Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4023
Gene name
LocationContig_366:15760..17068
Strand+
Gene length (bp)1308
Transcript length (bp)1308
Coding sequence length (bp)1308
Protein length (aa) 436

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13516 LRR_6 Leucine Rich repeat 1.0E+00 240 259
PF13516 LRR_6 Leucine Rich repeat 2.0E-02 295 317

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P41391|RNA1_SCHPO Ran GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rna1 PE=1 SV=1 8 435 5.0E-72
sp|P11745|RNA1_YEAST Ran GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA1 PE=1 SV=2 5 348 4.0E-65
sp|O13066|RAGP1_XENLA Ran GTPase-activating protein 1 OS=Xenopus laevis GN=rangap1 PE=2 SV=1 5 352 2.0E-45
sp|P46060|RAGP1_HUMAN Ran GTPase-activating protein 1 OS=Homo sapiens GN=RANGAP1 PE=1 SV=1 8 352 3.0E-43
sp|P46061|RAGP1_MOUSE Ran GTPase-activating protein 1 OS=Mus musculus GN=Rangap1 PE=1 SV=2 8 352 1.0E-42
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P41391|RNA1_SCHPO Ran GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rna1 PE=1 SV=1 8 435 5.0E-72
sp|P11745|RNA1_YEAST Ran GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNA1 PE=1 SV=2 5 348 4.0E-65
sp|O13066|RAGP1_XENLA Ran GTPase-activating protein 1 OS=Xenopus laevis GN=rangap1 PE=2 SV=1 5 352 2.0E-45
sp|P46060|RAGP1_HUMAN Ran GTPase-activating protein 1 OS=Homo sapiens GN=RANGAP1 PE=1 SV=1 8 352 3.0E-43
sp|P46061|RAGP1_MOUSE Ran GTPase-activating protein 1 OS=Mus musculus GN=Rangap1 PE=1 SV=2 8 352 1.0E-42
sp|Q9VIW3|RAGP1_DROME Ran GTPase-activating protein OS=Drosophila melanogaster GN=RanGAP PE=1 SV=1 3 350 5.0E-41
sp|P34342|RGP2_CAEEL Ran GTPase-activating protein 2 OS=Caenorhabditis elegans GN=ran-2 PE=4 SV=3 5 346 2.0E-34
sp|P34342|RGP2_CAEEL Ran GTPase-activating protein 2 OS=Caenorhabditis elegans GN=ran-2 PE=4 SV=3 7 309 2.0E-30
sp|Q9LE82|RAGP1_ARATH RAN GTPase-activating protein 1 OS=Arabidopsis thaliana GN=RANGAP1 PE=1 SV=1 37 344 5.0E-13
sp|P29315|RINI_RAT Ribonuclease inhibitor OS=Rattus norvegicus GN=Rnh1 PE=1 SV=2 134 352 6.0E-07
sp|Q9M651|RAGP2_ARATH RAN GTPase-activating protein 2 OS=Arabidopsis thaliana GN=RANGAP2 PE=1 SV=2 70 309 1.0E-06
sp|Q7RTR2|NLRC3_HUMAN Protein NLRC3 OS=Homo sapiens GN=NLRC3 PE=2 SV=2 135 308 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4023
MAGTDKVFSIEGRGLKLDTAADLEPHVAQLRAHDVEEVRLLGNTLGVEACKLLGEILATKKNLKVCLYLPGYYDL
ADVCKVANLADIFTGRLLSEIPDALSSLLTSILNLPHLHTINLNDNAFGLNTQAPLVAFLASHVPLQHLHLNNNG
LGPHAGILIADALSELHASKEAARKEGKDVPDLKTIICGRNRLENGSMTAWAKTFSLHNKIEEVKMVQNGIRQEG
ISHLLSQGLNHASELRILDLQDNTFTLMGAKALAKVTPTWTLLSELGIGDSLLGARGGVLLSEALALGKNDKLET
LRLQYNDITAVGLRGFAAAAKDALPALKRIELNGNKFSEDDGSIRALQELLEERKEALANDDTDEADWGVDSLSD
LESEDSDEEEEDEEDEEDIGPEEKAEKLVKEAEEAQAEPVVQVKDAEVEELAKKLAKTNV*
Coding >Ophun1|4023
ATGGCAGGCACTGACAAGGTCTTCTCTATCGAGGGCAGAGGCCTGAAGCTCGACACGGCCGCGGATCTCGAGCCT
CACGTCGCCCAACTCAGGGCTCACGATGTCGAAGAAGTCCGGCTCTTGGGGAACACGCTTGGCGTTGAGGCCTGC
AAGCTTCTAGGAGAGATTTTGGCTACCAAGAAGAACCTCAAGGTTTGCCTCTACTTGCCTGGCTATTATGACCTC
GCTGACGTCTGCAAGGTTGCCAACCTCGCCGACATCTTCACCGGCCGACTCCTGTCAGAGATTCCCGACGCTCTT
TCTTCCCTCCTCACATCCATTCTCAACCTGCCCCATCTTCACACTATCAATCTCAACGACAACGCTTTCGGTCTC
AACACGCAGGCGCCCTTGGTTGCCTTCCTCGCCTCTCACGTTCCGCTACAGCATCTTCATCTCAACAACAACGGC
CTCGGTCCCCACGCCGGTATCCTCATTGCCGACGCTCTGTCCGAGCTTCACGCCAGCAAGGAAGCTGCTCGGAAG
GAGGGCAAGGACGTCCCTGACCTCAAGACGATTATATGCGGTAGAAACAGGCTCGAGAATGGCAGCATGACGGCT
TGGGCCAAGACGTTTAGCCTGCACAACAAAATTGAAGAGGTCAAGATGGTCCAGAACGGCATCCGCCAGGAGGGC
ATCTCTCATCTCCTCAGCCAGGGTCTGAATCACGCCAGCGAGCTGAGGATTCTCGACCTACAGGACAACACGTTT
ACTCTCATGGGAGCCAAGGCTCTTGCCAAGGTGACGCCGACCTGGACGTTACTTTCGGAGCTCGGCATTGGCGAT
TCTCTGCTCGGCGCTCGGGGCGGCGTGCTGCTTTCCGAGGCTCTCGCCCTCGGCAAGAACGACAAGCTCGAGACG
CTGCGCCTGCAGTACAATGACATTACAGCCGTCGGCCTCAGGGGCTTTGCCGCTGCCGCCAAAGACGCCCTGCCG
GCACTGAAGCGTATCGAGCTGAACGGCAACAAGTTCTCCGAGGACGATGGCTCGATTCGCGCCCTACAGGAGCTA
CTCGAGGAGCGCAAGGAAGCACTTGCCAACGATGACACAGACGAGGCCGACTGGGGCGTTGATAGCCTGAGCGAT
CTAGAGAGCGAGGACAGCGACGAGGAAGAGGAGGATGAAGAAGACGAAGAGGATATTGGCCCCGAGGAGAAGGCC
GAGAAGCTCGTGAAGGAGGCCGAGGAGGCGCAGGCGGAACCGGTTGTCCAGGTCAAGGACGCCGAAGTAGAGGAA
CTGGCCAAGAAGCTGGCCAAGACGAACGTTTGA
Transcript >Ophun1|4023
ATGGCAGGCACTGACAAGGTCTTCTCTATCGAGGGCAGAGGCCTGAAGCTCGACACGGCCGCGGATCTCGAGCCT
CACGTCGCCCAACTCAGGGCTCACGATGTCGAAGAAGTCCGGCTCTTGGGGAACACGCTTGGCGTTGAGGCCTGC
AAGCTTCTAGGAGAGATTTTGGCTACCAAGAAGAACCTCAAGGTTTGCCTCTACTTGCCTGGCTATTATGACCTC
GCTGACGTCTGCAAGGTTGCCAACCTCGCCGACATCTTCACCGGCCGACTCCTGTCAGAGATTCCCGACGCTCTT
TCTTCCCTCCTCACATCCATTCTCAACCTGCCCCATCTTCACACTATCAATCTCAACGACAACGCTTTCGGTCTC
AACACGCAGGCGCCCTTGGTTGCCTTCCTCGCCTCTCACGTTCCGCTACAGCATCTTCATCTCAACAACAACGGC
CTCGGTCCCCACGCCGGTATCCTCATTGCCGACGCTCTGTCCGAGCTTCACGCCAGCAAGGAAGCTGCTCGGAAG
GAGGGCAAGGACGTCCCTGACCTCAAGACGATTATATGCGGTAGAAACAGGCTCGAGAATGGCAGCATGACGGCT
TGGGCCAAGACGTTTAGCCTGCACAACAAAATTGAAGAGGTCAAGATGGTCCAGAACGGCATCCGCCAGGAGGGC
ATCTCTCATCTCCTCAGCCAGGGTCTGAATCACGCCAGCGAGCTGAGGATTCTCGACCTACAGGACAACACGTTT
ACTCTCATGGGAGCCAAGGCTCTTGCCAAGGTGACGCCGACCTGGACGTTACTTTCGGAGCTCGGCATTGGCGAT
TCTCTGCTCGGCGCTCGGGGCGGCGTGCTGCTTTCCGAGGCTCTCGCCCTCGGCAAGAACGACAAGCTCGAGACG
CTGCGCCTGCAGTACAATGACATTACAGCCGTCGGCCTCAGGGGCTTTGCCGCTGCCGCCAAAGACGCCCTGCCG
GCACTGAAGCGTATCGAGCTGAACGGCAACAAGTTCTCCGAGGACGATGGCTCGATTCGCGCCCTACAGGAGCTA
CTCGAGGAGCGCAAGGAAGCACTTGCCAACGATGACACAGACGAGGCCGACTGGGGCGTTGATAGCCTGAGCGAT
CTAGAGAGCGAGGACAGCGACGAGGAAGAGGAGGATGAAGAAGACGAAGAGGATATTGGCCCCGAGGAGAAGGCC
GAGAAGCTCGTGAAGGAGGCCGAGGAGGCGCAGGCGGAACCGGTTGTCCAGGTCAAGGACGCCGAAGTAGAGGAA
CTGGCCAAGAAGCTGGCCAAGACGAACGTTTGA
Gene >Ophun1|4023
ATGGCAGGCACTGACAAGGTCTTCTCTATCGAGGGCAGAGGCCTGAAGCTCGACACGGCCGCGGATCTCGAGCCT
CACGTCGCCCAACTCAGGGCTCACGATGTCGAAGAAGTCCGGCTCTTGGGGAACACGCTTGGCGTTGAGGCCTGC
AAGCTTCTAGGAGAGATTTTGGCTACCAAGAAGAACCTCAAGGTTTGCCTCTACTTGCCTGGCTATTATGACCTC
GCTGACGTCTGCAAGGTTGCCAACCTCGCCGACATCTTCACCGGCCGACTCCTGTCAGAGATTCCCGACGCTCTT
TCTTCCCTCCTCACATCCATTCTCAACCTGCCCCATCTTCACACTATCAATCTCAACGACAACGCTTTCGGTCTC
AACACGCAGGCGCCCTTGGTTGCCTTCCTCGCCTCTCACGTTCCGCTACAGCATCTTCATCTCAACAACAACGGC
CTCGGTCCCCACGCCGGTATCCTCATTGCCGACGCTCTGTCCGAGCTTCACGCCAGCAAGGAAGCTGCTCGGAAG
GAGGGCAAGGACGTCCCTGACCTCAAGACGATTATATGCGGTAGAAACAGGCTCGAGAATGGCAGCATGACGGCT
TGGGCCAAGACGTTTAGCCTGCACAACAAAATTGAAGAGGTCAAGATGGTCCAGAACGGCATCCGCCAGGAGGGC
ATCTCTCATCTCCTCAGCCAGGGTCTGAATCACGCCAGCGAGCTGAGGATTCTCGACCTACAGGACAACACGTTT
ACTCTCATGGGAGCCAAGGCTCTTGCCAAGGTGACGCCGACCTGGACGTTACTTTCGGAGCTCGGCATTGGCGAT
TCTCTGCTCGGCGCTCGGGGCGGCGTGCTGCTTTCCGAGGCTCTCGCCCTCGGCAAGAACGACAAGCTCGAGACG
CTGCGCCTGCAGTACAATGACATTACAGCCGTCGGCCTCAGGGGCTTTGCCGCTGCCGCCAAAGACGCCCTGCCG
GCACTGAAGCGTATCGAGCTGAACGGCAACAAGTTCTCCGAGGACGATGGCTCGATTCGCGCCCTACAGGAGCTA
CTCGAGGAGCGCAAGGAAGCACTTGCCAACGATGACACAGACGAGGCCGACTGGGGCGTTGATAGCCTGAGCGAT
CTAGAGAGCGAGGACAGCGACGAGGAAGAGGAGGATGAAGAAGACGAAGAGGATATTGGCCCCGAGGAGAAGGCC
GAGAAGCTCGTGAAGGAGGCCGAGGAGGCGCAGGCGGAACCGGTTGTCCAGGTCAAGGACGCCGAAGTAGAGGAA
CTGGCCAAGAAGCTGGCCAAGACGAACGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail