Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4028
Gene name
LocationContig_367:10294..12216
Strand+
Gene length (bp)1922
Transcript length (bp)1743
Coding sequence length (bp)1743
Protein length (aa) 581

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 2.9E-07 55 77
PF18044 zf-CCCH_4 CCCH-type zinc finger 2.0E-07 56 77

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|G0S381|AMO1_CHATD Nucleoporin AMO1 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=AMO1 PE=3 SV=1 55 580 1.0E-85
sp|O74315|AMO1_SCHPO Nucleoporin-like protein amo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=amo1 PE=3 SV=1 55 248 1.0E-06

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3543
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4217
Ophiocordyceps australis map64 (Brazil) OphauB2|6606
Ophiocordyceps camponoti-floridani Ophcf2|05214
Ophiocordyceps camponoti-rufipedis Ophun1|4028 (this protein)
Ophiocordyceps kimflemingae Ophio5|5447
Ophiocordyceps subramaniannii Hirsu2|6795

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4028
MIFASKLRSRLSPRPQQQPPAPRFIRRSSSSPLSRHEVAFESLEPILPRLRLPSMPVCRFFQQGYCKFGSSCRFQ
HPSRNQSQPSQPSQPNRFSPLSGSGGRGNQDSVLEKYSISSAAITKDLTEDKPTWILSAYAPGRDAPEQLFGGFP
REQSFEEVRLHYMMGKASGNEQQALGEAQALYTTAQEQMERALNNIQEAMRFVADAEDRHPNRNDICRQATHGAP
FGEFLVGKRPKSTADSSIPSNPFATMPGPSQLAGGAAANPFGQPSPAKPNPFAQASPSPFAPQGAANGGQAGGFG
QAAQPSVSTFGQPTSLGAKPNPFASSSAAPTNAFGVPAQLGQKPNPFANHGQANSTTSPFASIPSSGDNSRNPFG
APAPSQTDAPVNPFASNQNNNSAGGAFGASPFATAASTTAAATVQTGNSFATHAGPPPPYEANRPFGQPEPPKAN
GVFSKPSTDASNNKTPFGQQPPVNASSGIGNHPPLESYSTKGPTGRLATFKGKTVVYKDGEAGTRGFDGTWARIW
FPEGPPAPCRDTLLPPSEYDARSRKQWEAFAETGNFVGGIMPEVPPPRELTRWDF*
Coding >Ophun1|4028
ATGATCTTCGCCTCGAAGCTTCGCTCGCGCCTCTCGCCTCGTCCGCAGCAGCAGCCGCCAGCACCGCGATTCATC
CGCCGAAGCAGCTCCAGTCCGTTGTCGCGACATGAAGTAGCCTTCGAGTCTCTGGAGCCGATACTGCCGCGTTTG
CGACTGCCCAGCATGCCTGTGTGTCGCTTCTTTCAGCAGGGGTACTGCAAATTCGGCAGTAGTTGTCGGTTTCAG
CATCCTTCTCGCAATCAGTCGCAGCCGTCGCAGCCGTCGCAGCCGAACCGGTTCAGTCCGCTGTCTGGTAGCGGA
GGGCGAGGGAATCAGGACTCGGTGCTTGAAAAGTATAGCATCAGCTCTGCGGCCATTACCAAGGACCTCACCGAA
GACAAGCCGACATGGATCCTGTCAGCATACGCGCCTGGAAGGGATGCTCCCGAGCAGCTATTTGGTGGGTTTCCG
CGCGAGCAGAGCTTCGAGGAGGTAAGGTTGCACTACATGATGGGTAAAGCCTCGGGAAACGAGCAGCAGGCGCTC
GGTGAAGCCCAGGCTCTTTACACGACCGCACAGGAGCAGATGGAAAGGGCGCTTAACAATATCCAAGAAGCTATG
CGCTTCGTCGCCGACGCAGAAGACAGACACCCGAACCGCAACGACATTTGCCGCCAGGCAACCCATGGCGCTCCC
TTTGGCGAATTCCTCGTCGGCAAGAGGCCCAAGTCGACGGCCGACTCGTCGATTCCCTCGAACCCCTTCGCCACG
ATGCCCGGTCCGTCGCAGCTAGCCGGAGGAGCAGCCGCGAATCCCTTCGGCCAGCCGTCTCCCGCAAAGCCGAAT
CCCTTTGCGCAGGCGTCGCCATCCCCCTTTGCGCCGCAAGGGGCGGCTAACGGGGGGCAAGCTGGTGGCTTTGGC
CAGGCCGCGCAGCCGTCAGTCTCTACCTTTGGACAACCAACTTCTCTGGGCGCCAAGCCGAATCCCTTTGCTTCC
TCTTCTGCTGCGCCGACTAATGCTTTCGGAGTGCCGGCTCAGCTCGGGCAGAAGCCGAACCCGTTTGCGAATCAT
GGGCAGGCCAACTCTACCACCAGCCCTTTTGCCTCCATCCCGTCCTCTGGTGATAACTCGAGGAACCCGTTTGGC
GCGCCGGCTCCTTCTCAGACCGACGCACCAGTTAATCCATTCGCATCCAACCAGAATAACAATAGCGCTGGGGGG
GCTTTTGGTGCCTCTCCCTTTGCGACCGCGGCTTCTACCACGGCTGCGGCGACGGTTCAGACCGGCAACTCGTTC
GCAACGCACGCTGGTCCGCCTCCGCCGTATGAGGCGAACCGTCCATTTGGCCAGCCAGAGCCGCCCAAAGCCAAC
GGCGTCTTCAGCAAGCCCTCTACAGATGCGAGCAATAACAAAACTCCTTTCGGCCAGCAACCCCCGGTGAATGCG
TCCAGCGGCATCGGCAATCACCCGCCACTGGAAAGCTACAGCACCAAGGGGCCAACGGGCCGGCTGGCGACCTTT
AAAGGCAAGACCGTCGTATACAAGGACGGGGAGGCCGGCACGCGCGGTTTCGACGGCACGTGGGCGCGCATCTGG
TTCCCTGAAGGGCCACCGGCCCCGTGCAGGGACACGCTCCTCCCGCCGAGCGAGTACGACGCGCGGTCGAGGAAG
CAGTGGGAAGCGTTTGCTGAGACGGGCAATTTTGTAGGAGGGATTATGCCTGAGGTTCCACCGCCGAGGGAGCTT
ACGCGGTGGGATTTTTAG
Transcript >Ophun1|4028
ATGATCTTCGCCTCGAAGCTTCGCTCGCGCCTCTCGCCTCGTCCGCAGCAGCAGCCGCCAGCACCGCGATTCATC
CGCCGAAGCAGCTCCAGTCCGTTGTCGCGACATGAAGTAGCCTTCGAGTCTCTGGAGCCGATACTGCCGCGTTTG
CGACTGCCCAGCATGCCTGTGTGTCGCTTCTTTCAGCAGGGGTACTGCAAATTCGGCAGTAGTTGTCGGTTTCAG
CATCCTTCTCGCAATCAGTCGCAGCCGTCGCAGCCGTCGCAGCCGAACCGGTTCAGTCCGCTGTCTGGTAGCGGA
GGGCGAGGGAATCAGGACTCGGTGCTTGAAAAGTATAGCATCAGCTCTGCGGCCATTACCAAGGACCTCACCGAA
GACAAGCCGACATGGATCCTGTCAGCATACGCGCCTGGAAGGGATGCTCCCGAGCAGCTATTTGGTGGGTTTCCG
CGCGAGCAGAGCTTCGAGGAGGTAAGGTTGCACTACATGATGGGTAAAGCCTCGGGAAACGAGCAGCAGGCGCTC
GGTGAAGCCCAGGCTCTTTACACGACCGCACAGGAGCAGATGGAAAGGGCGCTTAACAATATCCAAGAAGCTATG
CGCTTCGTCGCCGACGCAGAAGACAGACACCCGAACCGCAACGACATTTGCCGCCAGGCAACCCATGGCGCTCCC
TTTGGCGAATTCCTCGTCGGCAAGAGGCCCAAGTCGACGGCCGACTCGTCGATTCCCTCGAACCCCTTCGCCACG
ATGCCCGGTCCGTCGCAGCTAGCCGGAGGAGCAGCCGCGAATCCCTTCGGCCAGCCGTCTCCCGCAAAGCCGAAT
CCCTTTGCGCAGGCGTCGCCATCCCCCTTTGCGCCGCAAGGGGCGGCTAACGGGGGGCAAGCTGGTGGCTTTGGC
CAGGCCGCGCAGCCGTCAGTCTCTACCTTTGGACAACCAACTTCTCTGGGCGCCAAGCCGAATCCCTTTGCTTCC
TCTTCTGCTGCGCCGACTAATGCTTTCGGAGTGCCGGCTCAGCTCGGGCAGAAGCCGAACCCGTTTGCGAATCAT
GGGCAGGCCAACTCTACCACCAGCCCTTTTGCCTCCATCCCGTCCTCTGGTGATAACTCGAGGAACCCGTTTGGC
GCGCCGGCTCCTTCTCAGACCGACGCACCAGTTAATCCATTCGCATCCAACCAGAATAACAATAGCGCTGGGGGG
GCTTTTGGTGCCTCTCCCTTTGCGACCGCGGCTTCTACCACGGCTGCGGCGACGGTTCAGACCGGCAACTCGTTC
GCAACGCACGCTGGTCCGCCTCCGCCGTATGAGGCGAACCGTCCATTTGGCCAGCCAGAGCCGCCCAAAGCCAAC
GGCGTCTTCAGCAAGCCCTCTACAGATGCGAGCAATAACAAAACTCCTTTCGGCCAGCAACCCCCGGTGAATGCG
TCCAGCGGCATCGGCAATCACCCGCCACTGGAAAGCTACAGCACCAAGGGGCCAACGGGCCGGCTGGCGACCTTT
AAAGGCAAGACCGTCGTATACAAGGACGGGGAGGCCGGCACGCGCGGTTTCGACGGCACGTGGGCGCGCATCTGG
TTCCCTGAAGGGCCACCGGCCCCGTGCAGGGACACGCTCCTCCCGCCGAGCGAGTACGACGCGCGGTCGAGGAAG
CAGTGGGAAGCGTTTGCTGAGACGGGCAATTTTGTAGGAGGGATTATGCCTGAGGTTCCACCGCCGAGGGAGCTT
ACGCGGTGGGATTTTTAG
Gene >Ophun1|4028
ATGATCTTCGCCTCGAAGCTTCGCTCGCGCCTCTCGCCTCGTCCGCAGCAGCAGCCGCCAGCACCGCGATTCATC
CGCCGAAGCAGCTCCAGTCCGTTGTCGCGACATGAAGTAGCCTTCGAGTCTCTGGAGCCGATACTGCCGCGTTTG
CGACTGCCCAGCATGCCTGTGTGTCGCTTCTTTCAGCAGGGGTACTGCAAATTCGGCAGTGAGTGTTTTCTTCCC
GTTCACGATTGACGATGCTGTGTGCTGAGCTGATGGTGTCTTTCTTGGCAGGTAGTTGTCGGTTTCAGCATCCTT
CTCGCAATCAGTCGCAGCCGTCGCAGCCGTCGCAGCCGAACCGGTTCAGTCCGCTGTCTGGTAGCGGAGGGCGAG
GGAATCAGGACTCGGTGCTTGGTGAGAGCCCATGCCGCAGACGTGGCGCGCGTCGATTGACGGTCCGGGCAGAAA
AGTATAGCATCAGCTCTGCGGCCATTACCAAGGACCTCACCGAAGACAAGCCGACATGGATCCTGTCAGCATACG
CGCCTGGAAGGGATGCTCCCGAGCAGCTATTTGGTGGGTTTCCGCGCGAGCAGAGCTTCGAGGAGGTAAGGTTGC
ACTACATGATGGGTAAAGCCTCGGGAAACGAGCAGCAGGCGGTAAGTCTCCTCTCCCCGTTATTCTGATGAAGCC
ATGGCCTGACTCTCTTCTCCTCGAAGCTCGGTGAAGCCCAGGCTCTTTACACGACCGCACAGGAGCAGATGGAAA
GGGCGCTTAACAATATCCAAGAAGCTATGCGCTTCGTCGCCGACGCAGAAGACAGACACCCGAACCGCAACGACA
TTTGCCGCCAGGCAACCCATGGCGCTCCCTTTGGCGAATTCCTCGTCGGCAAGAGGCCCAAGTCGACGGCCGACT
CGTCGATTCCCTCGAACCCCTTCGCCACGATGCCCGGTCCGTCGCAGCTAGCCGGAGGAGCAGCCGCGAATCCCT
TCGGCCAGCCGTCTCCCGCAAAGCCGAATCCCTTTGCGCAGGCGTCGCCATCCCCCTTTGCGCCGCAAGGGGCGG
CTAACGGGGGGCAAGCTGGTGGCTTTGGCCAGGCCGCGCAGCCGTCAGTCTCTACCTTTGGACAACCAACTTCTC
TGGGCGCCAAGCCGAATCCCTTTGCTTCCTCTTCTGCTGCGCCGACTAATGCTTTCGGAGTGCCGGCTCAGCTCG
GGCAGAAGCCGAACCCGTTTGCGAATCATGGGCAGGCCAACTCTACCACCAGCCCTTTTGCCTCCATCCCGTCCT
CTGGTGATAACTCGAGGAACCCGTTTGGCGCGCCGGCTCCTTCTCAGACCGACGCACCAGTTAATCCATTCGCAT
CCAACCAGAATAACAATAGCGCTGGGGGGGCTTTTGGTGCCTCTCCCTTTGCGACCGCGGCTTCTACCACGGCTG
CGGCGACGGTTCAGACCGGCAACTCGTTCGCAACGCACGCTGGTCCGCCTCCGCCGTATGAGGCGAACCGTCCAT
TTGGCCAGCCAGAGCCGCCCAAAGCCAACGGCGTCTTCAGCAAGCCCTCTACAGATGCGAGCAATAACAAAACTC
CTTTCGGCCAGCAACCCCCGGTGAATGCGTCCAGCGGCATCGGCAATCACCCGCCACTGGAAAGCTACAGCACCA
AGGGGCCAACGGGCCGGCTGGCGACCTTTAAAGGCAAGACCGTCGTATACAAGGACGGGGAGGCCGGCACGCGCG
GTTTCGACGGCACGTGGGCGCGCATCTGGTTCCCTGAAGGGCCACCGGCCCCGTGCAGGGACACGCTCCTCCCGC
CGAGCGAGTACGACGCGCGGTCGAGGAAGCAGTGGGAAGCGTTTGCTGAGACGGGCAATTTTGTAGGAGGGATTA
TGCCTGAGGTTCCACCGCCGAGGGAGCTTACGCGGTGGGATTTTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail