Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|402
Gene name
LocationContig_111:17063..20670
Strand-
Gene length (bp)3607
Transcript length (bp)3501
Coding sequence length (bp)3501
Protein length (aa) 1167

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04821 TIMELESS Timeless protein 6.5E-87 30 302

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S2A9|TOF1_NEUCR Topoisomerase 1-associated factor 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tof-1 PE=3 SV=1 1 990 0.0E+00
sp|Q2HBI0|TOF1_CHAGB Topoisomerase 1-associated factor 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TOF1 PE=3 SV=1 4 1012 0.0E+00
sp|Q2PIU8|TOF1_ASPOR Topoisomerase 1-associated factor 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tof1 PE=3 SV=1 5 1166 0.0E+00
sp|A1C928|TOF1_ASPCL Topoisomerase 1-associated factor 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tof1 PE=3 SV=1 5 1166 0.0E+00
sp|A1D9I5|TOF1_NEOFI Topoisomerase 1-associated factor 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tof1 PE=3 SV=1 5 1019 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7S2A9|TOF1_NEUCR Topoisomerase 1-associated factor 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=tof-1 PE=3 SV=1 1 990 0.0E+00
sp|Q2HBI0|TOF1_CHAGB Topoisomerase 1-associated factor 1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=TOF1 PE=3 SV=1 4 1012 0.0E+00
sp|Q2PIU8|TOF1_ASPOR Topoisomerase 1-associated factor 1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tof1 PE=3 SV=1 5 1166 0.0E+00
sp|A1C928|TOF1_ASPCL Topoisomerase 1-associated factor 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=tof1 PE=3 SV=1 5 1166 0.0E+00
sp|A1D9I5|TOF1_NEOFI Topoisomerase 1-associated factor 1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=tof1 PE=3 SV=1 5 1019 0.0E+00
sp|Q0UJF3|TOF1_PHANO Topoisomerase 1-associated factor 1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=TOF1 PE=3 SV=1 3 1166 0.0E+00
sp|Q4W9M7|TOF1_ASPFU Topoisomerase 1-associated factor 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tof1 PE=3 SV=2 5 1099 0.0E+00
sp|Q1DM35|TOF1_COCIM Topoisomerase 1-associated factor 1 OS=Coccidioides immitis (strain RS) GN=TOF1 PE=3 SV=1 4 1147 0.0E+00
sp|Q5AXH3|TOF1_EMENI Topoisomerase 1-associated factor 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tof1 PE=3 SV=2 4 1166 0.0E+00
sp|A2R2E3|TOF1_ASPNC Topoisomerase 1-associated factor 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=tof1 PE=3 SV=2 5 1166 0.0E+00
sp|Q0CU99|TOF1_ASPTN Topoisomerase 1-associated factor 1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=tof1 PE=3 SV=1 4 1166 0.0E+00
sp|A4R4R3|TOF1_MAGO7 Topoisomerase 1-associated factor 1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=TOF1 PE=3 SV=1 4 1166 0.0E+00
sp|Q9UUM2|SWI1_SCHPO Mating-type switching protein swi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swi1 PE=1 SV=1 14 995 1.0E-122
sp|Q6CFJ2|TOF1_YARLI Topoisomerase 1-associated factor 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TOF1 PE=3 SV=1 10 906 2.0E-106
sp|A5DJ85|TOF1_PICGU Topoisomerase 1-associated factor 1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=TOF1 PE=3 SV=2 10 1013 4.0E-89
sp|Q59NW5|TOF1_CANAL Topoisomerase 1-associated factor 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TOF1 PE=3 SV=1 10 908 2.0E-79
sp|A3LR41|TOF1_PICST Topoisomerase 1-associated factor 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=TOF1 PE=3 SV=2 10 1085 3.0E-79
sp|Q6BPI8|TOF1_DEBHA Topoisomerase 1-associated factor 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TOF1 PE=3 SV=2 10 913 5.0E-79
sp|P53840|TOF1_YEAST Topoisomerase 1-associated factor 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOF1 PE=1 SV=1 10 784 3.0E-77
sp|Q6FNX7|TOF1_CANGA Topoisomerase 1-associated factor 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TOF1 PE=3 SV=1 10 748 9.0E-77
sp|A5E2H7|TOF1_LODEL Topoisomerase 1-associated factor 1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=TOF1 PE=3 SV=2 10 720 2.0E-71
sp|Q752A3|TOF1_ASHGO Topoisomerase 1-associated factor 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TOF1 PE=3 SV=2 10 844 9.0E-64
sp|Q6CUU2|TOF1_KLULA Topoisomerase 1-associated factor 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TOF1 PE=3 SV=1 3 845 3.0E-63
sp|P0CR92|TOF1_CRYNJ Topoisomerase 1-associated factor 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TOF1 PE=3 SV=1 14 874 2.0E-55
sp|P0CR93|TOF1_CRYNB Topoisomerase 1-associated factor 1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TOF1 PE=3 SV=1 14 874 5.0E-52
sp|Q4PAB2|TOF1_USTMA Topoisomerase 1-associated factor 1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=TOF1 PE=3 SV=1 37 861 1.0E-40
sp|Q9UNS1|TIM_HUMAN Protein timeless homolog OS=Homo sapiens GN=TIMELESS PE=1 SV=2 18 551 9.0E-19
sp|Q9R1X4|TIM_MOUSE Protein timeless homolog OS=Mus musculus GN=Timeless PE=1 SV=3 18 551 1.0E-16
sp|Q9Z2Y1|TIM_RAT Protein timeless homolog OS=Rattus norvegicus GN=Timeless PE=1 SV=1 18 551 8.0E-16
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1129
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6481
Ophiocordyceps australis map64 (Brazil) OphauB2|3580
Ophiocordyceps camponoti-floridani Ophcf2|00603
Ophiocordyceps camponoti-rufipedis Ophun1|402 (this protein)
Ophiocordyceps kimflemingae Ophio5|8203
Ophiocordyceps subramaniannii Hirsu2|10189

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|402
MEEDTVHPEVRAHIDSLASALGGISTDDEEYQLGDDALEVLRDIKRWIRFYDDKTSRMDVARCLREANIVEGDLL
PILALWREKAADNKMRARLALACLEILVPLTWPIERDKERMTVNHYRHMPVLQLAQLQYKKAILSFDAAQILHTA
VRIAVPSIALPIGDRTPRDQGTIKLVLFFLRNIAMITSSGSKNKEDVDGEVSQISRSSTLDAFSQQGVFLFLLTI
SSGMGEEYRTEDTTVMEILYHLVKGVDVDQLFMHDKQLNNAKAKELAVLMEKESKMLNTHGRKGHARHSRFGTMI
WVTRQDNKMSSLSGQDVLLNKTARNQKIDNDKVFRPPRRSKKAIADEQDLAPPTKLNTRARTQLREFVQDFLDSG
FNKLFQHVRRSMEREASHIMQYHRRQFFYLVSWFLQAERARRLGNGKPASGEVDSFSLVAGVLNHEMFIKLNGAL
HESYEMKDWQELTAVMRCFTQILLTVQQMACCGREDDEEVAENLLNRIFYQESTYDVIVNIAKSYKDQGFDFLDA
ATELVHYFIRILEAYSKQNVDLQIRSRQRARRKNQAQDQQQGDDGSADDETAAQKTCKERKFDFQRFSSKFTTQG
VADTYVAFTKFYADLNDEQLKRAHRYFHRVAFKQQMSVMLFRLDIIHLFYNMIMGPEPMSKSSKMFGEWKELVKH
LLRKCFKKMNQRPQLLTELLFSKIQATALFLETGHEVQTVTAKRPPKPGAELEFRYTEERDRQIAIVVGALLERN
EADHINWLKGVITDAQSERRSWEAAQEAITEPVEDEQPAEAAEPKRPPLINVRHDSPARRTAMFKNSHLRLLMTV
SGLRRIGPASEETVESCWIIPEDVTAQHLADTLHYINQAEFSPPTFEDDASAVSQLRRKPAPRKKAVYDDDQDET
ATDNDESLFPIGGPTTRKAIDKPPRKIRRRRRRRKDNASEPDDSAVDEARRKRSEREREKARRIKSALYVREGDD
DFNSEEDEAFFARERAIADRARMAAESATTGVMKKPEQRKRKADADDDDDGDDAVRADSDEETPRKKHKSDTGSR
LATSEDEDEDEVEDEDEDDEDVKDDSSSTPGTKRKSPPSTQGNSAPSKKHKPKHTLPLTDDEADSSDIKNMLPRQ
SAPERTGAKGNASDDDDDDEAIVSRRRLRVRGGFVISSDEE*
Coding >Ophun1|402
ATGGAGGAGGACACCGTTCATCCTGAAGTCCGGGCGCACATCGACAGCCTCGCTTCTGCGCTTGGTGGCATTAGC
ACCGACGATGAGGAATACCAGCTTGGCGATGACGCCCTCGAGGTTCTGCGAGACATCAAGCGTTGGATCCGCTTC
TACGATGACAAAACGAGCCGCATGGACGTTGCGCGATGTCTCCGCGAAGCAAACATCGTCGAGGGCGACCTGCTC
CCCATCCTCGCCCTGTGGCGTGAGAAGGCCGCGGACAACAAGATGAGAGCGCGCTTGGCACTGGCCTGCTTGGAG
ATACTGGTCCCTTTAACGTGGCCTATCGAACGGGACAAGGAGCGCATGACCGTCAACCACTATCGACACATGCCT
GTTCTCCAACTGGCTCAGCTCCAGTACAAGAAGGCCATTTTGAGCTTTGATGCTGCTCAAATACTTCATACGGCT
GTACGCATCGCAGTGCCATCGATCGCGCTTCCCATCGGGGACAGGACTCCTCGGGACCAGGGAACCATCAAGCTC
GTCTTGTTCTTCCTCCGCAACATAGCTATGATAACTTCTTCCGGCAGTAAGAACAAGGAGGATGTCGATGGCGAA
GTATCACAAATCTCGAGAAGCTCGACACTGGACGCATTCTCACAACAGGGCGTGTTCCTCTTTCTACTCACAATC
TCGTCCGGCATGGGGGAAGAATACAGGACCGAAGACACGACCGTCATGGAAATCCTTTACCACTTAGTCAAAGGC
GTCGACGTTGACCAACTGTTCATGCACGATAAGCAGCTCAACAATGCCAAGGCGAAAGAACTCGCAGTTCTCATG
GAAAAAGAGTCCAAGATGCTCAACACCCACGGTCGCAAAGGCCACGCAAGGCACAGTCGATTCGGCACCATGATC
TGGGTGACGCGCCAAGACAACAAGATGTCATCTCTCTCGGGCCAGGACGTTCTCTTGAACAAGACAGCGCGCAAC
CAGAAGATAGACAACGACAAAGTCTTCCGACCACCCCGTCGATCCAAGAAGGCCATAGCCGACGAACAAGATCTA
GCCCCCCCAACCAAACTCAACACGCGGGCACGGACTCAGTTGCGGGAATTCGTCCAAGACTTCCTCGACTCCGGC
TTCAACAAACTGTTCCAGCACGTCCGCAGGTCCATGGAGCGGGAGGCAAGCCACATCATGCAGTACCACCGACGA
CAGTTCTTCTACCTCGTCTCCTGGTTCCTACAAGCCGAGCGCGCCAGACGGCTGGGAAACGGCAAGCCGGCCAGC
GGTGAGGTCGATAGCTTCAGCCTGGTTGCCGGCGTCCTGAACCACGAGATGTTCATCAAGCTCAACGGGGCGCTC
CACGAGTCGTACGAGATGAAGGACTGGCAGGAACTGACGGCCGTTATGCGCTGCTTCACGCAGATCCTCCTCACG
GTGCAGCAAATGGCCTGTTGCGGACGCGAAGATGACGAGGAAGTAGCGGAAAACCTCCTGAACCGAATCTTCTAT
CAGGAATCGACATACGACGTCATCGTCAACATCGCAAAATCCTACAAAGACCAAGGCTTCGACTTCCTCGACGCC
GCAACCGAACTCGTCCATTACTTCATCCGCATCCTCGAAGCCTACTCCAAGCAAAACGTCGACCTGCAGATCCGC
TCGCGACAACGCGCCAGGCGCAAGAACCAAGCCCAAGATCAACAACAAGGCGACGACGGCTCAGCCGACGACGAG
ACGGCGGCTCAGAAGACTTGCAAGGAGCGCAAGTTCGACTTCCAGAGGTTCTCGTCCAAGTTTACGACGCAGGGA
GTCGCCGATACCTACGTTGCCTTTACCAAGTTTTACGCAGACCTCAACGACGAGCAGCTCAAGAGAGCGCACCGA
TACTTCCACCGCGTCGCCTTCAAGCAGCAAATGAGCGTCATGCTCTTCCGCCTTGATATAATCCATCTCTTCTAC
AACATGATCATGGGACCCGAGCCCATGAGCAAGTCATCCAAGATGTTTGGCGAATGGAAAGAGCTCGTCAAGCAT
CTTCTTCGCAAATGCTTCAAGAAGATGAACCAGAGGCCACAGCTGCTGACGGAGCTACTCTTCAGCAAGATCCAA
GCAACCGCCCTCTTCCTCGAGACCGGCCACGAGGTGCAGACGGTGACGGCCAAGCGACCGCCCAAGCCCGGTGCC
GAGCTGGAGTTTCGATATACCGAGGAGAGGGATCGACAGATTGCCATTGTGGTGGGCGCCTTGTTGGAACGGAAC
GAGGCTGATCACATCAACTGGTTGAAGGGCGTCATAACCGACGCCCAGAGCGAGCGCCGATCCTGGGAGGCAGCT
CAGGAAGCGATAACAGAGCCCGTTGAGGACGAACAGCCGGCCGAAGCCGCAGAGCCGAAAAGGCCTCCTTTGATC
AATGTTCGGCATGACAGCCCAGCCCGACGCACCGCCATGTTCAAGAACTCCCATCTCCGCCTCCTCATGACCGTC
AGCGGCCTGCGACGCATCGGACCAGCATCGGAAGAAACGGTCGAGTCCTGCTGGATCATCCCCGAAGACGTAACG
GCCCAACACCTCGCAGACACACTCCACTACATCAACCAAGCCGAATTCAGTCCCCCGACCTTCGAAGACGATGCC
TCAGCCGTGAGCCAGCTCCGACGCAAACCCGCCCCCCGCAAGAAAGCCGTCTACGACGACGACCAAGATGAAACG
GCAACCGACAACGACGAATCGCTCTTCCCCATAGGCGGCCCGACGACACGCAAAGCCATAGACAAACCTCCCCGT
AAGATCCGCCGCCGCCGCCGCCGCCGCAAAGATAACGCCTCGGAGCCCGACGACTCAGCGGTAGACGAGGCGCGT
CGCAAACGAAGCGAGCGCGAACGTGAAAAGGCAAGACGCATCAAGTCGGCCCTGTACGTCCGCGAAGGCGACGAC
GACTTCAACTCGGAAGAGGACGAGGCCTTTTTCGCGCGCGAGCGTGCCATTGCCGATCGGGCCAGGATGGCGGCT
GAGTCGGCGACGACGGGGGTGATGAAGAAGCCTGAGCAGCGGAAGCGGAAGGCTGATGCTGACGACGATGATGAT
GGTGATGATGCTGTGCGTGCGGACAGCGATGAAGAAACGCCCAGGAAGAAGCACAAGTCGGATACTGGGTCTCGT
CTCGCAACAAGTGAAGACGAAGACGAAGACGAGGTTGAAGATGAAGATGAAGACGATGAAGACGTCAAAGACGAC
TCCTCTTCAACACCTGGAACAAAACGCAAATCCCCCCCCTCAACCCAAGGAAACTCAGCCCCCTCCAAGAAACAC
AAACCCAAGCACACACTCCCACTCACCGACGACGAAGCTGACAGCAGCGACATCAAAAACATGCTGCCCCGTCAA
AGCGCCCCTGAGCGAACAGGGGCCAAGGGAAACGCCAGCGACGACGATGACGACGATGAAGCCATCGTCAGTCGG
CGACGGCTCAGGGTCCGAGGCGGCTTCGTCATCTCGTCTGATGAGGAGTAA
Transcript >Ophun1|402
ATGGAGGAGGACACCGTTCATCCTGAAGTCCGGGCGCACATCGACAGCCTCGCTTCTGCGCTTGGTGGCATTAGC
ACCGACGATGAGGAATACCAGCTTGGCGATGACGCCCTCGAGGTTCTGCGAGACATCAAGCGTTGGATCCGCTTC
TACGATGACAAAACGAGCCGCATGGACGTTGCGCGATGTCTCCGCGAAGCAAACATCGTCGAGGGCGACCTGCTC
CCCATCCTCGCCCTGTGGCGTGAGAAGGCCGCGGACAACAAGATGAGAGCGCGCTTGGCACTGGCCTGCTTGGAG
ATACTGGTCCCTTTAACGTGGCCTATCGAACGGGACAAGGAGCGCATGACCGTCAACCACTATCGACACATGCCT
GTTCTCCAACTGGCTCAGCTCCAGTACAAGAAGGCCATTTTGAGCTTTGATGCTGCTCAAATACTTCATACGGCT
GTACGCATCGCAGTGCCATCGATCGCGCTTCCCATCGGGGACAGGACTCCTCGGGACCAGGGAACCATCAAGCTC
GTCTTGTTCTTCCTCCGCAACATAGCTATGATAACTTCTTCCGGCAGTAAGAACAAGGAGGATGTCGATGGCGAA
GTATCACAAATCTCGAGAAGCTCGACACTGGACGCATTCTCACAACAGGGCGTGTTCCTCTTTCTACTCACAATC
TCGTCCGGCATGGGGGAAGAATACAGGACCGAAGACACGACCGTCATGGAAATCCTTTACCACTTAGTCAAAGGC
GTCGACGTTGACCAACTGTTCATGCACGATAAGCAGCTCAACAATGCCAAGGCGAAAGAACTCGCAGTTCTCATG
GAAAAAGAGTCCAAGATGCTCAACACCCACGGTCGCAAAGGCCACGCAAGGCACAGTCGATTCGGCACCATGATC
TGGGTGACGCGCCAAGACAACAAGATGTCATCTCTCTCGGGCCAGGACGTTCTCTTGAACAAGACAGCGCGCAAC
CAGAAGATAGACAACGACAAAGTCTTCCGACCACCCCGTCGATCCAAGAAGGCCATAGCCGACGAACAAGATCTA
GCCCCCCCAACCAAACTCAACACGCGGGCACGGACTCAGTTGCGGGAATTCGTCCAAGACTTCCTCGACTCCGGC
TTCAACAAACTGTTCCAGCACGTCCGCAGGTCCATGGAGCGGGAGGCAAGCCACATCATGCAGTACCACCGACGA
CAGTTCTTCTACCTCGTCTCCTGGTTCCTACAAGCCGAGCGCGCCAGACGGCTGGGAAACGGCAAGCCGGCCAGC
GGTGAGGTCGATAGCTTCAGCCTGGTTGCCGGCGTCCTGAACCACGAGATGTTCATCAAGCTCAACGGGGCGCTC
CACGAGTCGTACGAGATGAAGGACTGGCAGGAACTGACGGCCGTTATGCGCTGCTTCACGCAGATCCTCCTCACG
GTGCAGCAAATGGCCTGTTGCGGACGCGAAGATGACGAGGAAGTAGCGGAAAACCTCCTGAACCGAATCTTCTAT
CAGGAATCGACATACGACGTCATCGTCAACATCGCAAAATCCTACAAAGACCAAGGCTTCGACTTCCTCGACGCC
GCAACCGAACTCGTCCATTACTTCATCCGCATCCTCGAAGCCTACTCCAAGCAAAACGTCGACCTGCAGATCCGC
TCGCGACAACGCGCCAGGCGCAAGAACCAAGCCCAAGATCAACAACAAGGCGACGACGGCTCAGCCGACGACGAG
ACGGCGGCTCAGAAGACTTGCAAGGAGCGCAAGTTCGACTTCCAGAGGTTCTCGTCCAAGTTTACGACGCAGGGA
GTCGCCGATACCTACGTTGCCTTTACCAAGTTTTACGCAGACCTCAACGACGAGCAGCTCAAGAGAGCGCACCGA
TACTTCCACCGCGTCGCCTTCAAGCAGCAAATGAGCGTCATGCTCTTCCGCCTTGATATAATCCATCTCTTCTAC
AACATGATCATGGGACCCGAGCCCATGAGCAAGTCATCCAAGATGTTTGGCGAATGGAAAGAGCTCGTCAAGCAT
CTTCTTCGCAAATGCTTCAAGAAGATGAACCAGAGGCCACAGCTGCTGACGGAGCTACTCTTCAGCAAGATCCAA
GCAACCGCCCTCTTCCTCGAGACCGGCCACGAGGTGCAGACGGTGACGGCCAAGCGACCGCCCAAGCCCGGTGCC
GAGCTGGAGTTTCGATATACCGAGGAGAGGGATCGACAGATTGCCATTGTGGTGGGCGCCTTGTTGGAACGGAAC
GAGGCTGATCACATCAACTGGTTGAAGGGCGTCATAACCGACGCCCAGAGCGAGCGCCGATCCTGGGAGGCAGCT
CAGGAAGCGATAACAGAGCCCGTTGAGGACGAACAGCCGGCCGAAGCCGCAGAGCCGAAAAGGCCTCCTTTGATC
AATGTTCGGCATGACAGCCCAGCCCGACGCACCGCCATGTTCAAGAACTCCCATCTCCGCCTCCTCATGACCGTC
AGCGGCCTGCGACGCATCGGACCAGCATCGGAAGAAACGGTCGAGTCCTGCTGGATCATCCCCGAAGACGTAACG
GCCCAACACCTCGCAGACACACTCCACTACATCAACCAAGCCGAATTCAGTCCCCCGACCTTCGAAGACGATGCC
TCAGCCGTGAGCCAGCTCCGACGCAAACCCGCCCCCCGCAAGAAAGCCGTCTACGACGACGACCAAGATGAAACG
GCAACCGACAACGACGAATCGCTCTTCCCCATAGGCGGCCCGACGACACGCAAAGCCATAGACAAACCTCCCCGT
AAGATCCGCCGCCGCCGCCGCCGCCGCAAAGATAACGCCTCGGAGCCCGACGACTCAGCGGTAGACGAGGCGCGT
CGCAAACGAAGCGAGCGCGAACGTGAAAAGGCAAGACGCATCAAGTCGGCCCTGTACGTCCGCGAAGGCGACGAC
GACTTCAACTCGGAAGAGGACGAGGCCTTTTTCGCGCGCGAGCGTGCCATTGCCGATCGGGCCAGGATGGCGGCT
GAGTCGGCGACGACGGGGGTGATGAAGAAGCCTGAGCAGCGGAAGCGGAAGGCTGATGCTGACGACGATGATGAT
GGTGATGATGCTGTGCGTGCGGACAGCGATGAAGAAACGCCCAGGAAGAAGCACAAGTCGGATACTGGGTCTCGT
CTCGCAACAAGTGAAGACGAAGACGAAGACGAGGTTGAAGATGAAGATGAAGACGATGAAGACGTCAAAGACGAC
TCCTCTTCAACACCTGGAACAAAACGCAAATCCCCCCCCTCAACCCAAGGAAACTCAGCCCCCTCCAAGAAACAC
AAACCCAAGCACACACTCCCACTCACCGACGACGAAGCTGACAGCAGCGACATCAAAAACATGCTGCCCCGTCAA
AGCGCCCCTGAGCGAACAGGGGCCAAGGGAAACGCCAGCGACGACGATGACGACGATGAAGCCATCGTCAGTCGG
CGACGGCTCAGGGTCCGAGGCGGCTTCGTCATCTCGTCTGATGAGGAGTAA
Gene >Ophun1|402
ATGGAGGAGGACACCGTTCATCCTGAAGTCCGGGCGCACATCGACAGCCTCGCTTCTGCGGTAAGCGTATTGTTC
CTGTCTGCCTGCCTCCGTCTGCTAAACCACGTTCTTGCCAGCTTGGTGGCATTAGCACCGACGATGAGGAATACC
AGCTTGGCGATGACGCCCTCGAGGTTCTGCGAGACATCAAGCGTTGGATCCGCTTCTACGATGACAAAACGAGCC
GCATGGACGTTGCGCGATGTCTCCGCGAAGCAAACATCGTCGAGGGCGACCTGCTCCCCATCCTCGCCCTGTGGC
GTGAGAAGGCCGCGGACAACAAGATGAGAGCGCGCTTGGCACTGGCCTGCTTGGAGATACTGGTCCCTTTAACGT
GGCCTATCGAACGGGACAAGGAGCGCATGACCGTCAACCACTATCGACACATGCCTGTTCTCCAACTGGCTCAGC
TCCAGTACAAGAAGGCCATTTTGAGCTTTGATGCTGCTCAAATACTTCATACGGCTGTACGCATCGCAGTGCCAT
CGATCGCGCTTCCCATCGGGGACAGGACTCCTCGGGACCAGGGAACCATCAAGCTCGTCTTGTTCTTCCTCCGCA
ACATAGCTATGATAACTTCTTCCGGCAGTAAGAACAAGGAGGATGTCGATGGCGAAGTATCACAAATCTCGAGAA
GCTCGACACTGGACGCATTCTCACAACAGGGCGTGTTCCTCTTTCTACTCACAATCTCGTCCGGCATGGGGGAAG
AATACAGGACCGAAGACACGACCGTCATGGAAATCCTTTACCACTTAGTCAAAGGCGTCGACGTTGACCAACTGT
TCATGCACGATAAGCAGCTCAACAATGCCAAGGCGAAAGAACTCGCAGTTCTCATGGAAAAAGAGTCCAAGATGC
TCAACACCCACGGTCGCAAAGGCCACGCAAGGCACAGTCGATTCGGCACCATGATCTGGGTGACGCGCCAAGACA
ACAAGATGTCATCTCTCTCGGGCCAGGACGTTCTCTTGAACAAGACAGCGCGCAACCAGAAGATAGACAACGACA
AAGTCTTCCGACCACCCCGTCGATCCAAGAAGGCCATAGCCGACGAACAAGATCTAGCCCCCCCAACCAAACTCA
ACACGCGGGCACGGACTCAGTTGCGGGAATTCGTCCAAGACTTCCTCGACTCCGGCTTCAACAAACTGTTCCAGC
ACGTCCGCAGGTCCATGGAGCGGGAGGCAAGCCACATCATGCAGTACCACCGACGACAGTTCTTCTACCTCGTCT
CCTGGTTCCTACAAGCCGAGCGCGCCAGACGGCTGGGAAACGGCAAGCCGGCCAGCGGTGAGGTCGATAGCTTCA
GCCTGGTTGCCGGCGTCCTGAACCACGAGATGTTCATCAAGCTCAACGGGGCGCTCCACGAGTCGTACGAGATGA
AGGACTGGCAGGAACTGACGGCCGTTATGCGCTGCTTCACGCAGATCCTCCTCACGGTGCAGCAAATGGCCTGTT
GCGGACGCGAAGATGACGAGGAAGTAGCGGAAAACCTCCTGAACCGAATCTTCTATCAGGAATCGACATACGACG
TCATCGTCAACATCGCAAAATCCTACAAAGACCAAGGCTTCGACTTCCTCGACGCCGCAACCGAACTCGTCCATT
ACTTCATCCGCATCCTCGAAGCCTACTCCAAGCAAAACGTCGACCTGCAGATCCGCTCGCGACAACGCGCCAGGC
GCAAGAACCAAGCCCAAGATCAACAACAAGGCGACGACGGCTCAGCCGACGACGAGACGGCGGCTCAGAAGACTT
GCAAGGAGCGCAAGTTCGACTTCCAGAGGTTCTCGTCCAAGTTTACGACGCAGGGAGTCGCCGATACCTACGTTG
CCTTTACCAAGTTTTACGCAGACCTCAACGACGAGCAGCTCAAGAGAGCGCACCGATACTTCCACCGCGTCGCCT
TCAAGCAGCAAATGAGCGTCATGCTCTTCCGCCTTGATATAATCCATCTCTTCTACAACATGATCATGGGACCCG
AGCCCATGAGCAAGTCATCCAAGATGTTTGGCGAATGGAAAGAGCTCGTCAAGCATCTTCTTCGCAAATGCTTCA
AGAAGATGAACCAGAGGCCACAGCTGCTGACGGAGCTACTCTTCAGCAAGATCCAAGCAACCGCCCTCTTCCTCG
AGACCGGCCACGAGGTGCAGACGGTGACGGCCAAGCGACCGCCCAAGCCCGGTGCCGAGCTGGAGTTTCGATATA
CCGAGGAGAGGGATCGACAGATTGCCATTGTGGTGGGCGCCTTGTTGGAACGGAACGAGGCTGATCACATCAACT
GGTTGAAGGGCGTCATAACCGACGCCCAGAGCGAGCGCCGATCCTGGGAGGCAGCTCAGGAAGCGATAACAGAGC
CCGTTGAGGACGAACAGCCGGCCGAAGCCGCAGAGCCGAAAAGGCCTCCTTTGATCAGTGAGCTTCATCCATCTC
CCCCTTTCCCTCATCACAGCTGACAAGAGCAGATGTTCGGCATGACAGCCCAGCCCGACGCACCGCCATGTTCAA
GAACTCCCATCTCCGCCTCCTCATGACCGTCAGCGGCCTGCGACGCATCGGACCAGCATCGGAAGAAACGGTCGA
GTCCTGCTGGATCATCCCCGAAGACGTAACGGCCCAACACCTCGCAGACACACTCCACTACATCAACCAAGCCGA
ATTCAGTCCCCCGACCTTCGAAGACGATGCCTCAGCCGTGAGCCAGCTCCGACGCAAACCCGCCCCCCGCAAGAA
AGCCGTCTACGACGACGACCAAGATGAAACGGCAACCGACAACGACGAATCGCTCTTCCCCATAGGCGGCCCGAC
GACACGCAAAGCCATAGACAAACCTCCCCGTAAGATCCGCCGCCGCCGCCGCCGCCGCAAAGATAACGCCTCGGA
GCCCGACGACTCAGCGGTAGACGAGGCGCGTCGCAAACGAAGCGAGCGCGAACGTGAAAAGGCAAGACGCATCAA
GTCGGCCCTGTACGTCCGCGAAGGCGACGACGACTTCAACTCGGAAGAGGACGAGGCCTTTTTCGCGCGCGAGCG
TGCCATTGCCGATCGGGCCAGGATGGCGGCTGAGTCGGCGACGACGGGGGTGATGAAGAAGCCTGAGCAGCGGAA
GCGGAAGGCTGATGCTGACGACGATGATGATGGTGATGATGCTGTGCGTGCGGACAGCGATGAAGAAACGCCCAG
GAAGAAGCACAAGTCGGATACTGGGTCTCGTCTCGCAACAAGTGAAGACGAAGACGAAGACGAGGTTGAAGATGA
AGATGAAGACGATGAAGACGTCAAAGACGACTCCTCTTCAACACCTGGAACAAAACGCAAATCCCCCCCCTCAAC
CCAAGGAAACTCAGCCCCCTCCAAGAAACACAAACCCAAGCACACACTCCCACTCACCGACGACGAAGCTGACAG
CAGCGACATCAAAAACATGCTGCCCCGTCAAAGCGCCCCTGAGCGAACAGGGGCCAAGGGAAACGCCAGCGACGA
CGATGACGACGATGAAGCCATCGTCAGTCGGCGACGGCTCAGGGTCCGAGGCGGCTTCGTCATCTCGTCTGATGA
GGAGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail