Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4016
Gene name
LocationContig_366:5158..5584
Strand-
Gene length (bp)426
Transcript length (bp)426
Coding sequence length (bp)426
Protein length (aa) 142

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00011 HSP20 Hsp20/alpha crystallin family 9.4E-08 28 140

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14368|HSP16_SCHPO Heat shock protein 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hsp16 PE=1 SV=1 10 134 3.0E-08
sp|Q4UKR8|HSPC2_RICFE Small heat shock protein C2 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=hspC2 PE=3 SV=1 7 140 7.0E-08
sp|Q12329|HSP42_YEAST Heat shock protein 42 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP42 PE=1 SV=1 21 141 2.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6836
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4318
Ophiocordyceps camponoti-floridani Ophcf2|00362
Ophiocordyceps camponoti-rufipedis Ophun1|4016 (this protein)
Ophiocordyceps kimflemingae Ophio5|2905

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4016
MRNILNNPFFQPPRNNDASSFTPPIDVFSNPSAFTIHVALPGASKSDIGLDWDPQRSSLRIAGVVHRPGDEAFVA
TLVSSERAVGVFDRQVPLPPRGTGAADEGVVVDDAAITARMEHGILVVVVPKVAKERAEVRRVVID*
Coding >Ophun1|4016
ATGCGCAACATCCTCAACAACCCCTTCTTCCAACCCCCCCGCAACAACGACGCCTCATCCTTCACCCCCCCCATC
GACGTCTTCAGCAACCCCTCGGCCTTCACCATCCACGTCGCCCTCCCCGGCGCCAGCAAGTCCGACATCGGCCTC
GACTGGGATCCGCAGCGGTCCAGCCTGCGCATCGCTGGCGTCGTCCACCGTCCCGGCGACGAGGCTTTTGTCGCC
ACCCTCGTGTCTTCTGAGCGGGCTGTCGGTGTCTTTGATCGTCAGGTGCCGTTGCCGCCGAGGGGGACTGGGGCT
GCGGACGAGGGTGTCGTTGTTGACGATGCTGCCATTACGGCTAGGATGGAGCATGGCATCTTGGTCGTTGTTGTG
CCCAAGGTTGCCAAGGAGAGGGCCGAGGTTCGACGGGTCGTCATCGATTAA
Transcript >Ophun1|4016
ATGCGCAACATCCTCAACAACCCCTTCTTCCAACCCCCCCGCAACAACGACGCCTCATCCTTCACCCCCCCCATC
GACGTCTTCAGCAACCCCTCGGCCTTCACCATCCACGTCGCCCTCCCCGGCGCCAGCAAGTCCGACATCGGCCTC
GACTGGGATCCGCAGCGGTCCAGCCTGCGCATCGCTGGCGTCGTCCACCGTCCCGGCGACGAGGCTTTTGTCGCC
ACCCTCGTGTCTTCTGAGCGGGCTGTCGGTGTCTTTGATCGTCAGGTGCCGTTGCCGCCGAGGGGGACTGGGGCT
GCGGACGAGGGTGTCGTTGTTGACGATGCTGCCATTACGGCTAGGATGGAGCATGGCATCTTGGTCGTTGTTGTG
CCCAAGGTTGCCAAGGAGAGGGCCGAGGTTCGACGGGTCGTCATCGATTAA
Gene >Ophun1|4016
ATGCGCAACATCCTCAACAACCCCTTCTTCCAACCCCCCCGCAACAACGACGCCTCATCCTTCACCCCCCCCATC
GACGTCTTCAGCAACCCCTCGGCCTTCACCATCCACGTCGCCCTCCCCGGCGCCAGCAAGTCCGACATCGGCCTC
GACTGGGATCCGCAGCGGTCCAGCCTGCGCATCGCTGGCGTCGTCCACCGTCCCGGCGACGAGGCTTTTGTCGCC
ACCCTCGTGTCTTCTGAGCGGGCTGTCGGTGTCTTTGATCGTCAGGTGCCGTTGCCGCCGAGGGGGACTGGGGCT
GCGGACGAGGGTGTCGTTGTTGACGATGCTGCCATTACGGCTAGGATGGAGCATGGCATCTTGGTCGTTGTTGTG
CCCAAGGTTGCCAAGGAGAGGGCCGAGGTTCGACGGGTCGTCATCGATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail