Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4043
Gene name
LocationContig_369:8734..10989
Strand+
Gene length (bp)2255
Transcript length (bp)1980
Coding sequence length (bp)1980
Protein length (aa) 660

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 79 101 22
3 111 133 22
4 560 582 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup79
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4549
Ophiocordyceps australis 1348a (Ghana) OphauG2|2770
Ophiocordyceps australis map64 (Brazil) OphauB2|5422
Ophiocordyceps camponoti-floridani Ophcf2|05947
Ophiocordyceps camponoti-floridani Ophcf2|03859
Ophiocordyceps camponoti-rufipedis Ophun1|2838
Ophiocordyceps camponoti-rufipedis Ophun1|4043 (this protein)
Ophiocordyceps kimflemingae Ophio5|1128
Ophiocordyceps kimflemingae Ophio5|2420
Ophiocordyceps kimflemingae Ophio5|2711
Ophiocordyceps kimflemingae Ophio5|664
Ophiocordyceps subramaniannii Hirsu2|6042
Ophiocordyceps subramaniannii Hirsu2|5839
Ophiocordyceps subramaniannii Hirsu2|4649
Ophiocordyceps subramaniannii Hirsu2|4478
Ophiocordyceps subramaniannii Hirsu2|6765
Ophiocordyceps subramaniannii Hirsu2|1547

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4043
MSTSAQHRVHLGSWTDWSRGPVMGVTLTLDRTRASLLIAFTAFFIGIVASCFWRIVVFFIHRLYSTPNPRDALHH
QRQVLLRNSVTAPSSLLAFSQLYWTWRREGGTIWRTLPVIICAVASIVIFTVASGFSSQISSAVGNAALLDGSRC
GIVAGAAQAGRLEDLGVLLPYGIRRITDSANYAQQCYGARGAGLLDCATFIKRSLPYSTDDQAPCPFQGGICRTN
TSNLLFDTGYLNSHEHLGVNSSPDRRILFKTTLHCAPLQTDGYSRDIQTPFRNYTRYYYGRRTHDTSQDHDGNYT
LQVRDLNDQYDHFKHGFDNTDGHWSPTLQSYVAFVRNGRLQPTGSEFVPIPQLFRSDGDLMIFFLSGNGAVFMRP
TPDPWYRGTVPGQNVSMDHSADSLTLQTFEPEEAASPMACLQRHQFCDGYGHCGPLASYLDALAGARSVFNSTVL
EVPQDDEQPATPFATFRRALGSALGVIDLMVSSFQGNALLSQQVSSSGLRGPLPDNQWQLDVTYWWTTMLAAIQA
SFVQMAAGTTDAELEPYVMHLNSSYKILASAFTSFSVFGLYFVYILGFVIIIVSIALEPLLNFLRERRDPKLYTH
LERQSDQVLQLQRAAYQGIGSGTWIGFAGAVPRTKRVEALADLSGHYQEAGHVSSQWSL*
Coding >Ophun1|4043
ATGAGCACCTCGGCCCAGCATCGCGTCCATCTTGGATCATGGACGGACTGGTCGCGCGGGCCCGTCATGGGCGTC
ACTCTCACCCTCGACCGAACACGAGCTTCGCTGCTCATAGCCTTTACAGCCTTCTTCATCGGCATCGTCGCCTCC
TGCTTCTGGCGAATCGTCGTCTTCTTCATCCATCGTCTCTACTCAACGCCTAATCCCCGCGATGCCCTCCATCAC
CAGCGCCAAGTCCTCCTCCGCAACTCCGTAACCGCTCCCTCCAGCCTCCTGGCCTTTTCGCAGCTGTACTGGACC
TGGCGTCGAGAAGGGGGCACCATATGGAGGACGCTCCCCGTGATAATCTGCGCCGTGGCCTCGATTGTCATCTTT
ACCGTTGCCAGTGGCTTCTCGTCTCAGATATCGTCGGCGGTTGGGAACGCTGCCTTGCTGGATGGCTCGCGCTGC
GGTATTGTTGCTGGTGCGGCTCAGGCTGGGCGCTTGGAGGATCTCGGTGTTCTTCTTCCGTATGGGATTCGGCGC
ATCACCGACTCGGCCAACTATGCGCAGCAGTGTTACGGGGCTCGGGGCGCTGGTTTGCTGGATTGCGCGACCTTT
ATCAAGCGCAGTCTGCCGTATAGCACTGATGATCAGGCTCCGTGTCCCTTTCAGGGCGGTATCTGCCGGACCAAT
ACGTCCAACCTGCTGTTTGATACGGGATATCTAAACAGTCACGAGCATCTAGGCGTCAACTCATCTCCCGATCGT
CGAATCCTCTTCAAGACTACCTTGCACTGCGCGCCCCTACAGACAGACGGATACTCCAGAGACATCCAAACGCCC
TTCCGCAACTACACTCGATACTACTACGGCCGGAGAACACACGACACATCTCAAGATCACGACGGGAACTACACG
CTGCAAGTCCGCGACCTGAATGACCAGTACGATCACTTCAAGCACGGCTTCGACAATACGGACGGCCATTGGAGC
CCGACGCTGCAATCATACGTCGCCTTTGTCAGAAACGGTCGTCTACAACCCACAGGCTCAGAATTCGTGCCCATC
CCTCAGCTCTTCCGCTCTGACGGAGACCTCATGATCTTCTTCCTCTCCGGCAACGGCGCCGTATTCATGAGACCA
ACCCCCGATCCTTGGTATCGCGGAACCGTCCCCGGCCAAAACGTATCCATGGACCATTCCGCAGACTCCCTCACA
CTCCAAACATTCGAGCCCGAAGAAGCAGCTTCCCCCATGGCCTGCCTCCAACGACACCAGTTTTGCGACGGTTAC
GGCCACTGCGGACCGCTGGCTAGTTACCTTGATGCCCTCGCCGGCGCCAGAAGCGTCTTCAACTCGACCGTTCTC
GAAGTCCCTCAGGACGACGAGCAGCCGGCTACGCCGTTTGCAACGTTTCGGCGTGCCTTGGGATCGGCTCTGGGA
GTTATTGACTTGATGGTTTCTAGCTTTCAGGGGAATGCCCTTTTGTCTCAGCAGGTTTCTAGCAGTGGGCTCAGG
GGGCCTTTGCCTGATAACCAGTGGCAGCTTGATGTGACCTATTGGTGGACGACGATGCTGGCTGCTATCCAGGCT
TCTTTCGTTCAGATGGCTGCCGGCACGACGGATGCTGAACTCGAACCATATGTTATGCACCTCAACAGCTCCTAC
AAGATCTTGGCCTCGGCATTTACCTCGTTCAGCGTCTTTGGTCTTTACTTCGTCTACATTCTCGGCTTCGTCATC
ATCATCGTCTCCATCGCGCTCGAACCGCTGCTCAACTTCCTGAGAGAACGGCGCGACCCGAAACTATACACCCAT
CTGGAGCGCCAATCGGACCAGGTCCTCCAGCTTCAGCGTGCCGCTTATCAGGGCATCGGCTCCGGCACGTGGATA
GGCTTCGCTGGCGCTGTTCCAAGGACCAAGAGAGTGGAAGCCCTCGCTGATCTATCGGGTCATTATCAGGAGGCC
GGTCACGTATCGAGTCAGTGGAGTTTGTGA
Transcript >Ophun1|4043
ATGAGCACCTCGGCCCAGCATCGCGTCCATCTTGGATCATGGACGGACTGGTCGCGCGGGCCCGTCATGGGCGTC
ACTCTCACCCTCGACCGAACACGAGCTTCGCTGCTCATAGCCTTTACAGCCTTCTTCATCGGCATCGTCGCCTCC
TGCTTCTGGCGAATCGTCGTCTTCTTCATCCATCGTCTCTACTCAACGCCTAATCCCCGCGATGCCCTCCATCAC
CAGCGCCAAGTCCTCCTCCGCAACTCCGTAACCGCTCCCTCCAGCCTCCTGGCCTTTTCGCAGCTGTACTGGACC
TGGCGTCGAGAAGGGGGCACCATATGGAGGACGCTCCCCGTGATAATCTGCGCCGTGGCCTCGATTGTCATCTTT
ACCGTTGCCAGTGGCTTCTCGTCTCAGATATCGTCGGCGGTTGGGAACGCTGCCTTGCTGGATGGCTCGCGCTGC
GGTATTGTTGCTGGTGCGGCTCAGGCTGGGCGCTTGGAGGATCTCGGTGTTCTTCTTCCGTATGGGATTCGGCGC
ATCACCGACTCGGCCAACTATGCGCAGCAGTGTTACGGGGCTCGGGGCGCTGGTTTGCTGGATTGCGCGACCTTT
ATCAAGCGCAGTCTGCCGTATAGCACTGATGATCAGGCTCCGTGTCCCTTTCAGGGCGGTATCTGCCGGACCAAT
ACGTCCAACCTGCTGTTTGATACGGGATATCTAAACAGTCACGAGCATCTAGGCGTCAACTCATCTCCCGATCGT
CGAATCCTCTTCAAGACTACCTTGCACTGCGCGCCCCTACAGACAGACGGATACTCCAGAGACATCCAAACGCCC
TTCCGCAACTACACTCGATACTACTACGGCCGGAGAACACACGACACATCTCAAGATCACGACGGGAACTACACG
CTGCAAGTCCGCGACCTGAATGACCAGTACGATCACTTCAAGCACGGCTTCGACAATACGGACGGCCATTGGAGC
CCGACGCTGCAATCATACGTCGCCTTTGTCAGAAACGGTCGTCTACAACCCACAGGCTCAGAATTCGTGCCCATC
CCTCAGCTCTTCCGCTCTGACGGAGACCTCATGATCTTCTTCCTCTCCGGCAACGGCGCCGTATTCATGAGACCA
ACCCCCGATCCTTGGTATCGCGGAACCGTCCCCGGCCAAAACGTATCCATGGACCATTCCGCAGACTCCCTCACA
CTCCAAACATTCGAGCCCGAAGAAGCAGCTTCCCCCATGGCCTGCCTCCAACGACACCAGTTTTGCGACGGTTAC
GGCCACTGCGGACCGCTGGCTAGTTACCTTGATGCCCTCGCCGGCGCCAGAAGCGTCTTCAACTCGACCGTTCTC
GAAGTCCCTCAGGACGACGAGCAGCCGGCTACGCCGTTTGCAACGTTTCGGCGTGCCTTGGGATCGGCTCTGGGA
GTTATTGACTTGATGGTTTCTAGCTTTCAGGGGAATGCCCTTTTGTCTCAGCAGGTTTCTAGCAGTGGGCTCAGG
GGGCCTTTGCCTGATAACCAGTGGCAGCTTGATGTGACCTATTGGTGGACGACGATGCTGGCTGCTATCCAGGCT
TCTTTCGTTCAGATGGCTGCCGGCACGACGGATGCTGAACTCGAACCATATGTTATGCACCTCAACAGCTCCTAC
AAGATCTTGGCCTCGGCATTTACCTCGTTCAGCGTCTTTGGTCTTTACTTCGTCTACATTCTCGGCTTCGTCATC
ATCATCGTCTCCATCGCGCTCGAACCGCTGCTCAACTTCCTGAGAGAACGGCGCGACCCGAAACTATACACCCAT
CTGGAGCGCCAATCGGACCAGGTCCTCCAGCTTCAGCGTGCCGCTTATCAGGGCATCGGCTCCGGCACGTGGATA
GGCTTCGCTGGCGCTGTTCCAAGGACCAAGAGAGTGGAAGCCCTCGCTGATCTATCGGGTCATTATCAGGAGGCC
GGTCACGTATCGAGTCAGTGGAGTTTGTGA
Gene >Ophun1|4043
ATGAGCACCTCGGCCCAGCATCGCGTCCATCTTGGATCATGGACGGACTGGTCGCGCGGGCCCGTCATGGGCGTC
ACTCTCACCCTCGACCGAACACGAGCTTCGCTGCTCATAGCCTTTACAGCCTTCTTCATCGGCATCGTCGCCTCC
TGCTTCTGGCGAATCGTCGTCTTCTTCATCCATCGTCTCTACTCAACGCCTAATCCCCGCGATGCCCTCCATCAC
CAGCGCCAAGTCCTCCTCCGCAACTCCGTAACCGCTCCCTCCAGCCTCCTGGCCTTTTCGCAGCTGTACTGGACC
TGGCGTCGAGAAGGGGGCACCATATGGAGGACGCTCCCCGTGATAATCTGCGCCGTGGCCTCGATTGTCATCTTT
ACCGTTGCCAGTGGCTTCTCGTCTCAGATATCGTCGGCGGTTGGGAACGCTGCCTTGCTGGATGGCTCGCGCTGC
GGTATTGTTGCTGGTGCGGCTCAGGCTGGGCGCTTGGAGGATCTCGGTGTTCTTCTTCCGTATGGGATTCGGCGC
ATCACCGACTCGGCCAACTATGCGCAGCAGTGTTACGGGGCTCGGGGCGCTGGTTTGCTGGATTGCGCGACCTTT
ATCAAGCGCAGTCTGCCGTATAGCACTGATGATCAGGCTCCGTGTCCCTTTCAGGGCGGTATCTGCCGGACCAAT
ACGTCCAACCTGCTGTTTGATACGGGATATCTAAACAGTCACGAGCATCTAGGTATGAGGGCATCGAGATTCTGC
TTTCACAAGACCGCGTCTAATGTTTACGTCTTAAACAGGCGTCAACTCATCTCCCGATCGTCGAATCCTCTTCAA
GACTACCTTGCACTGCGCGCCCCTACAGACAGACGGATACTCCAGAGACATCCAAACGCCCTTCCGCAACTACAC
TCGATACTACTACGGCCGGAGAACACACGACACATCTCAAGATCACGACGGGAACTACACGCTGCAAGTCCGCGA
CCTGAATGACCAGTACGATCACTTCAAGCACGGCTTCGACAATACGGACGGCCATTGGAGCCCGACGCTGCAGTG
AGTCCCTTTGCTCCTTGCTTCCTGTACTCCTAATACTCAAACGGCTGACATTCCCCAAGATCATACGTCGCCTTT
GTCAGAAACGGTCGTCTACAACCCACAGGCTCAGAATTCGTGCCCATCCCTCAGCTCTTCCGCTCTGACGGAGAC
CTCATGATCTTCTTCCTCTCCGGCAACGGCGCCGTATTCATGAGACCAACCCCCGATCCTTGGTATCGCGGAACC
GTCCCCGGCCAAAACGTATCCATGGACCATTCCGCAGACTCCCTCACACTCCAAACATTCGAGCCCGAAGAAGCA
GCTTCCCCCATGGCCTGCCTCCAACGACACCAGTTTTGCGACGGTTACGGCCACTGCGGACCGCTGGCTAGTTAC
CTTGATGCCCTCGCCGGCGCCAGAAGCGTCTTCAACTCGACCGTTCTCGAAGTCCCTCAGGACGACGAGCAGCCG
GCTACGCCGTTTGCAACGTTTCGGCGTGCCTTGGGATCGGCTCTGGGAGTTATTGACTTGATGGTTTCTAGCTTT
CAGGGGAATGCCCTTTTGTCTCAGCAGGTTTCTAGCAGTGGGCTCAGGGGGCCTTTGCCTGATAACCAGTGGCAG
CTTGATGTGACCTATTGGTGGACGACGATGCTGGCTGCTATCCAGGCTTCTTTCGTTCAGATGGCTGCCGGCACG
ACGGATGCTGAACTCGAACCATATGTTATGCACCTCAACAGCTCCTACGTGTGTAATAACCAGGTACTATATAGC
CCTGGACTGAGTCCTCCTGCTTCTCAAGACTGACCCAAAGTGCAGAAGATCTTGGCCTCGGCATTTACCTCGTTC
AGCGTCTTTGGTCTTTACTTCGTCTACATTCTCGGCTTCGTCATCATCATCGTCTCCATCGCGCTCGAACCGCTG
CTCAACTTCCTGAGAGAACGGCGCGACCCGAAACTATACACCCATCTGGAGCGCCAATCGGACCAGGTCCTCCAG
CTTCAGCGTGCCGCTTATCAGGGCATCGGCTCCGGCACGTGGATAGGCTTCGCTGGCGCTGTTCCAAGGACCAAG
AGAGTGGAAGCCCTCGCTGATCTATCGGGTCATTATCAGGAGGCCGGTCACGGTGAGAAGATGGGTGGTGTTGCG
GGAGAGTGTCCCTTGCTATCTGCCTCTACGAATACCGAGGGAGAACTCGGAGGGCAGTATCGAGTCAGTGGAGTT
TGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail