Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4034
Gene name
LocationContig_368:4322..10979
Strand-
Gene length (bp)6657
Transcript length (bp)5493
Coding sequence length (bp)5493
Protein length (aa) 1831

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 6.8E-72 290 569
PF04055 Radical_SAM Radical SAM superfamily 2.1E-22 1494 1671
PF08608 Wyosine_form Wyosine base formation 2.7E-23 1679 1747
PF00271 Helicase_C Helicase conserved C-terminal domain 4.4E-14 680 792
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 1.1E-07 612 649
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 9.0E-08 609 652
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 3.2E-07 612 649
PF13639 zf-RING_2 Ring finger domain 1.0E-06 610 650

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O59761|TYW1_SCHPO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyw1 PE=3 SV=1 1086 1813 0.0E+00
sp|Q08960|TYW1_YEAST S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYW1 PE=1 SV=1 1157 1812 0.0E+00
sp|Q8BJM7|TYW1_MOUSE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Mus musculus GN=Tyw1 PE=1 SV=1 1175 1817 7.0E-139
sp|Q2KHP8|TYW1_XENLA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Xenopus laevis GN=tyw1 PE=2 SV=1 1368 1817 8.0E-137
sp|Q08C92|TYW1_DANRE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Danio rerio GN=tyw1 PE=2 SV=1 1445 1817 3.0E-136
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O59761|TYW1_SCHPO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tyw1 PE=3 SV=1 1086 1813 0.0E+00
sp|Q08960|TYW1_YEAST S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TYW1 PE=1 SV=1 1157 1812 0.0E+00
sp|Q8BJM7|TYW1_MOUSE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Mus musculus GN=Tyw1 PE=1 SV=1 1175 1817 7.0E-139
sp|Q2KHP8|TYW1_XENLA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Xenopus laevis GN=tyw1 PE=2 SV=1 1368 1817 8.0E-137
sp|Q08C92|TYW1_DANRE S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Danio rerio GN=tyw1 PE=2 SV=1 1445 1817 3.0E-136
sp|Q9NV66|TYW1_HUMAN S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Homo sapiens GN=TYW1 PE=2 SV=2 1175 1817 2.0E-133
sp|Q5REF9|TYW1_PONAB S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pongo abelii GN=TYW1 PE=2 SV=1 1175 1817 4.0E-133
sp|Q8RXN5|TYW1_ARATH S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Arabidopsis thaliana GN=TYW1 PE=2 SV=1 1154 1829 1.0E-132
sp|Q8H8N3|TYW1_ORYSJ S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Oryza sativa subsp. japonica GN=TYW1 PE=2 SV=1 1261 1812 2.0E-127
sp|Q6NUM6|TYW1B_HUMAN S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Homo sapiens GN=TYW1B PE=2 SV=3 1486 1817 2.0E-104
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 68 852 6.0E-97
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 327 830 2.0E-92
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 327 835 5.0E-92
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 327 830 2.0E-88
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 236 830 3.0E-85
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 292 830 1.0E-82
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 279 872 5.0E-78
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 300 827 7.0E-78
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 281 822 2.0E-75
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 267 822 3.0E-75
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 327 829 2.0E-73
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 327 830 3.0E-73
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 281 824 7.0E-73
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 77 824 2.0E-72
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 300 827 5.0E-71
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 263 824 2.0E-70
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 281 822 4.0E-69
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 300 834 8.0E-69
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 281 822 9.0E-69
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 216 820 2.0E-68
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 300 827 6.0E-68
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 275 827 5.0E-67
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 226 824 5.0E-67
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 226 834 5.0E-65
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 235 823 7.0E-64
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 236 823 7.0E-63
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 281 826 8.0E-63
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 225 827 8.0E-56
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 327 832 1.0E-55
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 327 832 2.0E-55
sp|O59412|TYW1_PYRHO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=taw1 PE=1 SV=1 1448 1746 6.0E-54
sp|Q9V1F9|TYW1_PYRAB S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=taw1 PE=1 SV=1 1448 1746 1.0E-53
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 296 822 2.0E-50
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 300 842 1.0E-46
sp|Q57705|TYW1_METJA S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=taw1 PE=1 SV=1 1435 1696 6.0E-44
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 300 840 6.0E-44
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 300 840 8.0E-42
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 249 819 8.0E-41
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 300 812 2.0E-40
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 300 826 1.0E-39
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 302 822 3.0E-38
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 300 822 5.0E-37
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 300 822 7.0E-37
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 300 822 2.0E-36
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 253 822 3.0E-36
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 300 812 7.0E-36
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 300 822 8.0E-36
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 300 822 1.0E-35
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 300 822 1.0E-35
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 299 819 2.0E-34
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 300 812 5.0E-34
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 300 830 2.0E-33
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 299 889 4.0E-33
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 302 823 1.0E-32
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 299 567 2.0E-32
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 300 572 2.0E-28
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 607 827 7.0E-28
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 300 824 1.0E-27
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 300 826 5.0E-27
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 327 570 2.0E-26
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 300 576 1.0E-25
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 636 829 2.0E-25
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 301 574 4.0E-25
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 297 574 5.0E-25
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 300 567 5.0E-25
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 300 567 1.0E-24
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 300 567 1.0E-24
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 300 567 1.0E-24
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 238 574 2.0E-24
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 300 567 3.0E-24
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 300 603 5.0E-24
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 300 603 5.0E-24
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 300 567 6.0E-24
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 300 586 1.0E-23
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 299 574 4.0E-23
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 279 574 4.0E-23
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 254 572 6.0E-23
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 280 567 8.0E-23
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 665 850 1.0E-22
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 302 572 1.0E-22
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 300 567 1.0E-22
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 280 574 2.0E-22
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 658 829 2.0E-22
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 660 813 3.0E-22
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 300 567 3.0E-22
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 279 574 3.0E-22
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 299 574 3.0E-22
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 279 604 4.0E-22
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 300 574 4.0E-22
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 299 598 5.0E-22
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 279 592 5.0E-22
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 300 567 6.0E-22
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 273 574 6.0E-22
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 671 822 7.0E-22
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 279 567 8.0E-22
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 300 867 9.0E-22
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 634 877 1.0E-21
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 216 570 1.0E-21
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 279 567 1.0E-21
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 302 606 1.0E-21
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 628 822 1.0E-21
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 299 574 1.0E-21
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 279 567 1.0E-21
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 671 822 1.0E-21
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 640 822 2.0E-21
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 279 567 2.0E-21
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 302 606 2.0E-21
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 300 567 2.0E-21
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 602 822 2.0E-21
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 302 606 2.0E-21
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 691 875 3.0E-21
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 691 875 3.0E-21
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 684 822 3.0E-21
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 279 606 3.0E-21
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 279 606 3.0E-21
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 270 567 3.0E-21
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 671 822 3.0E-21
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 300 574 3.0E-21
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 279 567 3.0E-21
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 300 567 4.0E-21
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 279 567 4.0E-21
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 671 822 4.0E-21
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 671 822 4.0E-21
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 671 822 4.0E-21
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 684 822 6.0E-21
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 300 567 6.0E-21
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 300 567 6.0E-21
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 279 606 6.0E-21
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 279 567 7.0E-21
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 696 851 9.0E-21
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 660 921 9.0E-21
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 671 822 1.0E-20
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 669 848 1.0E-20
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 678 822 1.0E-20
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 649 827 2.0E-20
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 660 822 2.0E-20
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 300 846 2.0E-20
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 669 848 2.0E-20
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 669 848 2.0E-20
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 669 848 2.0E-20
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 669 848 2.0E-20
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 301 570 2.0E-20
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 696 851 3.0E-20
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 696 851 3.0E-20
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 671 822 3.0E-20
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 300 567 4.0E-20
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 670 840 4.0E-20
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 302 590 4.0E-20
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 300 570 4.0E-20
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 695 822 5.0E-20
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 228 567 5.0E-20
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 302 600 6.0E-20
sp|Q9M1I1|FB304_ARATH F-box protein At3g54460 OS=Arabidopsis thaliana GN=At3g54460 PE=2 SV=1 324 636 6.0E-20
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 697 813 9.0E-20
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 671 822 9.0E-20
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 684 822 1.0E-19
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 697 822 1.0E-19
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 678 822 1.0E-19
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 279 567 1.0E-19
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 642 842 1.0E-19
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 669 838 1.0E-19
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 660 813 2.0E-19
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 695 822 2.0E-19
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 300 567 2.0E-19
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 671 822 2.0E-19
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 300 567 2.0E-19
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 300 579 2.0E-19
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 300 567 2.0E-19
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 697 836 2.0E-19
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 279 572 2.0E-19
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 660 813 3.0E-19
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 684 822 3.0E-19
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 660 813 3.0E-19
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 279 574 3.0E-19
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 681 822 3.0E-19
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 300 567 3.0E-19
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 299 567 3.0E-19
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 663 823 3.0E-19
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 678 871 3.0E-19
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 300 567 3.0E-19
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 663 823 3.0E-19
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 695 822 3.0E-19
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 695 851 4.0E-19
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 684 822 4.0E-19
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 279 572 4.0E-19
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 663 823 4.0E-19
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 300 574 4.0E-19
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 676 856 4.0E-19
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 679 822 5.0E-19
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 660 822 5.0E-19
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 302 572 5.0E-19
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 300 567 5.0E-19
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 684 822 6.0E-19
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 300 567 6.0E-19
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 695 863 8.0E-19
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 300 567 8.0E-19
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 300 576 8.0E-19
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 300 576 8.0E-19
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 300 576 8.0E-19
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 695 822 1.0E-18
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 683 840 1.0E-18
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 681 866 1.0E-18
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 582 856 1.0E-18
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 695 822 2.0E-18
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 679 822 2.0E-18
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 660 813 2.0E-18
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 695 847 2.0E-18
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 678 822 2.0E-18
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 678 822 2.0E-18
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 298 574 2.0E-18
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 300 567 2.0E-18
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 300 567 2.0E-18
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 301 571 2.0E-18
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 300 567 2.0E-18
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 675 847 2.0E-18
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 300 567 2.0E-18
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 673 822 2.0E-18
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 675 847 2.0E-18
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 300 567 3.0E-18
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 681 843 3.0E-18
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 681 843 3.0E-18
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 681 843 3.0E-18
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 681 843 3.0E-18
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 298 572 3.0E-18
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 673 822 3.0E-18
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 294 572 3.0E-18
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 676 823 3.0E-18
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 563 825 3.0E-18
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 695 822 4.0E-18
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 300 567 4.0E-18
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 582 856 4.0E-18
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 678 855 4.0E-18
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 302 497 5.0E-18
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 675 841 5.0E-18
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 673 822 5.0E-18
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 300 570 6.0E-18
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 675 829 6.0E-18
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 300 497 6.0E-18
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 679 822 8.0E-18
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 294 572 9.0E-18
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 668 829 1.0E-17
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 300 570 1.0E-17
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 677 813 1.0E-17
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 678 825 1.0E-17
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 236 576 1.0E-17
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 302 567 1.0E-17
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 300 453 1.0E-17
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 695 823 1.0E-17
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 695 823 1.0E-17
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 300 570 2.0E-17
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 300 570 2.0E-17
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 675 823 2.0E-17
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 623 819 2.0E-17
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 236 576 2.0E-17
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 300 497 2.0E-17
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 675 823 2.0E-17
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 300 570 3.0E-17
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 300 567 3.0E-17
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 300 570 4.0E-17
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 638 823 4.0E-17
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 695 822 4.0E-17
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 638 824 6.0E-17
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 300 570 6.0E-17
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 300 599 6.0E-17
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 302 567 6.0E-17
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 236 576 7.0E-17
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 300 577 7.0E-17
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 679 822 8.0E-17
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 300 567 8.0E-17
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 657 823 8.0E-17
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 236 576 8.0E-17
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 665 839 1.0E-16
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 244 577 1.0E-16
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 659 843 1.0E-16
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 668 822 1.0E-16
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 697 816 2.0E-16
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 683 823 2.0E-16
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 300 451 2.0E-16
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 691 830 2.0E-16
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 293 478 2.0E-16
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 679 830 2.0E-16
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 683 840 3.0E-16
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 634 848 3.0E-16
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 683 819 3.0E-16
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 683 824 3.0E-16
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 672 869 3.0E-16
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 697 831 3.0E-16
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 681 848 4.0E-16
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 681 848 4.0E-16
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 300 570 4.0E-16
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 660 830 5.0E-16
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 695 841 6.0E-16
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 300 576 6.0E-16
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 672 830 6.0E-16
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 683 851 6.0E-16
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 695 841 7.0E-16
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 695 841 7.0E-16
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 302 567 8.0E-16
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 300 576 8.0E-16
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 300 570 8.0E-16
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 300 576 8.0E-16
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 236 576 1.0E-15
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 683 843 1.0E-15
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 672 891 1.0E-15
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 672 822 1.0E-15
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 695 877 2.0E-15
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 300 452 2.0E-15
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 681 843 2.0E-15
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 236 576 2.0E-15
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 681 843 2.0E-15
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 697 831 2.0E-15
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 302 567 2.0E-15
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 695 898 3.0E-15
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 300 567 3.0E-15
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 683 822 3.0E-15
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 683 813 4.0E-15
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 695 867 4.0E-15
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 624 813 4.0E-15
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 624 813 4.0E-15
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 695 867 4.0E-15
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 300 452 4.0E-15
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 624 848 5.0E-15
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 624 848 5.0E-15
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 695 867 5.0E-15
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 683 822 5.0E-15
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 327 606 7.0E-15
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 300 580 7.0E-15
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 302 567 8.0E-15
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 302 567 8.0E-15
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 672 822 8.0E-15
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 683 822 8.0E-15
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 302 567 9.0E-15
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 676 813 1.0E-14
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 300 452 1.0E-14
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 302 567 1.0E-14
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 302 567 1.0E-14
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 681 839 1.0E-14
sp|Q9LK10|CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana GN=CLSY4 PE=1 SV=1 574 853 1.0E-14
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 683 813 2.0E-14
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 327 606 2.0E-14
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 672 930 2.0E-14
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 647 813 3.0E-14
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 262 567 4.0E-14
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 299 567 4.0E-14
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 677 822 4.0E-14
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 683 813 5.0E-14
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 683 810 5.0E-14
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 661 822 5.0E-14
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 672 869 7.0E-14
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 672 869 7.0E-14
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 281 512 8.0E-14
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 300 565 1.0E-13
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 697 812 1.0E-13
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 301 452 1.0E-13
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 676 822 2.0E-13
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 624 824 2.0E-13
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 676 825 2.0E-13
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 300 597 2.0E-13
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 675 854 2.0E-13
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 585 824 4.0E-13
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 299 600 4.0E-13
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 232 567 6.0E-13
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 677 822 8.0E-13
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 683 838 9.0E-13
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 677 822 1.0E-12
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 299 453 2.0E-12
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 299 484 2.0E-12
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 299 484 2.0E-12
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 299 484 2.0E-12
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 299 484 2.0E-12
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 561 827 2.0E-12
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 684 850 2.0E-12
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 677 822 2.0E-12
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 677 822 2.0E-12
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 684 850 2.0E-12
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 302 567 3.0E-12
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 671 826 3.0E-12
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 677 822 4.0E-12
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 299 567 5.0E-12
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 677 822 5.0E-12
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 675 833 5.0E-12
sp|O55764|172L_IIV6 Putative helicase 172L OS=Invertebrate iridescent virus 6 GN=IIV6-172L PE=3 SV=1 696 822 5.0E-12
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 670 846 5.0E-12
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 677 834 5.0E-12
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 671 826 6.0E-12
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 671 864 6.0E-12
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 223 529 6.0E-12
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 677 822 7.0E-12
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 654 833 7.0E-12
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 695 822 7.0E-12
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 695 822 7.0E-12
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 695 822 7.0E-12
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 299 575 9.0E-12
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 51 322 1.0E-11
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 300 565 1.0E-11
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 299 591 1.0E-11
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 299 591 1.0E-11
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 675 833 1.0E-11
sp|Q9M1I1|FB304_ARATH F-box protein At3g54460 OS=Arabidopsis thaliana GN=At3g54460 PE=2 SV=1 697 813 2.0E-11
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 300 445 2.0E-11
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 671 838 2.0E-11
sp|Q06554|IRC20_YEAST Uncharacterized ATP-dependent helicase IRC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC20 PE=1 SV=1 297 567 2.0E-11
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 677 813 2.0E-11
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 677 822 3.0E-11
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 300 529 4.0E-11
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 671 826 4.0E-11
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 677 819 4.0E-11
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 300 575 6.0E-11
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 675 833 7.0E-11
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 300 574 8.0E-11
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 671 864 1.0E-10
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 257 451 1.0E-10
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 299 453 2.0E-10
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 299 453 2.0E-10
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 299 575 2.0E-10
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 677 813 2.0E-10
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 669 825 2.0E-10
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 51 322 3.0E-10
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 695 846 3.0E-10
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 677 848 3.0E-10
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 51 322 4.0E-10
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 671 826 4.0E-10
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 299 453 5.0E-10
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 161 451 7.0E-10
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 300 583 8.0E-10
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 299 593 1.0E-09
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 299 451 1.0E-09
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 300 445 2.0E-09
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 299 453 2.0E-09
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 300 589 2.0E-09
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 302 561 2.0E-09
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 677 822 2.0E-09
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 694 826 5.0E-09
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 281 476 6.0E-09
sp|Q9M297|CLSY1_ARATH SNF2 domain-containing protein CLASSY 1 OS=Arabidopsis thaliana GN=CLSY1 PE=1 SV=1 676 873 9.0E-09
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 296 528 1.0E-08
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 281 476 3.0E-08
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 281 476 3.0E-08
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 281 476 3.0E-08
sp|Q5UP58|YR592_MIMIV Putative helicase R592 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R592 PE=3 SV=1 600 811 3.0E-08
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 300 533 5.0E-08
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 297 449 5.0E-08
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 302 561 6.0E-08
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 684 822 7.0E-08
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 669 829 2.0E-07
sp|Q9SIW2|CHR35_ARATH Protein CHROMATIN REMODELING 35 OS=Arabidopsis thaliana GN=DRD1 PE=1 SV=1 695 829 2.0E-07
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 302 561 3.0E-07
sp|F4K493|CLSY2_ARATH SNF2 domain-containing protein CLASSY 2 OS=Arabidopsis thaliana GN=CLSY2 PE=1 SV=1 676 810 3.0E-07
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 302 449 4.0E-07
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 299 534 4.0E-07
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 302 449 5.0E-07
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 302 449 5.0E-07
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 302 450 7.0E-07
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 302 449 8.0E-07
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 302 449 1.0E-06
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 302 452 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003824 catalytic activity Yes
GO:0051536 iron-sulfur cluster binding Yes
GO:0046872 metal ion binding Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:1901363 heterocyclic compound binding No
GO:0051540 metal cluster binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0097367 carbohydrate derivative binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0140657 ATP-dependent activity No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0005488 binding No
GO:0043169 cation binding No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4420
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5422
Ophiocordyceps australis map64 (Brazil) OphauB2|3883
Ophiocordyceps camponoti-floridani Ophcf2|04125
Ophiocordyceps camponoti-rufipedis Ophun1|4034 (this protein)
Ophiocordyceps kimflemingae Ophio5|7035
Ophiocordyceps subramaniannii Hirsu2|9150

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4034
MPPSRTRKRPAPLAVDPAQDETARTKRPALAAVSDDPTVLAGSGTQEPDPIDLTQEPDEPATELYGHLGAYDRNA
IRVDNVLHQQIGHLPRTVVEKIAPFMVRAIHEFDSGDIKLEAELTGEKGMFDCPVRLSFFGPSDPAERARIEQGL
KASRLLKATQLKQTKQQAQALRAASGLKSGSTSYGIGSDVGGITQAELSLEELIKKSDATEFRRGGDAIKTLAID
EAYLAAMPMAEQPPQLASTLLPYQLQARSHIYIILRTFADHTAGPVQLWVKSSKGMFWNLASGFVSPNAPKLCSG
GILADDMGLGKTLQVISLILTGGSGPTLIVAPVSVMSNWKQQIARHVKPEQAPSVLVYHGNKKMTAQELTKYDVV
ITSYGRLAKERDQTQRTLLDKSVQWRRVVLDEGHTIRNARTKAALAACELQAESRWVLTGTPIVNSVKDLHSLVQ
FLHLTGGIEQVEIFNNSITRKLTAGERGGEAILQALVQDICLRRKKDMEFVDLKLPEKKEFLHRIPFQPAEKVKY
NALLSEARGALEEYQARSASGQKGRFQNVLERLLRLRQTCNHWTLCRERIDDLMKLLEEENVVVLNDKNRALLQE
ALRLYVESQDDCAICYEAPSPPVITNCKHVFCRPCITKAIQIQHKCPMCRNALTEECLLEPAPEGTFDDNFDTDT
QSSKTDALLQIVQATVQKPGSKVIVFSQWTSFLNIVQNQLVKAGLKFSRIDGSMNAEKRDRAIEALDHDADTRVM
LASLAVCSVGLNLVAADTVILSDSWWAPAIEDQAIDRVHRLGQTRETTIWRLVMENSVEERVLTIQAEKRELVGK
AFCEKSKKENGSSFLHIVGREDIFSSMIEDVNTLRAAEAVLKSRAAATLVEDGTRDGNATATPAISLRTAATRFG
VSKSAVARAIEQIEGRRPRVKAGKPTLLTEKEDETLVGFIHWLETTGSPATRPQIMGACHALMKRRNAEAKSPSD
SWYGRWMATHGDLRLRIVKVYDKARRREGSGGKEVESDILSFLDECERSGRGPGEFAAGEVAGEHSSESSAADTP
EEMELGVEPGSSCRPAVMEVPVWLPLSGTIDGARLALADVIDLWHAYRTSLILCAVAILFALRLFLRSHQEETLV
ALPSIYRDRQDAPIEKTNSGPRRIKGGAVKKVKRPVDDAASTMPPVKLVVFYSSVTDTTAKLAGIYHESLVSAVE
RLARETGRPFLKPELHHLAEMDLDDFFVAPPTAPTEAGLFYLFLFPSYNIDSINDTVLQHLRETHHDFRIDTAPL
ASLLGYSVFGYGDREGWPDEERGFCFQAIELDKCMSKLTGRKRAYPVGMGDVKGDHRERFSEWAAGVEDVVASVA
RTGHLGLGVRGSGDAVESDDEEVDGGGEEAAGQQGERPLDDVEDLGKMLRTSGSKSGANSGAKPPLAVDFTTYSQ
QQTPAVVKEMVPRDSPTYAALTKQGYTIVGSHSGVKICRWTKSALRGRGSCYKYSLYGINSHQCMETTPSLSCSN
KCVFCWRHGTNPVGTTWRWVVDAPDVIFRGVKEGHYSKIRMMRGVPGVRAERYAEALRIRHCALSLVGEPIFYPY
INEFLALLHAEGISSFLVCNAQHPDQLAALKAVTQLYVSIDASNRESLRKIDRPLHRDFWERFLRCLDILREKRF
RHRTVFRLTLVKGFNVADEVEGYARLVERGLPCFIEVKGVTYCGTSTSANAGISMSNVPFYWEVCDFVRALDARL
ADMGLAYGIAAEHAHSCCVLLASERFRVDGLWRTHIDYRQFFQLLQERGADGDWSPEDYMGDPTPEWALWGNGGF
DPRDTRVDRKGRSMDVTVVRHRPPELEHVS*
Coding >Ophun1|4034
ATGCCTCCGTCTCGGACCAGGAAGCGCCCCGCTCCCCTCGCCGTCGACCCTGCGCAGGATGAGACGGCCCGAACA
AAGCGGCCCGCCCTTGCTGCTGTCTCGGACGATCCAACGGTCTTGGCTGGCAGCGGCACGCAAGAGCCGGACCCT
ATCGATCTGACTCAGGAACCGGATGAGCCGGCGACGGAGCTCTATGGTCATTTGGGTGCGTATGATCGCAATGCT
ATTCGCGTCGACAATGTGTTGCATCAGCAGATCGGACACTTGCCTCGTACCGTAGTCGAGAAGATTGCCCCATTC
ATGGTACGAGCTATTCACGAGTTTGATTCTGGCGATATCAAGTTGGAAGCCGAGTTGACGGGCGAAAAAGGCATG
TTTGACTGCCCCGTCCGACTGTCCTTTTTCGGGCCCAGCGACCCGGCCGAGCGTGCGCGTATCGAACAGGGTCTC
AAAGCCAGCAGGCTCCTCAAGGCAACTCAGCTGAAGCAGACCAAGCAACAGGCCCAGGCTCTGAGGGCGGCCTCG
GGGCTCAAGTCTGGTTCTACCTCGTACGGTATCGGCTCTGATGTTGGCGGCATTACTCAGGCGGAGCTCTCGCTT
GAGGAACTCATCAAGAAGAGCGATGCGACTGAGTTTCGCAGGGGCGGCGATGCCATCAAGACGTTGGCCATCGAC
GAGGCGTACTTGGCCGCCATGCCCATGGCCGAGCAGCCTCCGCAGCTGGCGTCGACTCTTTTGCCATATCAGCTT
CAGGCGAGATCCCACATCTACATAATCTTGAGGACTTTCGCTGACCATACTGCAGGGCCTGTGCAGCTGTGGGTG
AAGAGCAGCAAAGGCATGTTCTGGAACCTCGCCTCAGGCTTCGTCAGCCCGAACGCACCGAAGCTGTGTTCTGGG
GGGATCCTCGCCGACGACATGGGTCTGGGCAAGACGCTCCAGGTCATCAGCCTAATCCTGACTGGCGGTTCTGGA
CCGACCCTGATCGTCGCGCCTGTCAGCGTCATGAGCAACTGGAAGCAGCAAATCGCCCGGCACGTCAAGCCGGAG
CAGGCCCCCAGCGTCTTGGTCTATCATGGGAACAAGAAGATGACGGCCCAAGAGCTCACAAAGTACGATGTCGTC
ATCACGAGCTACGGACGGCTGGCCAAGGAAAGGGACCAGACCCAGCGAACACTGCTGGACAAGTCGGTTCAGTGG
CGACGCGTGGTTCTGGACGAAGGGCATACCATTCGAAATGCCCGAACCAAGGCGGCCTTGGCTGCCTGCGAGCTT
CAGGCAGAGTCTCGCTGGGTTCTCACGGGAACGCCCATAGTCAACTCGGTCAAGGATCTGCATTCGCTGGTCCAG
TTCCTCCATCTGACGGGGGGCATCGAGCAAGTGGAAATCTTCAACAACAGCATCACCCGCAAGCTCACGGCTGGA
GAACGCGGTGGCGAGGCGATTCTTCAGGCCCTTGTTCAAGACATCTGTCTCCGACGCAAAAAGGACATGGAGTTT
GTCGATCTCAAGCTGCCGGAGAAGAAGGAGTTTCTGCACCGCATCCCATTCCAACCCGCGGAGAAAGTGAAATAC
AACGCTCTTCTCTCCGAAGCTCGTGGCGCGTTGGAAGAGTATCAGGCGCGGTCTGCTTCCGGGCAAAAGGGTCGG
TTCCAGAACGTCCTCGAGCGTCTACTCCGGCTTCGACAGACATGTAATCACTGGACGCTCTGCCGGGAGCGAATT
GACGATCTCATGAAGCTGCTTGAAGAGGAAAACGTGGTCGTCCTAAACGACAAGAACCGGGCCTTGCTGCAGGAA
GCCCTCCGCCTGTACGTCGAGAGCCAAGACGACTGCGCCATCTGCTACGAGGCCCCGTCGCCGCCCGTCATCACC
AACTGCAAGCACGTCTTCTGCCGGCCATGCATCACAAAGGCCATCCAGATCCAGCACAAGTGCCCCATGTGCCGC
AACGCTCTGACCGAAGAGTGTCTGCTGGAGCCGGCTCCCGAGGGCACCTTCGACGACAACTTTGATACGGACACG
CAGAGCTCCAAGACAGACGCCCTGCTCCAGATTGTGCAGGCGACGGTGCAGAAGCCGGGTTCCAAGGTCATCGTT
TTCTCGCAATGGACGTCTTTCCTCAACATTGTTCAGAATCAGCTGGTCAAGGCGGGACTCAAGTTCAGCCGGATC
GACGGAAGCATGAACGCAGAGAAGCGGGACAGGGCCATTGAGGCGCTGGATCATGACGCAGACACGAGGGTGATG
CTCGCCAGCCTGGCCGTGTGCAGCGTCGGCCTCAACCTGGTGGCAGCTGACACGGTGATACTCTCTGACAGCTGG
TGGGCGCCAGCCATTGAGGACCAGGCCATCGACCGGGTGCACCGGCTGGGCCAGACGCGCGAGACAACTATCTGG
CGGCTGGTGATGGAGAACAGCGTGGAGGAGCGGGTGCTGACGATACAGGCGGAGAAGCGCGAGCTGGTGGGCAAA
GCTTTCTGCGAGAAGTCCAAGAAGGAGAACGGATCCTCGTTCCTACACATCGTGGGACGAGAAGACATCTTTTCG
AGTATGATTGAAGACGTCAACACGCTTCGAGCGGCTGAAGCCGTCCTCAAGTCCCGAGCAGCAGCAACTCTCGTT
GAAGACGGCACGCGAGACGGCAACGCAACTGCAACACCAGCAATCTCCCTCCGCACAGCGGCAACACGCTTCGGC
GTAAGCAAATCAGCCGTCGCCCGGGCCATCGAGCAGATCGAAGGACGACGCCCCCGCGTCAAAGCAGGCAAACCG
ACGCTCCTAACCGAAAAAGAAGACGAGACTCTGGTCGGCTTCATCCACTGGCTGGAAACAACGGGGAGTCCAGCG
ACGAGGCCGCAGATCATGGGCGCGTGCCACGCTCTGATGAAGCGACGCAACGCTGAGGCAAAGTCGCCGTCGGAT
TCGTGGTATGGCCGGTGGATGGCTACGCATGGGGACCTTCGACTTCGCATCGTCAAGGTCTATGACAAGGCGCGG
AGGAGGGAGGGTTCGGGGGGGAAGGAGGTTGAGAGTGACATCTTGTCGTTTTTGGACGAGTGTGAGCGTTCAGGG
AGGGGACCTGGTGAATTTGCTGCTGGTGAGGTTGCGGGTGAGCACTCTTCGGAGTCTTCAGCTGCGGACACGCCT
GAGGAGATGGAGCTGGGGGTTGAGCCGGGTTCGAGTTGCAGACCGGCCGTTATGGAGGTGCCCGTCTGGCTTCCA
CTATCTGGAACGATCGACGGAGCTCGTCTGGCGCTGGCAGACGTCATTGATCTCTGGCACGCCTACCGAACGTCT
CTTATTCTCTGCGCCGTCGCCATCCTCTTTGCTCTCCGGCTATTTCTCCGCAGCCATCAAGAGGAGACGCTCGTT
GCGCTTCCCAGCATCTATCGTGATCGCCAGGATGCGCCAATCGAGAAGACGAACAGTGGTCCGCGTCGGATCAAG
GGCGGCGCCGTCAAGAAAGTGAAGCGACCAGTCGATGACGCTGCGTCTACGATGCCGCCTGTCAAGCTCGTCGTC
TTCTACTCGTCCGTGACGGATACTACGGCCAAGCTGGCGGGTATCTATCACGAAAGCCTGGTCTCGGCTGTGGAG
AGGCTGGCGCGAGAGACGGGACGTCCCTTTCTGAAGCCTGAGCTGCATCATCTGGCGGAGATGGATCTCGACGAC
TTCTTCGTTGCGCCGCCGACGGCTCCAACTGAGGCGGGCCTTTTCTATCTCTTTCTTTTCCCGAGCTATAACATC
GACAGCATCAACGATACGGTTCTGCAGCATCTGCGCGAGACGCACCACGACTTTCGCATCGATACCGCGCCTCTC
GCCTCGTTGCTCGGGTACTCGGTCTTTGGCTACGGGGATAGAGAGGGCTGGCCGGATGAGGAGAGGGGGTTCTGC
TTCCAGGCTATCGAGCTGGATAAGTGCATGTCCAAGCTTACGGGTCGGAAGCGCGCGTATCCTGTTGGCATGGGC
GACGTCAAGGGGGATCATCGAGAGAGATTTTCTGAGTGGGCTGCTGGTGTTGAGGATGTGGTTGCGAGTGTCGCT
CGGACGGGACACCTTGGTTTGGGCGTGCGTGGGAGTGGCGATGCTGTGGAGAGTGATGACGAGGAGGTTGATGGT
GGTGGTGAAGAAGCGGCTGGCCAACAAGGGGAGAGGCCGCTGGACGATGTTGAGGATCTGGGCAAGATGCTGCGC
ACGTCGGGGTCCAAATCAGGGGCCAACTCAGGGGCCAAGCCACCCCTGGCCGTCGACTTCACCACATACAGCCAA
CAGCAGACTCCAGCCGTCGTCAAGGAAATGGTCCCTCGCGACTCGCCCACATACGCGGCCCTCACCAAGCAGGGC
TACACCATCGTCGGCTCTCACTCAGGCGTCAAGATCTGCCGCTGGACAAAGTCAGCCCTCCGAGGCCGCGGCAGC
TGCTACAAGTACTCCCTCTACGGCATCAACTCGCACCAATGCATGGAGACGACTCCCTCGCTATCATGCTCCAAC
AAGTGCGTCTTCTGCTGGCGCCACGGAACCAACCCCGTCGGCACCACCTGGCGCTGGGTCGTCGACGCGCCCGAC
GTCATCTTCCGCGGCGTCAAGGAGGGCCACTACAGCAAGATCCGCATGATGCGCGGCGTTCCGGGCGTCAGGGCG
GAGAGATACGCTGAAGCGCTACGGATTCGCCATTGCGCGCTTTCGCTCGTCGGAGAGCCCATCTTTTACCCTTAC
ATCAATGAGTTTCTGGCCTTGCTTCACGCAGAGGGCATCTCGTCCTTTCTTGTCTGCAACGCTCAGCATCCGGAT
CAGCTGGCGGCGTTAAAGGCAGTGACGCAGCTGTACGTCTCCATCGACGCCTCTAACCGCGAGTCACTGCGCAAG
ATTGACCGTCCGCTTCACCGCGACTTCTGGGAACGCTTCCTACGCTGTCTCGACATCCTCCGCGAGAAACGCTTC
CGCCACCGAACCGTCTTCCGCCTCACCCTCGTCAAGGGCTTCAACGTCGCCGACGAAGTCGAAGGATACGCCCGT
CTCGTGGAGCGCGGCCTCCCCTGCTTCATAGAGGTCAAGGGCGTCACCTACTGCGGCACCTCTACATCCGCCAAC
GCCGGAATCTCAATGTCCAACGTCCCCTTTTACTGGGAGGTTTGCGACTTTGTCCGCGCGCTTGACGCCCGGCTC
GCCGACATGGGCTTGGCGTACGGGATTGCGGCCGAGCATGCGCACAGCTGCTGCGTTCTGCTGGCTAGCGAGCGG
TTTCGCGTCGATGGTCTTTGGCGTACTCATATTGACTATCGGCAGTTCTTTCAGCTCCTCCAAGAGAGGGGCGCT
GATGGTGACTGGTCGCCGGAGGATTACATGGGGGATCCGACGCCGGAGTGGGCGCTCTGGGGGAATGGCGGCTTT
GATCCCCGTGATACTCGGGTTGATCGGAAGGGGAGGAGTATGGATGTGACGGTCGTTCGGCATCGGCCGCCGGAG
TTGGAGCACGTGTCGTGA
Transcript >Ophun1|4034
ATGCCTCCGTCTCGGACCAGGAAGCGCCCCGCTCCCCTCGCCGTCGACCCTGCGCAGGATGAGACGGCCCGAACA
AAGCGGCCCGCCCTTGCTGCTGTCTCGGACGATCCAACGGTCTTGGCTGGCAGCGGCACGCAAGAGCCGGACCCT
ATCGATCTGACTCAGGAACCGGATGAGCCGGCGACGGAGCTCTATGGTCATTTGGGTGCGTATGATCGCAATGCT
ATTCGCGTCGACAATGTGTTGCATCAGCAGATCGGACACTTGCCTCGTACCGTAGTCGAGAAGATTGCCCCATTC
ATGGTACGAGCTATTCACGAGTTTGATTCTGGCGATATCAAGTTGGAAGCCGAGTTGACGGGCGAAAAAGGCATG
TTTGACTGCCCCGTCCGACTGTCCTTTTTCGGGCCCAGCGACCCGGCCGAGCGTGCGCGTATCGAACAGGGTCTC
AAAGCCAGCAGGCTCCTCAAGGCAACTCAGCTGAAGCAGACCAAGCAACAGGCCCAGGCTCTGAGGGCGGCCTCG
GGGCTCAAGTCTGGTTCTACCTCGTACGGTATCGGCTCTGATGTTGGCGGCATTACTCAGGCGGAGCTCTCGCTT
GAGGAACTCATCAAGAAGAGCGATGCGACTGAGTTTCGCAGGGGCGGCGATGCCATCAAGACGTTGGCCATCGAC
GAGGCGTACTTGGCCGCCATGCCCATGGCCGAGCAGCCTCCGCAGCTGGCGTCGACTCTTTTGCCATATCAGCTT
CAGGCGAGATCCCACATCTACATAATCTTGAGGACTTTCGCTGACCATACTGCAGGGCCTGTGCAGCTGTGGGTG
AAGAGCAGCAAAGGCATGTTCTGGAACCTCGCCTCAGGCTTCGTCAGCCCGAACGCACCGAAGCTGTGTTCTGGG
GGGATCCTCGCCGACGACATGGGTCTGGGCAAGACGCTCCAGGTCATCAGCCTAATCCTGACTGGCGGTTCTGGA
CCGACCCTGATCGTCGCGCCTGTCAGCGTCATGAGCAACTGGAAGCAGCAAATCGCCCGGCACGTCAAGCCGGAG
CAGGCCCCCAGCGTCTTGGTCTATCATGGGAACAAGAAGATGACGGCCCAAGAGCTCACAAAGTACGATGTCGTC
ATCACGAGCTACGGACGGCTGGCCAAGGAAAGGGACCAGACCCAGCGAACACTGCTGGACAAGTCGGTTCAGTGG
CGACGCGTGGTTCTGGACGAAGGGCATACCATTCGAAATGCCCGAACCAAGGCGGCCTTGGCTGCCTGCGAGCTT
CAGGCAGAGTCTCGCTGGGTTCTCACGGGAACGCCCATAGTCAACTCGGTCAAGGATCTGCATTCGCTGGTCCAG
TTCCTCCATCTGACGGGGGGCATCGAGCAAGTGGAAATCTTCAACAACAGCATCACCCGCAAGCTCACGGCTGGA
GAACGCGGTGGCGAGGCGATTCTTCAGGCCCTTGTTCAAGACATCTGTCTCCGACGCAAAAAGGACATGGAGTTT
GTCGATCTCAAGCTGCCGGAGAAGAAGGAGTTTCTGCACCGCATCCCATTCCAACCCGCGGAGAAAGTGAAATAC
AACGCTCTTCTCTCCGAAGCTCGTGGCGCGTTGGAAGAGTATCAGGCGCGGTCTGCTTCCGGGCAAAAGGGTCGG
TTCCAGAACGTCCTCGAGCGTCTACTCCGGCTTCGACAGACATGTAATCACTGGACGCTCTGCCGGGAGCGAATT
GACGATCTCATGAAGCTGCTTGAAGAGGAAAACGTGGTCGTCCTAAACGACAAGAACCGGGCCTTGCTGCAGGAA
GCCCTCCGCCTGTACGTCGAGAGCCAAGACGACTGCGCCATCTGCTACGAGGCCCCGTCGCCGCCCGTCATCACC
AACTGCAAGCACGTCTTCTGCCGGCCATGCATCACAAAGGCCATCCAGATCCAGCACAAGTGCCCCATGTGCCGC
AACGCTCTGACCGAAGAGTGTCTGCTGGAGCCGGCTCCCGAGGGCACCTTCGACGACAACTTTGATACGGACACG
CAGAGCTCCAAGACAGACGCCCTGCTCCAGATTGTGCAGGCGACGGTGCAGAAGCCGGGTTCCAAGGTCATCGTT
TTCTCGCAATGGACGTCTTTCCTCAACATTGTTCAGAATCAGCTGGTCAAGGCGGGACTCAAGTTCAGCCGGATC
GACGGAAGCATGAACGCAGAGAAGCGGGACAGGGCCATTGAGGCGCTGGATCATGACGCAGACACGAGGGTGATG
CTCGCCAGCCTGGCCGTGTGCAGCGTCGGCCTCAACCTGGTGGCAGCTGACACGGTGATACTCTCTGACAGCTGG
TGGGCGCCAGCCATTGAGGACCAGGCCATCGACCGGGTGCACCGGCTGGGCCAGACGCGCGAGACAACTATCTGG
CGGCTGGTGATGGAGAACAGCGTGGAGGAGCGGGTGCTGACGATACAGGCGGAGAAGCGCGAGCTGGTGGGCAAA
GCTTTCTGCGAGAAGTCCAAGAAGGAGAACGGATCCTCGTTCCTACACATCGTGGGACGAGAAGACATCTTTTCG
AGTATGATTGAAGACGTCAACACGCTTCGAGCGGCTGAAGCCGTCCTCAAGTCCCGAGCAGCAGCAACTCTCGTT
GAAGACGGCACGCGAGACGGCAACGCAACTGCAACACCAGCAATCTCCCTCCGCACAGCGGCAACACGCTTCGGC
GTAAGCAAATCAGCCGTCGCCCGGGCCATCGAGCAGATCGAAGGACGACGCCCCCGCGTCAAAGCAGGCAAACCG
ACGCTCCTAACCGAAAAAGAAGACGAGACTCTGGTCGGCTTCATCCACTGGCTGGAAACAACGGGGAGTCCAGCG
ACGAGGCCGCAGATCATGGGCGCGTGCCACGCTCTGATGAAGCGACGCAACGCTGAGGCAAAGTCGCCGTCGGAT
TCGTGGTATGGCCGGTGGATGGCTACGCATGGGGACCTTCGACTTCGCATCGTCAAGGTCTATGACAAGGCGCGG
AGGAGGGAGGGTTCGGGGGGGAAGGAGGTTGAGAGTGACATCTTGTCGTTTTTGGACGAGTGTGAGCGTTCAGGG
AGGGGACCTGGTGAATTTGCTGCTGGTGAGGTTGCGGGTGAGCACTCTTCGGAGTCTTCAGCTGCGGACACGCCT
GAGGAGATGGAGCTGGGGGTTGAGCCGGGTTCGAGTTGCAGACCGGCCGTTATGGAGGTGCCCGTCTGGCTTCCA
CTATCTGGAACGATCGACGGAGCTCGTCTGGCGCTGGCAGACGTCATTGATCTCTGGCACGCCTACCGAACGTCT
CTTATTCTCTGCGCCGTCGCCATCCTCTTTGCTCTCCGGCTATTTCTCCGCAGCCATCAAGAGGAGACGCTCGTT
GCGCTTCCCAGCATCTATCGTGATCGCCAGGATGCGCCAATCGAGAAGACGAACAGTGGTCCGCGTCGGATCAAG
GGCGGCGCCGTCAAGAAAGTGAAGCGACCAGTCGATGACGCTGCGTCTACGATGCCGCCTGTCAAGCTCGTCGTC
TTCTACTCGTCCGTGACGGATACTACGGCCAAGCTGGCGGGTATCTATCACGAAAGCCTGGTCTCGGCTGTGGAG
AGGCTGGCGCGAGAGACGGGACGTCCCTTTCTGAAGCCTGAGCTGCATCATCTGGCGGAGATGGATCTCGACGAC
TTCTTCGTTGCGCCGCCGACGGCTCCAACTGAGGCGGGCCTTTTCTATCTCTTTCTTTTCCCGAGCTATAACATC
GACAGCATCAACGATACGGTTCTGCAGCATCTGCGCGAGACGCACCACGACTTTCGCATCGATACCGCGCCTCTC
GCCTCGTTGCTCGGGTACTCGGTCTTTGGCTACGGGGATAGAGAGGGCTGGCCGGATGAGGAGAGGGGGTTCTGC
TTCCAGGCTATCGAGCTGGATAAGTGCATGTCCAAGCTTACGGGTCGGAAGCGCGCGTATCCTGTTGGCATGGGC
GACGTCAAGGGGGATCATCGAGAGAGATTTTCTGAGTGGGCTGCTGGTGTTGAGGATGTGGTTGCGAGTGTCGCT
CGGACGGGACACCTTGGTTTGGGCGTGCGTGGGAGTGGCGATGCTGTGGAGAGTGATGACGAGGAGGTTGATGGT
GGTGGTGAAGAAGCGGCTGGCCAACAAGGGGAGAGGCCGCTGGACGATGTTGAGGATCTGGGCAAGATGCTGCGC
ACGTCGGGGTCCAAATCAGGGGCCAACTCAGGGGCCAAGCCACCCCTGGCCGTCGACTTCACCACATACAGCCAA
CAGCAGACTCCAGCCGTCGTCAAGGAAATGGTCCCTCGCGACTCGCCCACATACGCGGCCCTCACCAAGCAGGGC
TACACCATCGTCGGCTCTCACTCAGGCGTCAAGATCTGCCGCTGGACAAAGTCAGCCCTCCGAGGCCGCGGCAGC
TGCTACAAGTACTCCCTCTACGGCATCAACTCGCACCAATGCATGGAGACGACTCCCTCGCTATCATGCTCCAAC
AAGTGCGTCTTCTGCTGGCGCCACGGAACCAACCCCGTCGGCACCACCTGGCGCTGGGTCGTCGACGCGCCCGAC
GTCATCTTCCGCGGCGTCAAGGAGGGCCACTACAGCAAGATCCGCATGATGCGCGGCGTTCCGGGCGTCAGGGCG
GAGAGATACGCTGAAGCGCTACGGATTCGCCATTGCGCGCTTTCGCTCGTCGGAGAGCCCATCTTTTACCCTTAC
ATCAATGAGTTTCTGGCCTTGCTTCACGCAGAGGGCATCTCGTCCTTTCTTGTCTGCAACGCTCAGCATCCGGAT
CAGCTGGCGGCGTTAAAGGCAGTGACGCAGCTGTACGTCTCCATCGACGCCTCTAACCGCGAGTCACTGCGCAAG
ATTGACCGTCCGCTTCACCGCGACTTCTGGGAACGCTTCCTACGCTGTCTCGACATCCTCCGCGAGAAACGCTTC
CGCCACCGAACCGTCTTCCGCCTCACCCTCGTCAAGGGCTTCAACGTCGCCGACGAAGTCGAAGGATACGCCCGT
CTCGTGGAGCGCGGCCTCCCCTGCTTCATAGAGGTCAAGGGCGTCACCTACTGCGGCACCTCTACATCCGCCAAC
GCCGGAATCTCAATGTCCAACGTCCCCTTTTACTGGGAGGTTTGCGACTTTGTCCGCGCGCTTGACGCCCGGCTC
GCCGACATGGGCTTGGCGTACGGGATTGCGGCCGAGCATGCGCACAGCTGCTGCGTTCTGCTGGCTAGCGAGCGG
TTTCGCGTCGATGGTCTTTGGCGTACTCATATTGACTATCGGCAGTTCTTTCAGCTCCTCCAAGAGAGGGGCGCT
GATGGTGACTGGTCGCCGGAGGATTACATGGGGGATCCGACGCCGGAGTGGGCGCTCTGGGGGAATGGCGGCTTT
GATCCCCGTGATACTCGGGTTGATCGGAAGGGGAGGAGTATGGATGTGACGGTCGTTCGGCATCGGCCGCCGGAG
TTGGAGCACGTGTCGTGA
Gene >Ophun1|4034
ATGCCTCCGTCTCGGACCAGGAAGCGCCCCGCTCCCCTCGCCGTCGACCCTGCGCAGGATGAGACGGCCCGAACA
AAGCGGCCCGCCCTTGCTGCTGTCTCGGACGATCCAACGGTCTTGGCTGGCAGCGGCACGCAAGAGCCGGACCCT
ATCGATCTGACTCAGGAACCGGATGAGCCGGCGACGGAGCTCTATGGTCATTTGGGTGCGGTTTGCTGAATGGTT
CTGTTTGATACGTGGTGAGCTGACGGCGGTGTAGATAACAAGATTGTTGGCGTTCGGTTTTACAAAGGGTTTGCG
TCTGCTGGAGAGGCGGTTCTCTGCAGTAGAGAGCCTCAGAACCAGGCACGTTGAGCCGGAGAGTTTCATTGATGC
TCACGCAGCTGACTGCTATCAGTATGATCGCAATGCTATTCGCGTCGACAATGTGTTGCATCAGCAGATCGGACA
CTTGCCTCGTACCGTAGTCGAGAAGATTGCCCCATTCATGGTACGAGCTATTCACGAGTTTGTGAGTCTGTCTGG
CAGTGTCACCGACTTAGACCCCGTTGCAGGATTCTGGCGATATCAAGTTGGAAGCCGAGTTGACGGGCGAAAAAG
GCATGTTTGACTGCCCCGTCCGACTGTCCTTTTTCGGGCCCAGCGACCCGGCCGAGCGTGCGCGTATCGAACAGG
GTCTCAAAGCCAGCAGGCTCCTCAAGGCAACTCAGCTGAAGCAGACCAAGCAACAGGCCCAGGCTCTGAGGGCGG
CCTCGGGGCTCAAGTCTGGTTCTACCTCGTACGGTATCGGCTCTGATGTTGGCGGCATTACTCAGGCGGAGCTCT
CGCTTGAGGAACTCATCAAGAAGAGCGATGCGACTGAGTTTCGCAGGGGCGGCGATGCCATCAAGACGTTGGCCA
TCGACGAGGCGTACTTGGCCGCCATGCCCATGGCCGAGCAGCCTCCGCAGCTGGCGTCGACTCTTTTGCCATATC
AGCTTCAGGCGAGATCCCACATCTACATAATCTTGAGGACTTTCGCTGACCATACTGCAGGGTCTGGCATGGATG
ACCGCCAAGGAACACCCTCAGGTCCCGGAAATGGGCGCCGAAAGGCCTGTGCAGCTGTGGGTGAAGAGCAGCAAA
GGCATGTTCTGGAACCTCGCCTCAGGCTTCGTCAGCCCGAACGCACCGAAGCTGTGTTCTGGGGGGATCCTCGCC
GACGACATGGGTCTGGGCAAGACGCTCCAGGTCATCAGCCTAATCCTGACTGGCGGTTCTGGACCGACCCTGATC
GTCGCGCCTGTCAGCGTCATGAGCAACTGGAAGCAGCAAATCGCCCGGCACGTCAAGCCGGAGCAGGCCCCCAGC
GTCTTGGTCTATCATGGGAACAAGAAGATGACGGCCCAAGAGCTCACAAAGTACGATGTCGTCATCACGAGCTAC
GGACGGCTGGCCAAGGAAAGGGACCAGACCCAGCGAACACTGCTGGACAAGTCGGTTCAGTGGCGACGCGTGGTT
CTGGACGAAGGGCATACCATTCGAAATGCCCGAACCAAGGCGGCCTTGGCTGCCTGCGAGCTTCAGGCAGAGTCT
CGCTGGGTTCTCACGGGAACGCCCATGTCAGTTCTAAGCTTCTTGCAGCCCTGATGCGGCCAACGGCTGACGAGA
TCTACAGAGTCAACTCGGTCAAGGATCTGCATTCGCTGGTCCAGTTCCTCCATCTGACGGGGGGCATCGAGCAAG
TGGAAATCTTCAACAACAGCATCACCCGCAAGCTCACGGCTGGAGAACGCGGTGGCGAGGCGATTCTTCAGGCCC
TTGTTCAAGACATCTGTCTCCGACGCAAAAAGGACATGGAGTTTGTCGATCTCAAGCTGCCGGAGAAGAAGGAGT
TTCTGCACCGCATCCCATTCCAACCCGCGGAGAAAGTGAAATACAACGCTCTTCTGTAAGGCCCTCGACTTGCTG
AGAAGCGTTGAACAGTACTGACAGTCGGATGTAGCTCCGAAGCTCGTGGCGCGTTGGAAGAGTATCAGGCGCGGT
CTGCTTCCGGGCAAAAGGGTCGGTTCCAGAACGTCCTCGAGCGTCTACTCCGGCTTCGACAGACGTACGTATTCC
AAGCTCAACTGTTGAGGATGGCGACTGACCTGGACAGATGTAATCACTGGACGCTCTGCCGGGAGCGAATTGACG
ATCTCATGAAGCTGCTTGAAGAGGAAAACGTGGTCGTCCTAAACGACAAGAACCGGGCCTTGCTGCAGGAAGCCC
TCCGCCTGTACGTCGAGAGCCAAGACGACTGCGCCATCTGCTACGAGGCCCCGTCGCCGCCCGTCATCACCAACT
GCAAGCACGTCTTCTGCCGGCCATGCATCACAAAGGCCATCCAGATCCAGCACAAGTGCCCCATGTGCCGCAACG
CTCTGACCGAAGAGTGTCTGCTGGAGCCGGCTCCCGAGGGCACCTTCGACGACAACTTTGATACGGACACGCAGA
GCTCCAAGACAGACGCCCTGCTCCAGATTGTGCAGGCGACGGTGCAGAAGCCGGGTTCCAAGGTCATCGTTTTCT
CGCAATGGACGTCTTTCCTCAACATTGTTCAGAATCAGCTGGTCAAGGCGGGACTCAAGTTCAGCCGGATCGACG
GAAGCATGAACGCAGAGAAGCGGGACAGGGCCATTGAGGCGCTGGATCATGACGCAGACACGAGGGTGATGCTCG
CCAGCCTGGCCGTGTGCAGCGTCGGCCTCAACCTGGTGGCAGCTGACACGGTGATACTCTCTGACAGCTGTAGGT
AGCGTCTTGAACCTGGATGGCCTCGTCCAGCTGCTAATGTCTCTGTTCAGGGTGGGCGCCAGCCATTGAGGACCA
GGCCATCGACCGGGTGCACCGGCTGGGCCAGACGCGCGAGACAACTATCTGGCGGCTGGTGATGGAGAACAGCGT
GGAGGAGCGGGTGCTGACGATACAGGCGGAGAAGCGCGAGCTGGTGGGCAAAGCTTTCTGCGAGAAGTCCAAGAA
GGAGAACGTACGGGCGACGGATGTGTCGAGGATGCTGGCTTAGACGGGAGTCATGGGCTGGGATGGCTTATACTG
AAGGGGGGACAGAGGGTGATCTAGAGATGCTCATGGCGATGGAGGGATTTGCTCGTGGTGATATTAGCTCGTAAT
AGACAGCAGTGGGCAGAATGAAGTTGCGGTTCGCATGATGTTAGGCACCTGGTGGGCCTTGTGAAGCAGGGGTGC
TCGTCCTGCTTGGTCCACAATGAGGTCAGATCTGATGTCCAGGCAGCTGTCAAGACGCTCTTGCTGTATAAATTT
TGCAGTTGGTGGAGAGAAGAGACTTCCACACGATCCCACACGAGGCAGGGATCCTCGTTCCTACACATCGTGGGA
CGAGAAGACATCTTTTCGAGTATGATTGAAGACGTCAACACGCTTCGAGCGGCTGAAGCCGTCCTCAAGTCCCGA
GCAGCAGCAACTCTCGTTGAAGACGGCACGCGAGACGGCAACGCAACTGCAACACCAGCAATCTCCCTCCGCACA
GCGGCAACACGCTTCGGCGTAAGCAAATCAGCCGTCGCCCGGGCCATCGAGCAGATCGAAGGACGACGCCCCCGC
GTCAAAGCAGGCAAACCGACGCTCCTAACCGAAAAAGAAGACGAGACTCTGGTCGGCTTCATCCACTGGCTGGAA
ACAACGGGGAGTCCAGCGACGAGGCCGCAGATCATGGGCGCGTGCCACGCTCTGATGAAGCGACGCAACGCTGAG
GCAAAGTCGCCGTCGGATTCGTGGTATGGCCGGTGGATGGCTACGCATGGGGACCTTCGACTTCGCATCGTCAAG
GTCTATGACAAGGCGCGGAGGAGGGAGGGTTCGGGGGGGAAGGAGGTTGAGAGTGACATCTTGTCGTTTTTGGAC
GAGTGTGAGCGTTCAGGGAGGGGACCTGGTGAATTTGCTGCTGGTGAGGTTGCGGGTGAGCACTCTTCGGAGTCT
TCAGCTGCGGACACGCCTGAGGAGATGGAGCTGGGGGTTGAGCCGGGTTCGAGTTGTGAGTCTTGCCATCGTCCT
CGGTTGCCTCGTCGGTTGTCTTTGCCGGACTTGCGGAGGTGTAAGGTCAGGAGAGTTGATTTTGACTTGCGCCGC
ACAAGGAGAGCTAAGAGTTAAGTTGAAGCTGGTTGTGGTGATAGTAATATATGGATGGTATTCATGTGTGCGAAT
ATGAATGTGTGTGATGAGTGATACTGATAACTGATAAGCAAGGGGCACAACTCGGGGCGGGTCCACAAATGCCTC
TTTTTGTGCACGACGAATCCAGCCTCGAATATTATCAAGCAAAACCAACGACCATCATCGCGGCTCGCCTCAGCA
GGCAGACCGGCCGTTATGGAGGTGCCCGTCTGGCTTCCACTATCTGGAACGATCGACGGAGCTCGTCTGGCGCTG
GCAGACGTCATTGATCTCTGGCACGCCTACCGAACGTCTCTTATTCTCTGCGCCGTCGCCATCCTCTTTGCTCTC
CGGCTATTTCTCCGCAGCCATCAAGAGGAGACGCTCGTTGCGCTTCCCAGCATCTATCGTGATCGCCAGGATGCG
CCAATCGAGAAGACGAACAGTGGTCCGCGTCGGATCAAGGGCGGCGCCGTCAAGAAAGTGAAGCGACCAGTCGAT
GACGCTGCGTCTACGATGCCGCCTGTCAAGCTCGTCGTCTTCTACTCGTCCGTGACGGATACTACGGCCAAGCTG
GCGGGTATCTATCACGAAAGCCTGGTCTCGGCTGTGGAGAGGCTGGCGCGAGAGACGGGACGTCCCTTTCTGAAG
CCTGAGCTGCATCATCTGGCGGAGATGGATCTCGACGACTTCTTCGTTGCGCCGCCGACGGCTCCAACTGAGGCG
GGCCTTTTCTATCTCTTTCTTTTCCCGAGCTATAACATCGACAGCATCAACGATACGGTTCTGCAGCATCTGCGC
GAGACGCACCACGACTTTCGCATCGATACCGCGCCTCTCGCCTCGTTGCTCGGGTACTCGGTCTTTGGCTACGGG
GATAGAGAGGGCTGGCCGGATGAGGAGAGGGGGTTCTGCTTCCAGGCTATCGAGCTGGATAAGTGCATGTCCAAG
CTTACGGGTCGGAAGCGCGCGTATCCTGTTGGCATGGGCGACGTCAAGGGGGATCATCGAGAGAGATTTTCTGAG
TGGGCTGCTGGTGTTGAGGATGTGGTTGCGAGTGTCGCTCGGACGGGACACCTTGGTTTGGGCGTGCGTGGGAGT
GGCGATGCTGTGGAGAGTGATGACGAGGAGGTTGATGGTGGTGGTGAAGAAGCGGCTGGCCAACAAGGGGAGAGG
CCGCTGGACGATGTTGAGGATCTGGGCAAGATGCTGCGCACGTCGGGGTCCAAATCAGGGGCCAACTCAGGGGCC
AAGCCACCCCTGGCCGTCGACTTCACCACATACAGCCAACAGCAGACTCCAGCCGTCGTCAAGGAAATGGTCCCT
CGCGACTCGCCCACATACGCGGCCCTCACCAAGCAGGGCTACACCATCGTCGGCTCTCACTCAGGCGTCAAGATC
TGCCGCTGGACAAAGTCAGCCCTCCGAGGCCGCGGCAGCTGCTACAAGTACTCCCTCTACGGCATCAACTCGCAC
CAATGCATGGAGACGACTCCCTCGCTATCATGCTCCAACAAGTGCGTCTTCTGCTGGCGCCACGGAACCAACCCC
GTCGGCACCACCTGGCGCTGGGTCGTCGACGCGCCCGACGTCATCTTCCGCGGCGTCAAGGAGGGCCACTACAGC
AAGATCCGCATGATGCGCGGCGTTCCGGGCGTCAGGGCGGAGAGATACGCTGAAGCGCTACGGATTCGCCATTGC
GCGCTTTCGCTCGTCGGAGAGCCCATCTTTTACCCTTACATCAATGAGTTTCTGGCCTTGCTTCACGCAGAGGGC
ATCTCGTCCTTTCTTGTCTGCAACGCTCAGCATCCGGATCAGCTGGCGGCGTTAAAGGCAGTGACGCAGCTGTAC
GTCTCCATCGACGCCTCTAACCGCGAGTCACTGCGCAAGATTGACCGTCCGCTTCACCGCGACTTCTGGGAACGC
TTCCTACGCTGTCTCGACATCCTCCGCGAGAAACGCTTCCGCCACCGAACCGTCTTCCGCCTCACCCTCGTCAAG
GGCTTCAACGTCGCCGACGAAGTCGAAGGATACGCCCGTCTCGTGGAGCGCGGCCTCCCCTGCTTCATAGAGGTC
AAGGGCGTCACCTACTGCGGCACCTCTACATCCGCCAACGCCGGAATCTCAATGTCCAACGTCCCCTTTTACTGG
GAGGTTTGCGACTTTGTCCGCGCGCTTGACGCCCGGCTCGCCGACATGGGCTTGGCGTACGGGATTGCGGCCGAG
CATGCGCACAGCTGCTGCGTTCTGCTGGCTAGCGAGCGGTTTCGCGTCGATGGTCTTTGGCGTACTCATATTGAC
TATCGGCAGTTCTTTCAGCTCCTCCAAGAGAGGGGCGCTGATGGTGACTGGTCGCCGGAGGATTACATGGGGGAT
CCGACGCCGGAGTGGGCGCTCTGGGGGAATGGCGGCTTTGATCCCCGTGATACTCGGGTTGATCGGAAGGGGAGG
AGTATGGATGTGACGGTCGTTCGGCATCGGCCGCCGGAGTTGGAGCACGTGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail