCTCTCCGTCATG
GCGCCGAACCGGGCCGAGCACAACTACTGCAACATGCTGTACACGGTCGTCACCTACCTGATAGAACGGGTCAGC
GGCATGGGCTTCTACGACTTTCTGCGCAAGAACATCTTCGACCCTCTCGACATGAAGTCGACCTTTGCCCTCAGA
GACAATGTCCGACAAGCAGGCCTCGAAAACAAGCTGGCCACCGGCTATACGTGGGAAAAGACCGGGGGAAAGAAC
CGCAAGGTCGTGGTGGACGACAGCCCCGAGGCTCAGGGCGCAGGCCAGATGTACTCGACTGTCCTGGACTATGCC
AAATGGATCAAGGCCATGCTCCAGCACGAGGGGCCCCTGACGGAGAAGCTGGCGACGACACTGGTAACCAAGCGT
ATACAGCAGGATCCGGAGGATGATCCGGAGCAGGAGACATGTGTGTTTTACGCTCTTGGCTGGCTGGTGCAGCAG
TACAGCGGTTACAAGATTGTCTCCCACGAGGGAAACGAGCCCGGCTTCAAGTGCAACAGCTTCTTCCTGCCCGAG
CTCAACTTTGGCGGCGTCATTTTCACAAACTCGGACCTGGCCGATACCGTCGTCAGTCTGCTCATGTACCGCATG
ATCGACGAGGTGGTGCAAAAGGGATCTAACGGGAGGGCCATTCGCGAGGAGGGTCTCGGGTCCGAGTCTGAGTCC
GAGTCTGAGTCGGTCACTGACGATGACGAGGATGACGATGGGTTGGAGGATGAGCTTCGCGAGGAGCTTAGCCCC
GGCCTGGAGAAGCCCGAGCCGCAGAAGCTGCCGCTGAGCACTTATACGGCTACCTACTCGCACCCGGGCTACCAC
GACTTTACGGTTCAGGTCAAGGATGACGCGCTCTTCATCGACGCAACCGACCGGTCCTACGGCTTCACCCTGACC
TTCAAGCACATCTGCGAGCAGACCAAGTACATTTGCTACATGCTCCTGTCAACCGACCCGCGGGACACGCCCATC
AAGGCTGAGTTCCGGCTTGAGGACGACAAGGCCGTCAAGATGGGACTAAACCTGCAGGACTGGAACGACGAGTAC
GTCTGGTTTGAACGGGTGGAATAA
Transcript >Ophun1|4044
ATGGATCTCTTCCGCTCTGCCGACTTTGCGGCCTACGTCAAGAAGCTGATCGAGCGCCACCACGTGCCTGGTCTG
TCCATTGCCATCGTCCAAGATGGAAAGGTGGCTTCGGCTGCTTATGGCAAGGCATCGCTTGATCCCCCGCGAGAC
TGCAGCCCCGACACGCTCTTCTACGTCGGCTCGTTAGTCAAGTCGTTGACGGCTGCGTCCGCGGGCTTGCTAGTG
GAATACGACAAGTATCCGGATGTGCAGTTCGACGCTCCCATGGCGAAGCTCTTGCCTGGCGACTTTGTCATGCCC
GGGGACGAACACGACGATGTCACGCTTGAAGATGTTCTCTGCCACCGGACCGGCATGGCTCCCCACGAGTACTCC
ATCCTCGGCCCCAAGGCCAAGAAGCCGGACACGCCGCAATCCGTGACAAGGAACCTCCGGAACCTCTCCGTCATG
GCGCCGAACCGGGCCGAGCACAACTACTGCAACATGCTGTACACGGTCGTCACCTACCTGATAGAACGGGTCAGC
GGCATGGGCTTCTACGACTTTCTGCGCAAGAACATCTTCGACCCTCTCGACATGAAGTCGACCTTTGCCCTCAGA
GACAATGTCCGACAAGCAGGCCTCGAAAACAAGCTGGCCACCGGCTATACGTGGGAAAAGACCGGGGGAAAGAAC
CGCAAGGTCGTGGTGGACGACAGCCCCGAGGCTCAGGGCGCAGGCCAGATGTACTCGACTGTCCTGGACTATGCC
AAATGGATCAAGGCCATGCTCCAGCACGAGGGGCCCCTGACGGAGAAGCTGGCGACGACACTGGTAACCAAGCGT
ATACAGCAGGATCCGGAGGATGATCCGGAGCAGGAGACATGTGTGTTTTACGCTCTTGGCTGGCTGGTGCAGCAG
TACAGCGGTTACAAGATTGTCTCCCACGAGGGAAACGAGCCCGGCTTCAAGTGCAACAGCTTCTTCCTGCCCGAG
CTCAACTTTGGCGGCGTCATTTTCACAAACTCGGACCTGGCCGATACCGTCGTCAGTCTGCTCATGTACCGCATG
ATCGACGAGGTGGTGCAAAAGGGATCTAACGGGAGGGCCATTCGCGAGGAGGGTCTCGGGTCCGAGTCTGAGTCC
GAGTCTGAGTCGGTCACTGACGATGACGAGGATGACGATGGGTTGGAGGATGAGCTTCGCGAGGAGCTTAGCCCC
GGCCTGGAGAAGCCCGAGCCGCAGAAGCTGCCGCTGAGCACTTATACGGCTACCTACTCGCACCCGGGCTACCAC
GACTTTACGGTTCAGGTCAAGGATGACGCGCTCTTCATCGACGCAACCGACCGGTCCTACGGCTTCACCCTGACC
TTCAAGCACATCTGCGAGCAGACCAAGTACATTTGCTACATGCTCCTGTCAACCGACCCGCGGGACACGCCCATC
AAGGCTGAGTTCCGGCTTGAGGACGACAAGGCCGTCAAGATGGGACTAAACCTGCAGGACTGGAACGACGAGTAC
GTCTGGTTTGAACGGGTGGAATAA
Gene >Ophun1|4044
ATGGATCTCTTCCGCTCTGCCGACTTTGCGGCCTACGTCAAGAAGCTGATCGAGCGCCACCACGTGCCTGGTCTG
TCCATTGCCATCGTCCAAGATGGAAAGGTGGCTTCGGCTGCTTATGGCAAGGCATCGCTTGATCCCCCGCGAGAC
TGCAGCCCCGACACGCTCTTCTACGTCGGCTCGTTAGTCAAGTCGTTGACGGCTGCGTCCGCGGGCTTGCTAGTG
GAATACGACAAGTATCCGGATGTGCAGTTCGACGCTCCCATGGCGAAGCTCTTGCCTGGCGACTTTGTCATGCCC
GGGGACGAACACGACGATGTCACGCTTGAAGATGTTCTCTGCCACCGGACCGGCATGGCTCCGTAAGTCGATCCA
TGTCCGGATTTGCTATAACGAGAGACGACTAACAAGATATACCCTTAACAGCCACGAGTACTCCATCCTCGGCCC
CAAGGCCAAGAAGCCGGACACGCCGCAATCCGTGACAAGGAACCTCCGGAACCTCTCCGTCATGGCGCCGAACCG
GGCCGAGCACAACTACTGCAACATGCTGTACACGGTCGTCACCTACCTGATAGAACGGGTCAGCGGCATGGGCTT
CTACGACTTTCTGCGCAAGAACATCTTCGACCCTCTCGACATGAAGTCGACCTTTGCCCTCAGAGACAATGTCCG
ACAAGCAGGCCTCGAAAACAAGCTGGCCACCGGCTATACGTGGGAAAAGACCGGGGGAAAGAACCGCAAGGTCGT
GGTGGACGACAGCCCCGAGGCTCAGGGCGCAGGCCAGATGTACTCGACTGTCCTGGACTATGCCAAATGGATCAA
GGCCATGCTCCAGCACGAGGGGCCCCTGACGGAGAAGCTGGCGACGACACTGGTAACCAAGCGTATACAGCAGGA
TCCGGAGGATGATCCGGAGCAGGAGACATGTGTGTTTTACGCTCTTGGCTGGCTGGTGCAGCAGTACAGCGGTTA
CAAGATTGTCTCCCACGAGGGAAACGAGCCCGGCTTCAAGTGCAACAGCTTCTTCCTGCCCGAGCTCAACTTTGG
CGGCGTCATTTTCACAAACTCGGACCTGGCCGATACCGTCGTCAGTCTGCTCATGTACCGCATGATCGACGAGGT
GGTGCAAAAGGGATCTAACGGGAGGGCCATTCGCGAGGAGGGTCTCGGGTCCGAGTCTGAGTCCGAGTCTGAGTC
GGTCACTGACGATGACGAGGATGACGATGGGTTGGAGGATGAGCTTCGCGAGGAGCTTAGCCCCGGCCTGGAGAA
GCCCGAGCCGCAGAAGCTGCCGCTGAGCACTTATACGGCTACCTACTCGCACCCGGGCTACCACGACTTTACGGT
TCAGGTCAAGGATGACGCGCTCTTCATCGACGCAACCGACCGGTCCTACGGCTTCACCCTGACCTTCAAGCACAT
CTGCGAGCAGACCAAGTACATTTGCTACATGCTCCTGTCAACCGACCCGCGGGACACGCCCATCAAGGCTGAGTT
CCGGCTTGAGGACGACAAGGCCGTCAAGATGGGACTAAACCTGCAGGACTGGAACGACGAGTACGTCTGGTTTGA
ACGGGTGGAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail