Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4026
Gene name
LocationContig_367:4243..7542
Strand+
Gene length (bp)3299
Transcript length (bp)2841
Coding sequence length (bp)2841
Protein length (aa) 947

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10277 Frag1 Frag1/DRAM/Sfk1 family 2.6E-36 20 227

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P25618|CWH43_YEAST Protein CWH43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH43 PE=1 SV=2 18 945 0.0E+00
sp|Q9HDZ2|CWH43_SCHPO Protein cwh43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwh43 PE=2 SV=2 17 946 0.0E+00
sp|Q9H720|PG2IP_HUMAN PGAP2-interacting protein OS=Homo sapiens GN=CWH43 PE=2 SV=2 269 945 1.0E-90
sp|Q91YL7|PG2IP_MOUSE PGAP2-interacting protein OS=Mus musculus GN=Cwh43 PE=1 SV=1 262 945 1.0E-84
sp|Q2ABP2|PGAP2_CRIGR Post-GPI attachment to proteins factor 2 OS=Cricetulus griseus GN=Pgap2 PE=2 SV=1 8 234 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P25618|CWH43_YEAST Protein CWH43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CWH43 PE=1 SV=2 18 945 0.0E+00
sp|Q9HDZ2|CWH43_SCHPO Protein cwh43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cwh43 PE=2 SV=2 17 946 0.0E+00
sp|Q9H720|PG2IP_HUMAN PGAP2-interacting protein OS=Homo sapiens GN=CWH43 PE=2 SV=2 269 945 1.0E-90
sp|Q91YL7|PG2IP_MOUSE PGAP2-interacting protein OS=Mus musculus GN=Cwh43 PE=1 SV=1 262 945 1.0E-84
sp|Q2ABP2|PGAP2_CRIGR Post-GPI attachment to proteins factor 2 OS=Cricetulus griseus GN=Pgap2 PE=2 SV=1 8 234 2.0E-14
sp|Q2ABP3|PGAP2_RAT Post-GPI attachment to proteins factor 2 OS=Rattus norvegicus GN=Pgap2 PE=2 SV=1 8 234 5.0E-14
sp|Q3TQR0|PGAP2_MOUSE Post-GPI attachment to proteins factor 2 OS=Mus musculus GN=Pgap2 PE=1 SV=2 8 234 7.0E-14
sp|Q9UHJ9|PGAP2_HUMAN Post-GPI attachment to proteins factor 2 OS=Homo sapiens GN=PGAP2 PE=1 SV=2 8 234 6.0E-12
sp|A6H7B8|PGAP2_BOVIN Post-GPI attachment to proteins factor 2 OS=Bos taurus GN=PGAP2 PE=2 SV=1 8 234 1.0E-11
sp|Q5M9A7|PGAP2_XENLA Post-GPI attachment to proteins factor 2 OS=Xenopus laevis GN=pgap2 PE=2 SV=1 8 232 5.0E-11
sp|A8KBG2|PGAP2_XENTR Post-GPI attachment to proteins factor 2 OS=Xenopus tropicalis GN=pgap2 PE=2 SV=1 60 232 3.0E-08
sp|Q9VPT7|PGAP2_DROME Post-GPI attachment to proteins factor 2 OS=Drosophila melanogaster GN=CG3876 PE=2 SV=2 60 237 1.0E-07
sp|Q29M88|PGAP2_DROPS Post-GPI attachment to proteins factor 2 OS=Drosophila pseudoobscura pseudoobscura GN=GA17744 PE=3 SV=2 61 231 7.0E-07
sp|Q9VWK6|PGP2L_DROME Post-GPI attachment to proteins factor 2-like OS=Drosophila melanogaster GN=CG7990 PE=2 SV=4 63 233 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 79 101 22
3 108 130 22
4 140 159 19
5 172 189 17
6 204 226 22
7 264 286 22
8 296 318 22
9 344 361 17
10 376 394 18
11 407 426 19
12 441 463 22
13 483 505 22
14 530 552 22
15 565 587 22
16 597 615 18
17 636 653 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4026
MAATRYKDKDAGVVVSFSGQWVSWAHTVAASTAFLSALLVGIALHYHKIVQNEFYGYPDEWFPSVSAAIGDRYPE
RSCFMLFIAVTSGPRFALVGLWYLLTRKQGSRLPGFVASMGVVRTLTCGGWTYVTSTDDHDWHDIFMISYIVATL
PWTTGCIALSPPNPQAIKYRKYIASTFFGTLVPLIYFFIRHKVHRVAGAYTIYAFLEWALIILDVAFDAVTALDF
GTFEVLVKDVKGSTKGKQQATAGVYSGSFTWSEALDIAASIYHGFIFWSMLTSLGLLVWYFPLWHMGISGYEAFV
LVSASPALLVGPIRSLVVNNVRIVHLLSLVGVAAYLVPDQANRLLTVGVGVALSTLGWVATLHSESAHERRFESR
LLGLMIGLILSSTAKFAWQTNNPVWPILHDTNGGWNGTGLILGILAALRFTRHAPLTGSLSLGGKQGGSTVLAAC
GIGGLFFGLHSLLSDTSTMILWGWEGYPIRGPYFSTHGWCTVAAMSAGLGAGIWRPAVAGSWTQYAAGAVGALVL
TKFSHWLGYLGGLGMAVYLMAVSVPLLSSACKKKPAVTFGLGFFIYVFMVLFHVWVVAYAFVPGGPLVRERTDWI
MMTMMALIGAGVADYKASQPRRPQPRSPRASQHRKLYGVATLLVNILFLCAAFKRFPRADHKPYHGEDRVLTAGI
WTVHFSLDNDMWSSEYRMRDLIKEMELDVVGLLESDLQRIIMGNRDTTQFLAEDLGMYVDYGPGPNKHTWGAALL
SKFPIVESKHHLLPSPVGELAPAIHATLDVYGELVDVFVFHSGQEEDPEDRRLQSEYLSKLMGSSPRPSILLSYL
VTKPLEGNYKTYVSEQSGMHDIDWTDWDRWCEYILYKGLRRVGYARVSRSTITDTELQVGKFVVPRSAAEMTQLE
ARPAEERDRRVKESEVPEGWRFPALFRGAGVRDHRYHVFDEPRYFN*
Coding >Ophun1|4026
ATGGCGGCGACACGATACAAGGACAAGGACGCTGGCGTCGTCGTCAGCTTCAGCGGCCAGTGGGTGAGCTGGGCG
CATACCGTCGCAGCTTCGACTGCCTTCTTGAGCGCCCTGTTGGTGGGCATTGCTCTGCATTACCACAAAATCGTC
CAAAATGAGTTCTACGGCTACCCAGACGAATGGTTTCCCTCCGTCTCGGCCGCCATTGGCGATCGATATCCCGAG
CGGTCGTGCTTCATGCTCTTCATCGCCGTCACATCAGGTCCACGCTTCGCCCTCGTCGGCTTGTGGTATCTCTTG
ACGCGCAAGCAAGGGTCCAGACTCCCCGGCTTCGTGGCCTCCATGGGCGTCGTTCGCACATTGACCTGCGGTGGT
TGGACTTACGTTACGTCGACTGATGACCACGATTGGCACGACATTTTCATGATCTCCTACATCGTCGCGACGCTG
CCTTGGACCACCGGTTGCATCGCCTTGAGCCCTCCGAACCCTCAAGCCATCAAGTATCGCAAATACATTGCCAGC
ACCTTCTTTGGAACTCTCGTCCCGCTTATATACTTCTTCATCCGGCACAAAGTCCACCGCGTGGCGGGAGCTTAC
ACCATCTACGCCTTCTTGGAGTGGGCGCTCATCATCCTCGATGTGGCCTTTGATGCCGTCACAGCTCTCGACTTT
GGCACGTTTGAGGTGCTGGTGAAAGATGTCAAGGGCTCGACAAAGGGGAAGCAACAAGCGACGGCGGGCGTATAC
TCGGGCAGTTTCACATGGTCCGAAGCTTTGGACATTGCGGCGAGTATCTATCATGGGTTCATCTTCTGGTCCATG
TTGACCAGCCTGGGCCTTCTTGTCTGGTACTTTCCCCTTTGGCACATGGGGATATCCGGCTACGAGGCGTTCGTA
CTGGTTTCCGCATCGCCGGCACTCCTGGTCGGCCCTATCCGATCATTGGTGGTCAATAACGTCCGGATCGTTCAC
CTGCTTTCACTCGTCGGCGTCGCCGCATATCTTGTCCCCGACCAAGCCAATCGTCTCCTGACCGTCGGAGTCGGT
GTCGCCCTATCCACCTTGGGCTGGGTTGCCACCCTACACTCAGAATCCGCTCACGAGAGACGGTTCGAGTCGCGG
CTTCTGGGATTGATGATCGGCCTGATTCTTTCGTCGACTGCCAAGTTTGCATGGCAGACAAACAATCCCGTGTGG
CCTATCTTGCACGATACCAACGGGGGCTGGAACGGAACGGGCCTCATCCTCGGAATCCTGGCAGCGTTGCGCTTC
ACCCGTCACGCGCCCCTGACCGGCAGCCTCTCCCTCGGAGGCAAGCAGGGGGGCTCGACCGTGCTCGCCGCCTGT
GGCATCGGAGGGCTCTTCTTTGGCCTCCACTCGCTGCTGTCCGACACGAGCACCATGATCCTCTGGGGCTGGGAA
GGGTACCCCATCCGCGGCCCTTACTTCTCCACACACGGCTGGTGCACGGTGGCGGCAATGTCGGCCGGTCTCGGA
GCCGGCATTTGGAGACCCGCAGTGGCCGGAAGCTGGACGCAATACGCGGCGGGCGCTGTCGGAGCCCTGGTTCTG
ACCAAGTTCAGCCACTGGCTCGGATACCTGGGCGGCCTCGGGATGGCCGTATATCTGATGGCCGTCTCGGTCCCC
CTGCTGTCGAGCGCGTGCAAGAAGAAGCCGGCGGTGACGTTTGGGCTGGGCTTCTTCATCTACGTCTTCATGGTG
CTGTTCCACGTCTGGGTCGTGGCCTATGCCTTTGTGCCCGGCGGGCCGCTCGTGCGCGAGCGTACGGACTGGATC
ATGATGACGATGATGGCCCTCATCGGCGCCGGCGTGGCCGACTACAAGGCCTCACAGCCGCGACGACCTCAGCCG
CGGAGCCCTCGGGCGTCACAGCACCGCAAGTTGTACGGGGTGGCGACGCTGTTGGTCAACATCCTCTTTCTCTGT
GCCGCCTTCAAACGGTTCCCCAGGGCGGACCACAAGCCGTACCACGGCGAGGATCGGGTCTTGACGGCCGGCATC
TGGACGGTGCACTTCTCGCTCGACAACGACATGTGGTCGTCGGAGTATCGGATGCGCGACCTGATCAAGGAGATG
GAGCTGGACGTGGTAGGCCTTCTCGAGTCGGATCTACAGCGCATCATCATGGGCAACCGTGATACGACGCAGTTC
CTGGCCGAGGATCTCGGCATGTATGTCGACTACGGGCCCGGGCCCAACAAGCACACTTGGGGCGCTGCGCTGCTG
TCCAAGTTCCCGATCGTCGAGTCCAAGCACCACCTGCTGCCGAGTCCGGTAGGAGAGCTGGCGCCGGCGATTCAC
GCGACGCTTGACGTCTACGGTGAGCTGGTCGACGTCTTCGTCTTCCACTCGGGCCAAGAGGAGGACCCGGAGGAC
CGGAGGCTGCAGAGCGAATATCTGAGCAAGCTGATGGGGTCGAGTCCGAGGCCGTCGATCCTGCTGAGCTACCTG
GTGACGAAGCCGCTCGAGGGCAACTACAAGACGTACGTCAGCGAGCAGTCAGGCATGCACGATATCGACTGGACC
GACTGGGACCGATGGTGCGAGTACATCCTCTACAAGGGTCTCCGGCGCGTGGGCTACGCTCGCGTCAGCCGCAGT
ACCATTACCGACACGGAGCTGCAGGTGGGCAAGTTTGTCGTCCCCCGCTCAGCCGCGGAGATGACGCAGCTGGAG
GCGCGGCCGGCCGAGGAGCGGGACCGGCGAGTGAAGGAGTCGGAGGTGCCCGAAGGGTGGAGGTTCCCGGCGCTG
TTCCGGGGAGCCGGCGTGCGGGATCACCGGTATCATGTCTTTGATGAGCCGAGGTATTTCAACTAG
Transcript >Ophun1|4026
ATGGCGGCGACACGATACAAGGACAAGGACGCTGGCGTCGTCGTCAGCTTCAGCGGCCAGTGGGTGAGCTGGGCG
CATACCGTCGCAGCTTCGACTGCCTTCTTGAGCGCCCTGTTGGTGGGCATTGCTCTGCATTACCACAAAATCGTC
CAAAATGAGTTCTACGGCTACCCAGACGAATGGTTTCCCTCCGTCTCGGCCGCCATTGGCGATCGATATCCCGAG
CGGTCGTGCTTCATGCTCTTCATCGCCGTCACATCAGGTCCACGCTTCGCCCTCGTCGGCTTGTGGTATCTCTTG
ACGCGCAAGCAAGGGTCCAGACTCCCCGGCTTCGTGGCCTCCATGGGCGTCGTTCGCACATTGACCTGCGGTGGT
TGGACTTACGTTACGTCGACTGATGACCACGATTGGCACGACATTTTCATGATCTCCTACATCGTCGCGACGCTG
CCTTGGACCACCGGTTGCATCGCCTTGAGCCCTCCGAACCCTCAAGCCATCAAGTATCGCAAATACATTGCCAGC
ACCTTCTTTGGAACTCTCGTCCCGCTTATATACTTCTTCATCCGGCACAAAGTCCACCGCGTGGCGGGAGCTTAC
ACCATCTACGCCTTCTTGGAGTGGGCGCTCATCATCCTCGATGTGGCCTTTGATGCCGTCACAGCTCTCGACTTT
GGCACGTTTGAGGTGCTGGTGAAAGATGTCAAGGGCTCGACAAAGGGGAAGCAACAAGCGACGGCGGGCGTATAC
TCGGGCAGTTTCACATGGTCCGAAGCTTTGGACATTGCGGCGAGTATCTATCATGGGTTCATCTTCTGGTCCATG
TTGACCAGCCTGGGCCTTCTTGTCTGGTACTTTCCCCTTTGGCACATGGGGATATCCGGCTACGAGGCGTTCGTA
CTGGTTTCCGCATCGCCGGCACTCCTGGTCGGCCCTATCCGATCATTGGTGGTCAATAACGTCCGGATCGTTCAC
CTGCTTTCACTCGTCGGCGTCGCCGCATATCTTGTCCCCGACCAAGCCAATCGTCTCCTGACCGTCGGAGTCGGT
GTCGCCCTATCCACCTTGGGCTGGGTTGCCACCCTACACTCAGAATCCGCTCACGAGAGACGGTTCGAGTCGCGG
CTTCTGGGATTGATGATCGGCCTGATTCTTTCGTCGACTGCCAAGTTTGCATGGCAGACAAACAATCCCGTGTGG
CCTATCTTGCACGATACCAACGGGGGCTGGAACGGAACGGGCCTCATCCTCGGAATCCTGGCAGCGTTGCGCTTC
ACCCGTCACGCGCCCCTGACCGGCAGCCTCTCCCTCGGAGGCAAGCAGGGGGGCTCGACCGTGCTCGCCGCCTGT
GGCATCGGAGGGCTCTTCTTTGGCCTCCACTCGCTGCTGTCCGACACGAGCACCATGATCCTCTGGGGCTGGGAA
GGGTACCCCATCCGCGGCCCTTACTTCTCCACACACGGCTGGTGCACGGTGGCGGCAATGTCGGCCGGTCTCGGA
GCCGGCATTTGGAGACCCGCAGTGGCCGGAAGCTGGACGCAATACGCGGCGGGCGCTGTCGGAGCCCTGGTTCTG
ACCAAGTTCAGCCACTGGCTCGGATACCTGGGCGGCCTCGGGATGGCCGTATATCTGATGGCCGTCTCGGTCCCC
CTGCTGTCGAGCGCGTGCAAGAAGAAGCCGGCGGTGACGTTTGGGCTGGGCTTCTTCATCTACGTCTTCATGGTG
CTGTTCCACGTCTGGGTCGTGGCCTATGCCTTTGTGCCCGGCGGGCCGCTCGTGCGCGAGCGTACGGACTGGATC
ATGATGACGATGATGGCCCTCATCGGCGCCGGCGTGGCCGACTACAAGGCCTCACAGCCGCGACGACCTCAGCCG
CGGAGCCCTCGGGCGTCACAGCACCGCAAGTTGTACGGGGTGGCGACGCTGTTGGTCAACATCCTCTTTCTCTGT
GCCGCCTTCAAACGGTTCCCCAGGGCGGACCACAAGCCGTACCACGGCGAGGATCGGGTCTTGACGGCCGGCATC
TGGACGGTGCACTTCTCGCTCGACAACGACATGTGGTCGTCGGAGTATCGGATGCGCGACCTGATCAAGGAGATG
GAGCTGGACGTGGTAGGCCTTCTCGAGTCGGATCTACAGCGCATCATCATGGGCAACCGTGATACGACGCAGTTC
CTGGCCGAGGATCTCGGCATGTATGTCGACTACGGGCCCGGGCCCAACAAGCACACTTGGGGCGCTGCGCTGCTG
TCCAAGTTCCCGATCGTCGAGTCCAAGCACCACCTGCTGCCGAGTCCGGTAGGAGAGCTGGCGCCGGCGATTCAC
GCGACGCTTGACGTCTACGGTGAGCTGGTCGACGTCTTCGTCTTCCACTCGGGCCAAGAGGAGGACCCGGAGGAC
CGGAGGCTGCAGAGCGAATATCTGAGCAAGCTGATGGGGTCGAGTCCGAGGCCGTCGATCCTGCTGAGCTACCTG
GTGACGAAGCCGCTCGAGGGCAACTACAAGACGTACGTCAGCGAGCAGTCAGGCATGCACGATATCGACTGGACC
GACTGGGACCGATGGTGCGAGTACATCCTCTACAAGGGTCTCCGGCGCGTGGGCTACGCTCGCGTCAGCCGCAGT
ACCATTACCGACACGGAGCTGCAGGTGGGCAAGTTTGTCGTCCCCCGCTCAGCCGCGGAGATGACGCAGCTGGAG
GCGCGGCCGGCCGAGGAGCGGGACCGGCGAGTGAAGGAGTCGGAGGTGCCCGAAGGGTGGAGGTTCCCGGCGCTG
TTCCGGGGAGCCGGCGTGCGGGATCACCGGTATCATGTCTTTGATGAGCCGAGGTATTTCAACTAG
Gene >Ophun1|4026
ATGGCGGCGACACGATACAAGGACAAGGACGCTGGCGTCGTCGTCAGCTTCAGCGGCCAGTGGGTGAGCTGGGCG
CATACCGTCGCAGCTTCGAGTGAGTCGCGGCCGCCGTGTGGGACGAGTTTAATCCTAATCGACTGTGTCCAGCTG
CCTTCTTGAGCGCCCTGTTGGTGGGCATTGCTCTGCATTACCACAAAATCGTCCAAAATGAGTTCTACGGCTACC
CAGACGAATGGTTTCCCTCCGTCTCGGCCGCCATTGGCGATCGATATCCCGAGCGGTCGTGCTTCATGCTCTTCA
TCGCCGTCACATCAGGTACGCTCTCCCGTCTACACATCCGCTACTGAGTCTGACCCGTCCCAGGTCCACGCTTCG
CCCTCGTCGGCTTGTGGTATCTCTTGACGCGCAAGCAAGGGTCCAGACTCCCCGGCTTCGTGGCCTCCATGGGCG
TCGTTCGCACATTGACCTGCGGTGGTTGGACTTACGTTACGTCGACTGATGACCACGATTGGCACGACATTTTCA
TGATCTCCTACATCGTCGCGACGCTGCCTTGGACCACCGGTTGCATCGCCTTGAGCCCTCCGAACCCTCAAGCCA
TCAAGTATCGCAAATACATTGCCAGCACCTTCTTTGGAACTCTCGTCCCGCTTATATACTTCTTCATCCGGCACA
AAGTCCACCGCGTGGCGGGAGGTACGTCGTGTTGTTCAGACAGTGTCCAATGCAAAACTGACTTGCATAGCTTAC
ACCATCTACGCCTTCTTGGAGTGGGCGCTCATCATCCTCGATGTGGCCTTTGATGCCGTCACAGCTCTCGACTTT
GGCACGTTTGAGGTGCTGGTGAAAGATGTCAAGGGCTCGACAAAGGGGTACGTCCAATGGCTACCGAGATAGCGC
TCGCTTCTTGTACAGTCACCCCCAATACAGTGTTTCTCCGCCCATTGTAGCTAAAGCGTCTCTCTCTACAGTGAA
GCTGGGTCTTCGTTGCCGTCGGCAGTCTTGGAGAAGGAGTAAGTTCGACCGCGCGCCGAGGCATGACGCACCACT
GACGAGACCCTTAGGAAGCAACAAGCGACGGCGGGCGTATACTCGGGCAGTTTCACATGGTCCGAAGCTTTGGAC
ATTGCGGCGAGTATCTATCATGGGGTAAGAAAGAGCTCTCCCCTCTGGCGTCAGGGGTTTATTTGATTACCTACT
GACTCTTGGCAGTTCATCTTCTGGTCCATGTTGACCAGCCTGGGCCTTCTTGTCTGGTGTAAGTCGGTTCAACAT
CTATACTTACTCTTCCCAGGCTTACAAGTTCACAAGACTTTCCCCTTTGGCACATGGGGATATCCGGCTACGAGG
CGTTCGTACTGGTTTCCGCATCGCCGGCACTCCTGGTCGGCCCTATCCGATCATTGGTGGTCAATAACGTCCGGA
TCGTTCACCTGCTTTCACTCGTCGGCGTCGCCGCATATCTTGTCCCCGACCAAGCCAATCGTCTCCTGACCGTCG
GAGTCGGTGTCGCCCTATCCACCTTGGGCTGGGTTGCCACCCTACACTCAGAATCCGCTCACGAGAGACGGTTCG
AGTCGCGGCTTCTGGGATTGATGATCGGCCTGATTCTTTCGTCGACTGCCAAGTTTGCATGGCAGACAAACAATC
CCGTGTGGCCTATCTTGCACGATACCAACGGGGGCTGGAACGGAACGGGCCTCATCCTCGGAATCCTGGCAGCGT
TGCGCTTCACCCGTCACGCGCCCCTGACCGGCAGCCTCTCCCTCGGAGGCAAGCAGGGGGGCTCGACCGTGCTCG
CCGCCTGTGGCATCGGAGGGCTCTTCTTTGGCCTCCACTCGCTGCTGTCCGACACGAGCACCATGATCCTCTGGG
GCTGGGAAGGGTACCCCATCCGCGGCCCTTACTTCTCCACACACGGCTGGTGCACGGTGGCGGCAATGTCGGCCG
GTCTCGGAGCCGGCATTTGGAGACCCGCAGTGGCCGGAAGCTGGACGCAATACGCGGCGGGCGCTGTCGGAGCCC
TGGTTCTGACCAAGTTCAGCCACTGGCTCGGATACCTGGGCGGCCTCGGGATGGCCGTATATCTGATGGCCGTCT
CGGTCCCCCTGCTGTCGAGCGCGTGCAAGAAGAAGCCGGCGGTGACGTTTGGGCTGGGCTTCTTCATCTACGTCT
TCATGGTGCTGTTCCACGTCTGGGTCGTGGCCTATGCCTTTGTGCCCGGCGGGCCGCTCGTGCGCGAGCGTACGG
ACTGGATCATGATGACGATGATGGCCCTCATCGGCGCCGGCGTGGCCGACTACAAGGCCTCACAGCCGCGACGAC
CTCAGCCGCGGAGCCCTCGGGCGTCACAGCACCGCAAGTTGTACGGGGTGGCGACGCTGTTGGTCAACATCCTCT
TTCTCTGTGCCGCCTTCAAACGGTTCCCCAGGGCGGACCACAAGCCGTACCACGGCGAGGATCGGGTCTTGACGG
CCGGCATCTGGACGGTGCACTTCTCGCTCGACAACGACATGTGGTCGTCGGAGTATCGGATGCGCGACCTGATCA
AGGAGATGGAGCTGGACGTGGTAGGCCTTCTCGAGTCGGATCTACAGCGCATCATCATGGGCAACCGTGATACGA
CGCAGTTCCTGGCCGAGGATCTCGGCATGTATGTCGACTACGGGCCCGGGCCCAACAAGCACACTTGGGGCGCTG
CGCTGCTGTCCAAGTTCCCGATCGTCGAGTCCAAGCACCACCTGCTGCCGAGTCCGGTAGGAGAGCTGGCGCCGG
CGATTCACGCGACGCTTGACGTCTACGGTGAGCTGGTCGACGTCTTCGTCTTCCACTCGGGCCAAGAGGAGGACC
CGGAGGACCGGAGGCTGCAGAGCGAATATCTGAGCAAGCTGATGGGGTCGAGTCCGAGGCCGTCGATCCTGCTGA
GCTACCTGGTGACGAAGCCGCTCGAGGGCAACTACAAGACGTACGTCAGCGAGCAGTCAGGCATGCACGATATCG
ACTGGACCGACTGGGACCGATGGTGCGAGTACATCCTCTACAAGGGTCTCCGGCGCGTGGGCTACGCTCGCGTCA
GCCGCAGTACCATTACCGACACGGAGCTGCAGGTGGGCAAGTTTGTCGTCCCCCGCTCAGCCGCGGAGATGACGC
AGCTGGAGGCGCGGCCGGCCGAGGAGCGGGACCGGCGAGTGAAGGAGTCGGAGGTGCCCGAAGGGTGGAGGTTCC
CGGCGCTGTTCCGGGGAGCCGGCGTGCGGGATCACCGGTATCATGTCTTTGATGAGCCGAGGTATTTCAACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail