Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4033
Gene name
LocationContig_368:3065..3807
Strand+
Gene length (bp)742
Transcript length (bp)528
Coding sequence length (bp)528
Protein length (aa) 176

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02064 MAS20 MAS20 protein import receptor 1.9E-41 15 143

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P35848|TOM20_NEUCR Mitochondrial import receptor subunit tom20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tom20 PE=3 SV=1 20 175 1.0E-50
sp|O14225|TOM20_SCHPO Mitochondrial import receptor subunit tom20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tom20 PE=3 SV=1 15 150 4.0E-27
sp|P35180|TOM20_YEAST Mitochondrial import receptor subunit TOM20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOM20 PE=1 SV=1 1 147 2.0E-23

GO

GO Term Description Terminal node
GO:0006886 intracellular protein transport Yes
GO:0006605 protein targeting Yes
GO:0005742 mitochondrial outer membrane translocase complex Yes
GO:0033036 macromolecule localization No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0008104 protein localization No
GO:0046907 intracellular transport No
GO:0051234 establishment of localization No
GO:0098798 mitochondrial protein-containing complex No
GO:0098796 membrane protein complex No
GO:0032991 protein-containing complex No
GO:0051649 establishment of localization in cell No
GO:0071705 nitrogen compound transport No
GO:0071702 organic substance transport No
GO:0051179 localization No
GO:0098799 outer mitochondrial membrane protein complex No
GO:0070727 cellular macromolecule localization No
GO:0005575 cellular_component No
GO:0015031 protein transport No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0051641 cellular localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4033
MVQTSTIVQASAFSFAAAAVAYAIYFDHRRRTDPEFRRELRRNARRRARLEREEAEASTRHRREAIKRKVDAAKQ
EGFPTTVEERETFFNESVNAGEVLSADPASAVEAALAFYKGLKVYPSPGELIRIYDNTVPKPILDVLAEMIAYDS
SLDIRTRPAGHSGIDLGEIPNVGLD*
Coding >Ophun1|4033
ATGGTGCAGACCTCGACCATCGTCCAGGCCTCGGCCTTTTCCTTCGCCGCCGCAGCAGTCGCTTACGCCATCTAC
TTCGACCACCGACGCCGAACCGACCCCGAGTTCCGCCGCGAGCTACGAAGAAACGCCAGGCGAAGGGCCCGCCTC
GAAAGAGAAGAAGCCGAGGCATCCACCCGCCATCGCCGCGAGGCCATTAAGAGAAAAGTCGACGCCGCCAAGCAG
GAAGGCTTTCCCACCACCGTCGAGGAGCGAGAGACGTTTTTTAACGAATCCGTTAATGCCGGAGAGGTGCTGAGC
GCCGATCCCGCGAGCGCCGTCGAGGCCGCGCTGGCTTTCTACAAGGGCCTTAAGGTCTATCCCTCACCGGGCGAG
CTCATCAGGATCTACGACAATACCGTTCCCAAGCCTATACTAGATGTCCTGGCCGAGATGATCGCCTACGACTCC
AGCCTCGACATCCGCACGCGCCCCGCCGGCCACAGCGGCATCGACTTGGGCGAAATCCCAAACGTCGGTCTCGAC
TAG
Transcript >Ophun1|4033
ATGGTGCAGACCTCGACCATCGTCCAGGCCTCGGCCTTTTCCTTCGCCGCCGCAGCAGTCGCTTACGCCATCTAC
TTCGACCACCGACGCCGAACCGACCCCGAGTTCCGCCGCGAGCTACGAAGAAACGCCAGGCGAAGGGCCCGCCTC
GAAAGAGAAGAAGCCGAGGCATCCACCCGCCATCGCCGCGAGGCCATTAAGAGAAAAGTCGACGCCGCCAAGCAG
GAAGGCTTTCCCACCACCGTCGAGGAGCGAGAGACGTTTTTTAACGAATCCGTTAATGCCGGAGAGGTGCTGAGC
GCCGATCCCGCGAGCGCCGTCGAGGCCGCGCTGGCTTTCTACAAGGGCCTTAAGGTCTATCCCTCACCGGGCGAG
CTCATCAGGATCTACGACAATACCGTTCCCAAGCCTATACTAGATGTCCTGGCCGAGATGATCGCCTACGACTCC
AGCCTCGACATCCGCACGCGCCCCGCCGGCCACAGCGGCATCGACTTGGGCGAAATCCCAAACGTCGGTCTCGAC
TAG
Gene >Ophun1|4033
ATGGTGCAGACCTCGACCATCGTCCAGGCCTCGGCCTTTTCCTTCGCCGCCGCAGCAGTCGGTAAGCACAAGCTG
GAGAATCCTTTGAAACAACAAGAACCCACCACGAGAACGCACAGTACGCTGAAATCAACCAACCACCAGCTTACG
CCATCTACTTCGACCACCGACGCCGAACCGACCCCGAGTTCCGCCGCGAGCTACGAAGAAACGCCAGGCGAAGGG
CCCGCCTCGAAAGAGAAGAAGCCGAGGCATCCACCCGCCATCGCCGCGAGGCCATTAAGAGAAAAGTCGACGCCG
CCAAGCAGGAAGGCTTTCCCACCACCGTCGAGGAGCGAGAGACGTTTTTTAACGAATCCGTTAATGCCGGAGAGG
TGCTGAGCGCCGATCGTACGTCGTCTCTTTCGCCTGTACCCAGTTTTGCTGCTGACGGATATCTCTTCGCCAGCC
GCGAGCGCCGTCGAGGCCGCGCTGGCTTTCTACAAGGGCCTTAAGGTCTATCCCTCACCGGGCGAGCTCATCAGG
ATCTACGACAATACCGTTCCCAAGGTCTGCCTCTTCGATAAACCCCCCCCCCCCCCTCCTTCAACGAACTATCCG
CCAACAAACCCCTCCTCTCTAGCCTATACTAGATGTCCTGGCCGAGATGATCGCCTACGACTCCAGCCTCGACAT
CCGCACGCGCCCCGCCGGCCACAGCGGCATCGACTTGGGCGAAATCCCAAACGTCGGTCTCGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail