Protein ID | Ophun1|4011 |
Gene name | |
Location | Contig_364:15078..17895 |
Strand | + |
Gene length (bp) | 2817 |
Transcript length (bp) | 2817 |
Coding sequence length (bp) | 2817 |
Protein length (aa) | 939 |
PFAM Domain ID | Short name | Long name | E-value | Start | End |
---|---|---|---|---|---|
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 1.9E-11 | 58 | 140 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 4.8E-10 | 146 | 202 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 1.8E-09 | 265 | 354 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 7.4E-07 | 403 | 479 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 5.9E-07 | 450 | 509 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 2.5E-14 | 486 | 579 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 1.1E-11 | 583 | 645 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 3.1E-13 | 653 | 745 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 5.0E-10 | 773 | 855 |
PF12796 | Ank_2 | Ankyrin repeats (3 copies) | 1.3E-06 | 857 | 915 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 3.2E-07 | 149 | 202 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 3.8E-05 | 300 | 351 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 1.3E-07 | 452 | 502 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 8.4E-09 | 518 | 569 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 1.6E-06 | 617 | 671 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 2.7E-08 | 686 | 739 |
PF13637 | Ank_4 | Ankyrin repeats (many copies) | 1.7E-06 | 826 | 878 |
PF13606 | Ank_3 | Ankyrin repeat | 1.5E-03 | 78 | 99 |
PF13606 | Ank_3 | Ankyrin repeat | 1.0E-03 | 148 | 175 |
PF13606 | Ank_3 | Ankyrin repeat | 4.2E-03 | 518 | 544 |
PF13606 | Ank_3 | Ankyrin repeat | 5.4E-03 | 719 | 745 |
PF00023 | Ank | Ankyrin repeat | 3.1E-02 | 78 | 99 |
PF00023 | Ank | Ankyrin repeat | 1.8E-03 | 148 | 171 |
PF00023 | Ank | Ankyrin repeat | 2.4E-03 | 300 | 329 |
PF00023 | Ank | Ankyrin repeat | 9.3E-03 | 482 | 507 |
PF00023 | Ank | Ankyrin repeat | 6.9E-04 | 585 | 613 |
PF00023 | Ank | Ankyrin repeat | 6.8E-03 | 617 | 644 |
PF00023 | Ank | Ankyrin repeat | 1.4E-02 | 858 | 885 |
PF13857 | Ank_5 | Ankyrin repeats (many copies) | 1.3E-07 | 811 | 865 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 301 | 920 | 4.0E-59 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 148 | 919 | 2.0E-58 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 148 | 919 | 6.0E-58 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 148 | 919 | 2.0E-57 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 149 | 920 | 2.0E-56 |
Swissprot ID | Swissprot Description | Start | End | E-value |
---|---|---|---|---|
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 301 | 920 | 4.0E-59 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 148 | 919 | 2.0E-58 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 148 | 919 | 6.0E-58 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 148 | 919 | 2.0E-57 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 149 | 920 | 2.0E-56 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 66 | 844 | 2.0E-55 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 66 | 844 | 5.0E-54 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 73 | 877 | 3.0E-52 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 267 | 915 | 4.0E-52 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 414 | 915 | 2.0E-51 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 287 | 915 | 3.0E-50 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 66 | 877 | 4.0E-50 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 148 | 933 | 8.0E-50 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 66 | 844 | 1.0E-48 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 66 | 844 | 3.0E-48 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 436 | 915 | 2.0E-45 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 66 | 915 | 3.0E-45 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 418 | 919 | 7.0E-44 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 66 | 936 | 9.0E-44 |
sp|Q12955|ANK3_HUMAN | Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 | 436 | 915 | 1.0E-43 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 71 | 653 | 2.0E-43 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 432 | 915 | 2.0E-43 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 46 | 915 | 3.0E-43 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 66 | 915 | 4.0E-43 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 453 | 915 | 6.0E-43 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 414 | 926 | 2.0E-42 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 420 | 915 | 2.0E-42 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 46 | 915 | 5.0E-42 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 414 | 926 | 6.0E-42 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 66 | 915 | 1.0E-40 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 66 | 915 | 1.0E-40 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 66 | 878 | 2.0E-40 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 430 | 915 | 2.0E-40 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 75 | 923 | 8.0E-40 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 453 | 915 | 1.0E-39 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 415 | 928 | 2.0E-39 |
sp|O70511|ANK3_RAT | Ankyrin-3 OS=Rattus norvegicus GN=Ank3 PE=1 SV=3 | 436 | 915 | 3.0E-39 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 455 | 915 | 5.0E-39 |
sp|Q01484|ANK2_HUMAN | Ankyrin-2 OS=Homo sapiens GN=ANK2 PE=1 SV=4 | 59 | 653 | 8.0E-39 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 417 | 911 | 8.0E-39 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 418 | 865 | 1.0E-38 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 315 | 883 | 1.0E-38 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 74 | 835 | 2.0E-38 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 75 | 856 | 7.0E-38 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 418 | 865 | 9.0E-38 |
sp|Q8C8R3|ANK2_MOUSE | Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 | 59 | 653 | 1.0E-37 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 427 | 918 | 3.0E-37 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 292 | 919 | 5.0E-37 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 59 | 912 | 1.0E-36 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 70 | 911 | 4.0E-36 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 292 | 744 | 5.0E-36 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 435 | 911 | 1.0E-35 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 299 | 911 | 2.0E-35 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 277 | 895 | 2.0E-35 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 59 | 620 | 5.0E-35 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 512 | 915 | 6.0E-35 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 78 | 879 | 6.0E-35 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 514 | 915 | 1.0E-34 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 59 | 878 | 2.0E-34 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 519 | 914 | 2.0E-34 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 58 | 835 | 2.0E-34 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 292 | 911 | 4.0E-34 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 39 | 879 | 4.0E-34 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 330 | 865 | 5.0E-34 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 292 | 923 | 5.0E-34 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 292 | 919 | 5.0E-34 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 292 | 931 | 7.0E-34 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 444 | 877 | 9.0E-34 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 447 | 837 | 1.0E-33 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 75 | 744 | 1.0E-33 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 456 | 912 | 1.0E-33 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 85 | 895 | 4.0E-33 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 57 | 911 | 5.0E-33 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 85 | 895 | 5.0E-33 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 53 | 856 | 6.0E-33 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 59 | 654 | 6.0E-33 |
sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 365 | 892 | 8.0E-33 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 58 | 835 | 9.0E-33 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 330 | 912 | 2.0E-32 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 330 | 865 | 2.0E-32 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 292 | 849 | 2.0E-32 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 66 | 744 | 2.0E-32 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 382 | 865 | 3.0E-32 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 299 | 915 | 3.0E-32 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 299 | 915 | 4.0E-32 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 292 | 920 | 5.0E-32 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 37 | 911 | 5.0E-32 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 519 | 915 | 6.0E-32 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 292 | 911 | 6.0E-32 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 292 | 915 | 7.0E-32 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 519 | 915 | 7.0E-32 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 414 | 853 | 7.0E-32 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 585 | 915 | 8.0E-32 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 315 | 741 | 9.0E-32 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 480 | 898 | 1.0E-31 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 282 | 899 | 1.0E-31 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 292 | 920 | 2.0E-31 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 519 | 914 | 2.0E-31 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 59 | 844 | 4.0E-31 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 339 | 898 | 7.0E-31 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 419 | 915 | 9.0E-31 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 37 | 886 | 1.0E-30 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 262 | 712 | 1.0E-30 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 315 | 741 | 1.0E-30 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 59 | 844 | 2.0E-30 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 413 | 744 | 2.0E-30 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 585 | 915 | 2.0E-30 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 292 | 914 | 3.0E-30 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 419 | 915 | 3.0E-30 |
sp|Q02989|LITA_LATTR | Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 | 464 | 915 | 3.0E-30 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 521 | 911 | 5.0E-30 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 293 | 744 | 6.0E-30 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 456 | 912 | 6.0E-30 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 58 | 655 | 7.0E-30 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 416 | 915 | 1.0E-29 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 494 | 883 | 1.0E-29 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 456 | 912 | 1.0E-29 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 380 | 865 | 2.0E-29 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 380 | 865 | 3.0E-29 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 292 | 914 | 4.0E-29 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 292 | 914 | 4.0E-29 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 536 | 915 | 5.0E-29 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 469 | 919 | 5.0E-29 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 494 | 883 | 5.0E-29 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 521 | 911 | 6.0E-29 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 520 | 915 | 7.0E-29 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 486 | 883 | 8.0E-29 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 486 | 915 | 2.0E-28 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 105 | 919 | 2.0E-28 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 369 | 740 | 3.0E-28 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 532 | 934 | 4.0E-28 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 409 | 878 | 4.0E-28 |
sp|Q505D1|ANR28_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Mus musculus GN=Ankrd28 PE=1 SV=1 | 594 | 928 | 5.0E-28 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 435 | 873 | 7.0E-28 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 287 | 911 | 7.0E-28 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 435 | 901 | 8.0E-28 |
sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 292 | 922 | 8.0E-28 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 65 | 643 | 1.0E-27 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 446 | 874 | 1.0E-27 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 375 | 878 | 1.0E-27 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 518 | 880 | 2.0E-27 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 375 | 878 | 2.0E-27 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 383 | 837 | 2.0E-27 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 58 | 722 | 3.0E-27 |
sp|O15084|ANR28_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 | 594 | 928 | 3.0E-27 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 471 | 742 | 4.0E-27 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 533 | 929 | 5.0E-27 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 471 | 915 | 5.0E-27 |
sp|Q8N8A2|ANR44_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 | 58 | 688 | 6.0E-27 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 419 | 915 | 9.0E-27 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 53 | 603 | 9.0E-27 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 518 | 880 | 1.0E-26 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 418 | 655 | 1.0E-26 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 393 | 915 | 2.0E-26 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 418 | 655 | 2.0E-26 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 584 | 882 | 2.0E-26 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 299 | 662 | 3.0E-26 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 518 | 926 | 5.0E-26 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 502 | 879 | 8.0E-26 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 435 | 707 | 8.0E-26 |
sp|Q02989|LITA_LATTR | Alpha-latroinsectotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=1 SV=1 | 116 | 865 | 9.0E-26 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 523 | 915 | 1.0E-25 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 292 | 914 | 2.0E-25 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 523 | 915 | 2.0E-25 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 456 | 915 | 2.0E-25 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 134 | 603 | 2.0E-25 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 520 | 915 | 3.0E-25 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 372 | 882 | 3.0E-25 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 66 | 586 | 4.0E-25 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 455 | 744 | 4.0E-25 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 509 | 915 | 4.0E-25 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 343 | 868 | 5.0E-25 |
sp|Q9J4Z5|V245_FOWPN | Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 | 524 | 799 | 5.0E-25 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 523 | 915 | 6.0E-25 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 362 | 915 | 6.0E-25 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 518 | 880 | 7.0E-25 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 372 | 882 | 8.0E-25 |
sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 418 | 811 | 9.0E-25 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 582 | 928 | 1.0E-24 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 66 | 832 | 1.0E-24 |
sp|Q9J4Z5|V245_FOWPN | Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 | 431 | 743 | 1.0E-24 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 134 | 706 | 1.0E-24 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 468 | 915 | 1.0E-24 |
sp|Q1RK13|Y220_RICBR | Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 | 411 | 657 | 1.0E-24 |
sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 428 | 914 | 1.0E-24 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 465 | 837 | 2.0E-24 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 418 | 915 | 2.0E-24 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 524 | 915 | 3.0E-24 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 455 | 744 | 3.0E-24 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 53 | 603 | 3.0E-24 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 434 | 915 | 3.0E-24 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 468 | 915 | 5.0E-24 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 53 | 603 | 6.0E-24 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 409 | 915 | 2.0E-23 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 434 | 882 | 2.0E-23 |
sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 455 | 748 | 2.0E-23 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 301 | 628 | 3.0E-23 |
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 455 | 748 | 3.0E-23 |
sp|Q6RI86|TRPA1_RAT | Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 | 411 | 921 | 3.0E-23 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 431 | 914 | 4.0E-23 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 604 | 912 | 4.0E-23 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 292 | 706 | 4.0E-23 |
sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 565 | 883 | 4.0E-23 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 620 | 912 | 5.0E-23 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 53 | 603 | 5.0E-23 |
sp|Q8BLA8|TRPA1_MOUSE | Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 | 411 | 921 | 5.0E-23 |
sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 583 | 915 | 6.0E-23 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 435 | 915 | 6.0E-23 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 455 | 744 | 7.0E-23 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 524 | 915 | 7.0E-23 |
sp|Q5F478|ANR44_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 | 53 | 648 | 8.0E-23 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 274 | 654 | 8.0E-23 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 75 | 573 | 8.0E-23 |
sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 455 | 748 | 8.0E-23 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 67 | 693 | 1.0E-22 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 368 | 744 | 1.0E-22 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 575 | 907 | 2.0E-22 |
sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 301 | 728 | 2.0E-22 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 456 | 914 | 2.0E-22 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 74 | 573 | 2.0E-22 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 409 | 915 | 2.0E-22 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 522 | 878 | 2.0E-22 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 418 | 930 | 3.0E-22 |
sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 470 | 819 | 3.0E-22 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 30 | 655 | 4.0E-22 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 461 | 927 | 4.0E-22 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 292 | 914 | 7.0E-22 |
sp|Q810B6|ANFY1_MOUSE | Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 | 70 | 866 | 8.0E-22 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 23 | 655 | 1.0E-21 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 291 | 739 | 2.0E-21 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 422 | 739 | 2.0E-21 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 452 | 819 | 2.0E-21 |
sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 110 | 838 | 3.0E-21 |
sp|Q1RK13|Y220_RICBR | Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 | 544 | 877 | 4.0E-21 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 590 | 877 | 4.0E-21 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 392 | 707 | 5.0E-21 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 497 | 882 | 5.0E-21 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 395 | 704 | 5.0E-21 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 593 | 927 | 7.0E-21 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 392 | 707 | 7.0E-21 |
sp|Q810B6|ANFY1_MOUSE | Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 | 418 | 911 | 7.0E-21 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 294 | 636 | 7.0E-21 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 585 | 928 | 7.0E-21 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 59 | 582 | 8.0E-21 |
sp|Q9XZC0|LCTA_LATTR | Alpha-latrocrustotoxin-Lt1a (Fragment) OS=Latrodectus tredecimguttatus PE=2 SV=2 | 45 | 712 | 1.0E-20 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 75 | 573 | 1.0E-20 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 281 | 849 | 1.0E-20 |
sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 418 | 866 | 1.0E-20 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 418 | 739 | 1.0E-20 |
sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 453 | 860 | 1.0E-20 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 475 | 744 | 1.0E-20 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 551 | 919 | 2.0E-20 |
sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 599 | 911 | 2.0E-20 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 455 | 744 | 2.0E-20 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 291 | 739 | 3.0E-20 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 452 | 852 | 3.0E-20 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 452 | 819 | 3.0E-20 |
sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 303 | 845 | 3.0E-20 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 419 | 655 | 3.0E-20 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 483 | 883 | 4.0E-20 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 72 | 398 | 4.0E-20 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 72 | 398 | 4.0E-20 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 655 | 915 | 4.0E-20 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 486 | 883 | 5.0E-20 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 301 | 643 | 6.0E-20 |
sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 408 | 743 | 6.0E-20 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 483 | 883 | 9.0E-20 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 72 | 398 | 9.0E-20 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 486 | 883 | 1.0E-19 |
sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 369 | 918 | 1.0E-19 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 452 | 778 | 1.0E-19 |
sp|Q5UPJ9|YL122_MIMIV | Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 | 422 | 859 | 1.0E-19 |
sp|Q9J5A7|V155_FOWPN | Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 | 385 | 842 | 1.0E-19 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 393 | 707 | 2.0E-19 |
sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 484 | 898 | 2.0E-19 |
sp|Q68DC2|ANKS6_HUMAN | Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 | 517 | 860 | 2.0E-19 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 419 | 655 | 3.0E-19 |
sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 418 | 750 | 4.0E-19 |
sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 452 | 862 | 5.0E-19 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 287 | 849 | 5.0E-19 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 61 | 502 | 6.0E-19 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 301 | 643 | 6.0E-19 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 585 | 914 | 6.0E-19 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 607 | 919 | 7.0E-19 |
sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 631 | 915 | 8.0E-19 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 262 | 556 | 1.0E-18 |
sp|Q1RK13|Y220_RICBR | Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 | 284 | 607 | 1.0E-18 |
sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 417 | 712 | 1.0E-18 |
sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 631 | 915 | 1.0E-18 |
sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 418 | 678 | 1.0E-18 |
sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 420 | 655 | 2.0E-18 |
sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 595 | 936 | 2.0E-18 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 585 | 913 | 3.0E-18 |
sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 620 | 927 | 3.0E-18 |
sp|Q9J5I3|V018_FOWPN | Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 | 446 | 915 | 3.0E-18 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 484 | 799 | 4.0E-18 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 589 | 914 | 4.0E-18 |
sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 595 | 936 | 6.0E-18 |
sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 418 | 678 | 6.0E-18 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 306 | 577 | 7.0E-18 |
sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 431 | 744 | 7.0E-18 |
sp|Q7T163|KDIS_DANRE | Kinase D-interacting substrate of 220 kDa OS=Danio rerio GN=kidins220 PE=2 SV=2 | 250 | 603 | 1.0E-17 |
sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 186 | 682 | 1.0E-17 |
sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 595 | 936 | 1.0E-17 |
sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 439 | 643 | 1.0E-17 |
sp|Q96T49|PP16B_HUMAN | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 | 620 | 854 | 1.0E-17 |
sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 414 | 615 | 1.0E-17 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 78 | 521 | 2.0E-17 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 484 | 799 | 2.0E-17 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 305 | 636 | 2.0E-17 |
sp|Q14DN9|AKD1B_MOUSE | Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 | 418 | 708 | 2.0E-17 |
sp|Q502K3|ANR52_DANRE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 | 619 | 922 | 3.0E-17 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 541 | 877 | 3.0E-17 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 336 | 681 | 3.0E-17 |
sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 514 | 744 | 3.0E-17 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 331 | 678 | 3.0E-17 |
sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 517 | 921 | 3.0E-17 |
sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 296 | 586 | 3.0E-17 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 450 | 853 | 3.0E-17 |
sp|Q95N27|PP16B_BOVIN | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 | 620 | 854 | 3.0E-17 |
sp|Q8WXK1|ASB15_HUMAN | Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 | 418 | 717 | 3.0E-17 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 414 | 620 | 4.0E-17 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 418 | 882 | 4.0E-17 |
sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 414 | 615 | 4.0E-17 |
sp|Q68DC2|ANKS6_HUMAN | Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 | 418 | 738 | 5.0E-17 |
sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 669 | 928 | 6.0E-17 |
sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 456 | 889 | 6.0E-17 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 302 | 644 | 6.0E-17 |
sp|P97570|PLPL9_RAT | 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 | 403 | 652 | 6.0E-17 |
sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 713 | 914 | 6.0E-17 |
sp|Q5UP39|YR873_MIMIV | Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 | 486 | 922 | 6.0E-17 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 430 | 835 | 8.0E-17 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 635 | 922 | 8.0E-17 |
sp|Q5URB9|YR840_MIMIV | Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 | 453 | 915 | 8.0E-17 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 665 | 911 | 1.0E-16 |
sp|Q810B6|ANFY1_MOUSE | Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 | 518 | 921 | 1.0E-16 |
sp|Q14DN9|AKD1B_MOUSE | Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 | 631 | 914 | 1.0E-16 |
sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 386 | 673 | 1.0E-16 |
sp|A2AS55|ANR16_MOUSE | Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 | 573 | 881 | 1.0E-16 |
sp|Q499M5|ANR16_RAT | Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 | 414 | 660 | 1.0E-16 |
sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 668 | 915 | 1.0E-16 |
sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 418 | 708 | 1.0E-16 |
sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 417 | 658 | 1.0E-16 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 528 | 919 | 2.0E-16 |
sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 69 | 637 | 2.0E-16 |
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 514 | 744 | 2.0E-16 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 575 | 877 | 2.0E-16 |
sp|Q8VHQ3|PP16B_MOUSE | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 | 620 | 854 | 2.0E-16 |
sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 414 | 620 | 2.0E-16 |
sp|P59672|ANS1A_MOUSE | Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 | 439 | 643 | 2.0E-16 |
sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 578 | 884 | 3.0E-16 |
sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 462 | 635 | 3.0E-16 |
sp|Q9J517|V218_FOWPN | Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 | 453 | 744 | 3.0E-16 |
sp|Q96JP0|FEM1C_HUMAN | Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 | 484 | 704 | 3.0E-16 |
sp|A7MB89|FEM1C_BOVIN | Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 | 484 | 704 | 3.0E-16 |
sp|Q2T9K6|FEM1C_XENLA | Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 | 484 | 706 | 3.0E-16 |
sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 418 | 711 | 3.0E-16 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 549 | 915 | 4.0E-16 |
sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 377 | 738 | 4.0E-16 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 586 | 915 | 4.0E-16 |
sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 452 | 742 | 4.0E-16 |
sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 418 | 678 | 4.0E-16 |
sp|P97819|PLPL9_MOUSE | 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 | 403 | 652 | 4.0E-16 |
sp|Q8CEF1|FEM1C_MOUSE | Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 | 497 | 704 | 4.0E-16 |
sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 668 | 915 | 5.0E-16 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 472 | 653 | 5.0E-16 |
sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 668 | 915 | 5.0E-16 |
sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 668 | 915 | 5.0E-16 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 549 | 915 | 6.0E-16 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 526 | 855 | 6.0E-16 |
sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 410 | 727 | 6.0E-16 |
sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 410 | 727 | 6.0E-16 |
sp|Q5UPF8|YL088_MIMIV | Putative ankyrin repeat protein L88 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L88 PE=3 SV=1 | 292 | 691 | 7.0E-16 |
sp|A2AS55|ANR16_MOUSE | Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 | 414 | 660 | 7.0E-16 |
sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 418 | 654 | 7.0E-16 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 541 | 877 | 8.0E-16 |
sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 418 | 629 | 8.0E-16 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 301 | 611 | 1.0E-15 |
sp|Q6P6B7|ANR16_HUMAN | Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 | 582 | 881 | 1.0E-15 |
sp|Q6RI86|TRPA1_RAT | Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 | 278 | 760 | 2.0E-15 |
sp|Q6RI86|TRPA1_RAT | Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 | 496 | 911 | 2.0E-15 |
sp|Q810B6|ANFY1_MOUSE | Rabankyrin-5 OS=Mus musculus GN=Ankfy1 PE=1 SV=2 | 287 | 915 | 2.0E-15 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 650 | 913 | 2.0E-15 |
sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 494 | 882 | 2.0E-15 |
sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 260 | 603 | 2.0E-15 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 462 | 659 | 2.0E-15 |
sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 453 | 641 | 2.0E-15 |
sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 456 | 644 | 2.0E-15 |
sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 456 | 671 | 2.0E-15 |
sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 410 | 674 | 2.0E-15 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 52 | 398 | 3.0E-15 |
sp|A6NK59|ASB14_HUMAN | Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 | 418 | 678 | 3.0E-15 |
sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 410 | 674 | 3.0E-15 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 484 | 659 | 3.0E-15 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 37 | 571 | 4.0E-15 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 29 | 541 | 4.0E-15 |
sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 515 | 744 | 4.0E-15 |
sp|Q8BLA8|TRPA1_MOUSE | Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 | 277 | 760 | 4.0E-15 |
sp|Q8VHS6|ASB15_MOUSE | Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 | 418 | 678 | 4.0E-15 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 594 | 887 | 4.0E-15 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 303 | 746 | 4.0E-15 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 455 | 658 | 4.0E-15 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 37 | 571 | 5.0E-15 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 301 | 611 | 6.0E-15 |
sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 494 | 882 | 6.0E-15 |
sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 497 | 755 | 6.0E-15 |
sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 420 | 738 | 6.0E-15 |
sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 416 | 619 | 7.0E-15 |
sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 481 | 685 | 7.0E-15 |
sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 416 | 619 | 8.0E-15 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 418 | 654 | 8.0E-15 |
sp|Q1RHT6|Y997_RICBR | Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 | 384 | 656 | 8.0E-15 |
sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 486 | 710 | 8.0E-15 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 481 | 915 | 9.0E-15 |
sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 610 | 905 | 9.0E-15 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 645 | 915 | 1.0E-14 |
sp|Q9EQG6|KDIS_RAT | Kinase D-interacting substrate of 220 kDa OS=Rattus norvegicus GN=Kidins220 PE=1 SV=2 | 620 | 919 | 1.0E-14 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 59 | 398 | 1.0E-14 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 618 | 880 | 1.0E-14 |
sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 598 | 915 | 1.0E-14 |
sp|Q6P6B7|ANR16_HUMAN | Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 | 418 | 743 | 1.0E-14 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 789 | 923 | 1.0E-14 |
sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 418 | 676 | 1.0E-14 |
sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 456 | 635 | 1.0E-14 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 370 | 654 | 1.0E-14 |
sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 678 | 921 | 1.0E-14 |
sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 453 | 641 | 1.0E-14 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 442 | 654 | 1.0E-14 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 289 | 603 | 2.0E-14 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 289 | 571 | 2.0E-14 |
sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 530 | 899 | 2.0E-14 |
sp|Q14DN9|AKD1B_MOUSE | Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 | 523 | 934 | 2.0E-14 |
sp|Q499M5|ANR16_RAT | Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 | 578 | 881 | 2.0E-14 |
sp|Q2T9K6|FEM1C_XENLA | Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 | 687 | 918 | 2.0E-14 |
sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 473 | 819 | 2.0E-14 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 414 | 605 | 2.0E-14 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 587 | 914 | 2.0E-14 |
sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 482 | 893 | 2.0E-14 |
sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 442 | 744 | 2.0E-14 |
sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 484 | 682 | 2.0E-14 |
sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 417 | 658 | 2.0E-14 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 770 | 915 | 2.0E-14 |
sp|A6NGH8|ANR61_HUMAN | Ankyrin repeat domain-containing protein 61 OS=Homo sapiens GN=ANKRD61 PE=3 SV=2 | 450 | 655 | 2.0E-14 |
sp|O60733|PLPL9_HUMAN | 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 | 403 | 652 | 2.0E-14 |
sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 583 | 744 | 2.0E-14 |
sp|Q7T3P8|FEM1C_DANRE | Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 | 510 | 704 | 2.0E-14 |
sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 556 | 860 | 2.0E-14 |
sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 656 | 927 | 3.0E-14 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 301 | 644 | 3.0E-14 |
sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 277 | 735 | 3.0E-14 |
sp|A6NK59|ASB14_HUMAN | Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 | 460 | 904 | 3.0E-14 |
sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 506 | 923 | 3.0E-14 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 300 | 637 | 3.0E-14 |
sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 484 | 682 | 3.0E-14 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 432 | 746 | 3.0E-14 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 555 | 898 | 3.0E-14 |
sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 418 | 654 | 3.0E-14 |
sp|Q6P9Z4|FEM1A_DANRE | Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 | 515 | 707 | 3.0E-14 |
sp|O90760|V031_FOWPN | Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 | 411 | 571 | 3.0E-14 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 399 | 706 | 4.0E-14 |
sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 393 | 748 | 4.0E-14 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 789 | 923 | 4.0E-14 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 292 | 573 | 4.0E-14 |
sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 456 | 642 | 4.0E-14 |
sp|Q923M0|PP16A_MOUSE | Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 | 620 | 911 | 4.0E-14 |
sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 770 | 915 | 4.0E-14 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 418 | 654 | 4.0E-14 |
sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 456 | 657 | 4.0E-14 |
sp|Q07DW4|CTTB2_MUNRE | Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 | 483 | 704 | 4.0E-14 |
sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 444 | 704 | 4.0E-14 |
sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 770 | 915 | 4.0E-14 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 553 | 937 | 5.0E-14 |
sp|Q9VBP3|TNKS_DROME | Tankyrase OS=Drosophila melanogaster GN=Tnks PE=1 SV=1 | 620 | 933 | 5.0E-14 |
sp|Q8WXK1|ASB15_HUMAN | Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 | 456 | 819 | 5.0E-14 |
sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 385 | 713 | 5.0E-14 |
sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 405 | 727 | 5.0E-14 |
sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 405 | 704 | 5.0E-14 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 464 | 733 | 5.0E-14 |
sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 590 | 860 | 5.0E-14 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 53 | 571 | 6.0E-14 |
sp|Q5UPJ9|YL122_MIMIV | Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 | 460 | 924 | 6.0E-14 |
sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 774 | 914 | 6.0E-14 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 444 | 704 | 6.0E-14 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 70 | 490 | 7.0E-14 |
sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 265 | 570 | 7.0E-14 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 418 | 759 | 7.0E-14 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 770 | 915 | 7.0E-14 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 710 | 933 | 8.0E-14 |
sp|Q6P6B7|ANR16_HUMAN | Ankyrin repeat domain-containing protein 16 OS=Homo sapiens GN=ANKRD16 PE=1 SV=1 | 403 | 660 | 8.0E-14 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 300 | 637 | 8.0E-14 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 700 | 915 | 8.0E-14 |
sp|Q9J5H7|V024_FOWPN | Putative ankyrin repeat protein FPV024 OS=Fowlpox virus (strain NVSL) GN=FPV024 PE=3 SV=1 | 616 | 937 | 9.0E-14 |
sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 484 | 701 | 9.0E-14 |
sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 387 | 742 | 9.0E-14 |
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 303 | 576 | 1.0E-13 |
sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 561 | 924 | 1.0E-13 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 410 | 744 | 1.0E-13 |
sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 446 | 676 | 1.0E-13 |
sp|Q9J517|V218_FOWPN | Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 | 419 | 711 | 1.0E-13 |
sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 486 | 748 | 1.0E-13 |
sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 447 | 713 | 1.0E-13 |
sp|Q00PJ1|CTTB2_ATEAB | Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 | 444 | 704 | 1.0E-13 |
sp|Q6UB98|ANR12_HUMAN | Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 | 777 | 921 | 1.0E-13 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 620 | 919 | 2.0E-13 |
sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 587 | 931 | 2.0E-13 |
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 656 | 911 | 2.0E-13 |
sp|Q8BLA8|TRPA1_MOUSE | Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 | 105 | 649 | 2.0E-13 |
sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 303 | 576 | 2.0E-13 |
sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 452 | 745 | 2.0E-13 |
sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 456 | 642 | 2.0E-13 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 460 | 737 | 2.0E-13 |
sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 610 | 887 | 2.0E-13 |
sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 774 | 914 | 2.0E-13 |
sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 385 | 713 | 2.0E-13 |
sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 506 | 920 | 2.0E-13 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 789 | 923 | 2.0E-13 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 770 | 915 | 2.0E-13 |
sp|Q9Z2G0|FEM1B_MOUSE | Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 | 514 | 705 | 2.0E-13 |
sp|P0C6P7|FEM1B_RAT | Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 | 514 | 705 | 2.0E-13 |
sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 434 | 711 | 2.0E-13 |
sp|Q9J5G9|V034_FOWPN | Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 | 596 | 906 | 2.0E-13 |
sp|Q9UK73|FEM1B_HUMAN | Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 | 514 | 705 | 2.0E-13 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 770 | 915 | 2.0E-13 |
sp|Q09YJ3|CTTB2_MUNMU | Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 | 483 | 704 | 2.0E-13 |
sp|Q5ZM55|FEM1B_CHICK | Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 | 514 | 705 | 2.0E-13 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 76 | 520 | 3.0E-13 |
sp|G0LXV8|LATA_LATHA | Alpha-latrotoxin-Lh1a (Fragment) OS=Latrodectus hasseltii PE=1 SV=2 | 585 | 918 | 3.0E-13 |
sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 299 | 911 | 3.0E-13 |
sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 386 | 640 | 3.0E-13 |
sp|Q8VHS6|ASB15_MOUSE | Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 | 393 | 748 | 3.0E-13 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 514 | 867 | 3.0E-13 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 514 | 867 | 3.0E-13 |
sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 514 | 867 | 3.0E-13 |
sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 794 | 915 | 3.0E-13 |
sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 441 | 636 | 3.0E-13 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 770 | 915 | 3.0E-13 |
sp|Q641X1|ANR61_RAT | Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 | 450 | 749 | 3.0E-13 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 770 | 915 | 3.0E-13 |
sp|Q54F46|WARA_DICDI | Homeobox protein Wariai OS=Dictyostelium discoideum GN=warA PE=2 SV=1 | 293 | 573 | 4.0E-13 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 47 | 440 | 4.0E-13 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 773 | 919 | 4.0E-13 |
sp|Q14DN9|AKD1B_MOUSE | Ankyrin repeat and death domain-containing protein 1B OS=Mus musculus GN=Ankdd1b PE=2 SV=3 | 292 | 574 | 4.0E-13 |
sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 439 | 643 | 4.0E-13 |
sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 514 | 896 | 4.0E-13 |
sp|Q4V890|FEM1A_RAT | Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 | 516 | 709 | 4.0E-13 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 117 | 502 | 5.0E-13 |
sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 623 | 914 | 5.0E-13 |
sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 587 | 915 | 5.0E-13 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 414 | 590 | 5.0E-13 |
sp|Q4V890|FEM1A_RAT | Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 | 418 | 603 | 5.0E-13 |
sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 585 | 744 | 5.0E-13 |
sp|Q09YG9|CTTB2_SAIBB | Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 | 404 | 571 | 5.0E-13 |
sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 435 | 601 | 5.0E-13 |
sp|Q3SZE4|ASB11_BOVIN | Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 | 484 | 712 | 5.0E-13 |
sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 446 | 635 | 5.0E-13 |
sp|Q8HXA6|ASB15_BOVIN | Ankyrin repeat and SOCS box protein 15 OS=Bos taurus GN=ASB15 PE=2 SV=2 | 445 | 919 | 6.0E-13 |
sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 486 | 744 | 6.0E-13 |
sp|A7MB89|FEM1C_BOVIN | Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 | 687 | 918 | 6.0E-13 |
sp|Q29RM5|FEM1A_BOVIN | Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 | 481 | 712 | 6.0E-13 |
sp|O44997|DAPK_CAEEL | Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 | 438 | 731 | 6.0E-13 |
sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 456 | 642 | 7.0E-13 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 486 | 726 | 7.0E-13 |
sp|Q96JP0|FEM1C_HUMAN | Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 | 687 | 918 | 7.0E-13 |
sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 634 | 915 | 7.0E-13 |
sp|Q3V096|ANR42_MOUSE | Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 | 556 | 861 | 7.0E-13 |
sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 439 | 643 | 7.0E-13 |
sp|Q3UES3|TNKS2_MOUSE | Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 | 76 | 540 | 8.0E-13 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 666 | 910 | 8.0E-13 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 643 | 911 | 8.0E-13 |
sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 491 | 888 | 8.0E-13 |
sp|Q8CEF1|FEM1C_MOUSE | Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 | 687 | 918 | 8.0E-13 |
sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 439 | 643 | 8.0E-13 |
sp|P0C550|AKT1_ORYSI | Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 | 504 | 700 | 8.0E-13 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 133 | 507 | 9.0E-13 |
sp|Q9P2R3|ANFY1_HUMAN | Rabankyrin-5 OS=Homo sapiens GN=ANKFY1 PE=1 SV=2 | 287 | 883 | 9.0E-13 |
sp|Q9J569|V162_FOWPN | Putative ankyrin repeat protein FPV162 OS=Fowlpox virus (strain NVSL) GN=FPV162 PE=3 SV=1 | 292 | 653 | 9.0E-13 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 619 | 911 | 9.0E-13 |
sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 561 | 924 | 9.0E-13 |
sp|Q0JKV1|AKT1_ORYSJ | Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 | 504 | 700 | 9.0E-13 |
sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 439 | 643 | 9.0E-13 |
sp|Q9BSK4|FEM1A_HUMAN | Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 | 516 | 709 | 9.0E-13 |
sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 444 | 704 | 9.0E-13 |
sp|Q54KA7|SECG_DICDI | Ankyrin repeat, PH and SEC7 domain containing protein secG OS=Dictyostelium discoideum GN=secG PE=2 SV=1 | 758 | 911 | 1.0E-12 |
sp|P23631|LATA_LATTR | Alpha-latrotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=2 | 65 | 568 | 1.0E-12 |
sp|Q6RI86|TRPA1_RAT | Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 | 89 | 649 | 1.0E-12 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 303 | 541 | 1.0E-12 |
sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 74 | 604 | 1.0E-12 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 303 | 535 | 1.0E-12 |
sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 292 | 510 | 1.0E-12 |
sp|P97570|PLPL9_RAT | 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 | 455 | 697 | 1.0E-12 |
sp|P97819|PLPL9_MOUSE | 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 | 455 | 697 | 1.0E-12 |
sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 486 | 742 | 1.0E-12 |
sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 774 | 914 | 1.0E-12 |
sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 442 | 744 | 1.0E-12 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 716 | 911 | 1.0E-12 |
sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 475 | 638 | 1.0E-12 |
sp|Q29RM5|FEM1A_BOVIN | Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 | 418 | 603 | 1.0E-12 |
sp|Q6AWW5|Y5262_ARATH | Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 | 59 | 219 | 1.0E-12 |
sp|Q8C0T1|FM1AB_MOUSE | Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 | 518 | 709 | 1.0E-12 |
sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 587 | 756 | 1.0E-12 |
sp|Q6ZVZ8|ASB18_HUMAN | Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 | 713 | 915 | 1.0E-12 |
sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 587 | 756 | 1.0E-12 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 30 | 320 | 2.0E-12 |
sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 656 | 902 | 2.0E-12 |
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 692 | 919 | 2.0E-12 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 586 | 915 | 2.0E-12 |
sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 561 | 915 | 2.0E-12 |
sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 486 | 744 | 2.0E-12 |
sp|Q5URB9|YR840_MIMIV | Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 | 90 | 640 | 2.0E-12 |
sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 577 | 858 | 2.0E-12 |
sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 435 | 653 | 2.0E-12 |
sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 292 | 646 | 2.0E-12 |
sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 435 | 653 | 2.0E-12 |
sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 435 | 653 | 2.0E-12 |
sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 435 | 653 | 2.0E-12 |
sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 473 | 901 | 2.0E-12 |
sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 587 | 915 | 2.0E-12 |
sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 505 | 867 | 2.0E-12 |
sp|Q8VHS6|ASB15_MOUSE | Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 | 515 | 867 | 2.0E-12 |
sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 301 | 586 | 2.0E-12 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 514 | 867 | 2.0E-12 |
sp|Q9BSK4|FEM1A_HUMAN | Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 | 418 | 610 | 2.0E-12 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 292 | 738 | 2.0E-12 |
sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 590 | 860 | 2.0E-12 |
sp|Q9Z2G1|FM1AA_MOUSE | Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 | 518 | 709 | 2.0E-12 |
sp|Q5UQJ2|YR863_MIMIV | Putative ankyrin repeat protein R863 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L863 PE=3 SV=1 | 463 | 915 | 2.0E-12 |
sp|Q2IBD4|CTTB2_RAT | Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 | 444 | 652 | 2.0E-12 |
sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 587 | 759 | 2.0E-12 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 783 | 936 | 3.0E-12 |
sp|Q8BZ25|ANKK1_MOUSE | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 | 684 | 933 | 3.0E-12 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 29 | 541 | 3.0E-12 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 617 | 911 | 3.0E-12 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 666 | 910 | 3.0E-12 |
sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 486 | 726 | 3.0E-12 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 645 | 865 | 3.0E-12 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 585 | 914 | 3.0E-12 |
sp|Q9Z2G0|FEM1B_MOUSE | Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 | 373 | 604 | 3.0E-12 |
sp|P0C6P7|FEM1B_RAT | Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 | 373 | 604 | 3.0E-12 |
sp|Q9J5G9|V034_FOWPN | Putative ankyrin repeat protein FPV034 OS=Fowlpox virus (strain NVSL) GN=ANK2 PE=3 SV=1 | 418 | 673 | 3.0E-12 |
sp|Q9UK73|FEM1B_HUMAN | Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 | 373 | 604 | 3.0E-12 |
sp|Q6ZVZ8|ASB18_HUMAN | Ankyrin repeat and SOCS box protein 18 OS=Homo sapiens GN=ASB18 PE=2 SV=2 | 484 | 689 | 3.0E-12 |
sp|Q9Z2G1|FM1AA_MOUSE | Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 | 418 | 603 | 3.0E-12 |
sp|Q10311|YD58_SCHPO | Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 | 721 | 883 | 3.0E-12 |
sp|Q96I34|PP16A_HUMAN | Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 | 620 | 879 | 3.0E-12 |
sp|Q8VHK1|CSKI2_MOUSE | Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 | 473 | 678 | 3.0E-12 |
sp|Q2IBE6|CTTB2_PONAB | Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 | 404 | 571 | 3.0E-12 |
sp|Q8N2N9|AN36B_HUMAN | Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 | 567 | 744 | 3.0E-12 |
sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 692 | 919 | 4.0E-12 |
sp|Q5UPJ9|YL122_MIMIV | Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 | 632 | 927 | 4.0E-12 |
sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 523 | 711 | 4.0E-12 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 645 | 865 | 4.0E-12 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 420 | 744 | 4.0E-12 |
sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 637 | 928 | 4.0E-12 |
sp|Q8C0T1|FM1AB_MOUSE | Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 | 418 | 603 | 4.0E-12 |
sp|Q9J503|V232_FOWPN | Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 | 293 | 564 | 4.0E-12 |
sp|Q9J503|V232_FOWPN | Putative ankyrin repeat protein FPV232 OS=Fowlpox virus (strain NVSL) GN=FPV232 PE=3 SV=1 | 386 | 751 | 4.0E-12 |
sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 587 | 880 | 4.0E-12 |
sp|Q07DX4|CTTB2_NOMLE | Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 | 404 | 571 | 4.0E-12 |
sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 548 | 744 | 4.0E-12 |
sp|Q8WZ74|CTTB2_HUMAN | Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 | 404 | 571 | 4.0E-12 |
sp|B2RXR6|ANR44_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 | 668 | 922 | 5.0E-12 |
sp|Q9ULJ7|ANR50_HUMAN | Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 | 54 | 541 | 5.0E-12 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 47 | 541 | 5.0E-12 |
sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 484 | 744 | 5.0E-12 |
sp|Q5URB9|YR840_MIMIV | Putative ankyrin repeat protein R840 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R840 PE=3 SV=1 | 587 | 923 | 5.0E-12 |
sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 418 | 754 | 5.0E-12 |
sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 419 | 640 | 5.0E-12 |
sp|Q2IBF7|CTTB2_GORGO | Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 | 404 | 571 | 5.0E-12 |
sp|Q2QLF8|CTTB2_CALJA | Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 | 404 | 571 | 5.0E-12 |
sp|Q8BG95|MYPT2_MOUSE | Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 | 453 | 726 | 5.0E-12 |
sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 411 | 635 | 5.0E-12 |
sp|P14360|V240_FOWPN | Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 | 332 | 545 | 5.0E-12 |
sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 404 | 573 | 5.0E-12 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 617 | 911 | 6.0E-12 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 692 | 879 | 6.0E-12 |
sp|Q8VHS5|ASB16_MOUSE | Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 | 484 | 699 | 6.0E-12 |
sp|P98150|NFKB2_CHICK | Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 | 550 | 824 | 6.0E-12 |
sp|B9EJA2|CTTB2_MOUSE | Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 | 444 | 636 | 6.0E-12 |
sp|Q6DD51|CSKI2_XENLA | Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 | 473 | 678 | 6.0E-12 |
sp|Q09YJ3|CTTB2_MUNMU | Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 | 404 | 573 | 7.0E-12 |
sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 419 | 640 | 7.0E-12 |
sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 548 | 744 | 7.0E-12 |
sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 548 | 744 | 7.0E-12 |
sp|Q9TZC4|ILKH_CAEEL | Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 | 524 | 656 | 7.0E-12 |
sp|Q8IVF6|AN18A_HUMAN | Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 | 439 | 644 | 7.0E-12 |
sp|Q07E28|CTTB2_NEONE | Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 | 404 | 573 | 7.0E-12 |
sp|Q68DC2|ANKS6_HUMAN | Ankyrin repeat and SAM domain-containing protein 6 OS=Homo sapiens GN=ANKS6 PE=1 SV=2 | 582 | 893 | 8.0E-12 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 692 | 879 | 8.0E-12 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 121 | 684 | 8.0E-12 |
sp|Q00653|NFKB2_HUMAN | Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 | 446 | 653 | 8.0E-12 |
sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 431 | 586 | 8.0E-12 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 133 | 507 | 9.0E-12 |
sp|Q1RK13|Y220_RICBR | Putative ankyrin repeat protein RBE_0220 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0220 PE=3 SV=1 | 719 | 919 | 9.0E-12 |
sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 548 | 744 | 9.0E-12 |
sp|Q07E15|CTTB2_MUSPF | Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 | 444 | 670 | 9.0E-12 |
sp|Q2QL82|CTTB2_MICMU | Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 | 404 | 579 | 9.0E-12 |
sp|Q9H2K2|TNKS2_HUMAN | Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 | 620 | 920 | 1.0E-11 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 612 | 918 | 1.0E-11 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 787 | 923 | 1.0E-11 |
sp|Q91ZT7|ASB10_MOUSE | Ankyrin repeat and SOCS box protein 10 OS=Mus musculus GN=Asb10 PE=2 SV=1 | 584 | 841 | 1.0E-11 |
sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 150 | 502 | 1.0E-11 |
sp|Q9J517|V218_FOWPN | Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 | 617 | 895 | 1.0E-11 |
sp|Q59H18|TNI3K_HUMAN | Serine/threonine-protein kinase TNNI3K OS=Homo sapiens GN=TNNI3K PE=1 SV=3 | 265 | 535 | 1.0E-11 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 651 | 920 | 1.0E-11 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 667 | 901 | 1.0E-11 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 787 | 923 | 1.0E-11 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 483 | 711 | 1.0E-11 |
sp|Q5ZM55|FEM1B_CHICK | Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 | 373 | 603 | 1.0E-11 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 692 | 879 | 1.0E-11 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 692 | 879 | 1.0E-11 |
sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 404 | 573 | 1.0E-11 |
sp|Q2QLB3|CTTB2_CALMO | Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 1.0E-11 |
sp|A4D7T3|ASZ1_MACEU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 | 445 | 612 | 1.0E-11 |
sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 548 | 744 | 1.0E-11 |
sp|Q07DV1|CTTB2_AOTNA | Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 | 404 | 571 | 1.0E-11 |
sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 676 | 883 | 1.0E-11 |
sp|Q8R516|MIB2_MOUSE | E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 | 418 | 655 | 1.0E-11 |
sp|Q07DY4|CTTB2_COLGU | Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 1.0E-11 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 586 | 915 | 2.0E-11 |
sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 513 | 918 | 2.0E-11 |
sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 476 | 811 | 2.0E-11 |
sp|Q2T9K6|FEM1C_XENLA | Protein fem-1 homolog C OS=Xenopus laevis GN=fem1c PE=2 SV=1 | 418 | 604 | 2.0E-11 |
sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 265 | 539 | 2.0E-11 |
sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 667 | 901 | 2.0E-11 |
sp|A6NK59|ASB14_HUMAN | Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 | 569 | 915 | 2.0E-11 |
sp|Q8VHS6|ASB15_MOUSE | Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 | 586 | 930 | 2.0E-11 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 523 | 900 | 2.0E-11 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 259 | 574 | 2.0E-11 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 667 | 901 | 2.0E-11 |
sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 320 | 573 | 2.0E-11 |
sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 292 | 552 | 2.0E-11 |
sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 667 | 901 | 2.0E-11 |
sp|Q6P9Z4|FEM1A_DANRE | Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 | 689 | 918 | 2.0E-11 |
sp|Q6P9Z4|FEM1A_DANRE | Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 | 371 | 603 | 2.0E-11 |
sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 662 | 879 | 2.0E-11 |
sp|Q07DW4|CTTB2_MUNRE | Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 | 404 | 573 | 2.0E-11 |
sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 662 | 879 | 2.0E-11 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 692 | 879 | 2.0E-11 |
sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 716 | 883 | 2.0E-11 |
sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 491 | 744 | 2.0E-11 |
sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 491 | 744 | 2.0E-11 |
sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 774 | 921 | 2.0E-11 |
sp|Q8IVF6|AN18A_HUMAN | Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 | 583 | 743 | 2.0E-11 |
sp|Q2QL82|CTTB2_MICMU | Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 | 506 | 714 | 2.0E-11 |
sp|Q2QLB3|CTTB2_CALMO | Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 | 404 | 571 | 2.0E-11 |
sp|A0M8S4|CTTB2_PAPAN | Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 2.0E-11 |
sp|A1X154|ASZ1_ECHTE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 | 437 | 619 | 2.0E-11 |
sp|Q2IBA2|CTTB2_CHLAE | Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 2.0E-11 |
sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 676 | 883 | 2.0E-11 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 585 | 744 | 2.0E-11 |
sp|Q108T9|CTTB2_LOXAF | Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 | 506 | 713 | 2.0E-11 |
sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 415 | 586 | 2.0E-11 |
sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 2.0E-11 |
sp|Q9J5I7|V014_FOWPN | Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 | 454 | 734 | 2.0E-11 |
sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 334 | 759 | 2.0E-11 |
sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 438 | 579 | 2.0E-11 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 774 | 917 | 2.0E-11 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 619 | 922 | 3.0E-11 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 117 | 507 | 3.0E-11 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 481 | 911 | 3.0E-11 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 794 | 920 | 3.0E-11 |
sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 590 | 799 | 3.0E-11 |
sp|Q9J4Z6|V244_FOWPN | Putative ankyrin repeat protein FPV244 OS=Fowlpox virus (strain NVSL) GN=FPV244 PE=3 SV=1 | 660 | 918 | 3.0E-11 |
sp|Q5RF15|TNI3K_PONAB | Serine/threonine-protein kinase TNNI3K OS=Pongo abelii GN=TNNI3K PE=2 SV=3 | 265 | 535 | 3.0E-11 |
sp|Q05823|RN5A_HUMAN | 2-5A-dependent ribonuclease OS=Homo sapiens GN=RNASEL PE=1 SV=2 | 420 | 705 | 3.0E-11 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 669 | 879 | 3.0E-11 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 483 | 706 | 3.0E-11 |
sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 419 | 620 | 3.0E-11 |
sp|Q8WZ74|CTTB2_HUMAN | Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 | 506 | 705 | 3.0E-11 |
sp|Q2IBF7|CTTB2_GORGO | Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 3.0E-11 |
sp|Q2QLF8|CTTB2_CALJA | Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 3.0E-11 |
sp|P14360|V240_FOWPN | Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 | 489 | 676 | 3.0E-11 |
sp|Q07E28|CTTB2_NEONE | Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 3.0E-11 |
sp|Q07DV1|CTTB2_AOTNA | Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 3.0E-11 |
sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 404 | 573 | 3.0E-11 |
sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 414 | 590 | 3.0E-11 |
sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 547 | 744 | 3.0E-11 |
sp|Q5UQ08|YR787_MIMIV | Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 | 456 | 745 | 3.0E-11 |
sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 3.0E-11 |
sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 483 | 705 | 3.0E-11 |
sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 547 | 744 | 3.0E-11 |
sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 582 | 801 | 3.0E-11 |
sp|Q6RI86|TRPA1_RAT | Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 | 28 | 604 | 4.0E-11 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 723 | 911 | 4.0E-11 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 788 | 915 | 4.0E-11 |
sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 523 | 879 | 4.0E-11 |
sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 405 | 602 | 4.0E-11 |
sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 431 | 637 | 4.0E-11 |
sp|Q7T3P8|FEM1C_DANRE | Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 | 405 | 635 | 4.0E-11 |
sp|Q7T3P8|FEM1C_DANRE | Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 | 687 | 918 | 4.0E-11 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 460 | 653 | 4.0E-11 |
sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 483 | 711 | 4.0E-11 |
sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 491 | 744 | 4.0E-11 |
sp|Q07DX4|CTTB2_NOMLE | Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 4.0E-11 |
sp|Q07E15|CTTB2_MUSPF | Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 | 404 | 573 | 4.0E-11 |
sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 404 | 579 | 4.0E-11 |
sp|P17442|PHO81_YEAST | Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 | 475 | 749 | 4.0E-11 |
sp|Q5UPH0|YL100_MIMIV | Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 | 146 | 611 | 4.0E-11 |
sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 484 | 689 | 4.0E-11 |
sp|Q653P0|KOR1_ORYSJ | Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 | 435 | 601 | 4.0E-11 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 299 | 537 | 5.0E-11 |
sp|Q9ULH0|KDIS_HUMAN | Kinase D-interacting substrate of 220 kDa OS=Homo sapiens GN=KIDINS220 PE=1 SV=3 | 142 | 569 | 5.0E-11 |
sp|Q9J513|V222_FOWPN | Putative ankyrin repeat protein FPV222 OS=Fowlpox virus (strain NVSL) GN=FPV222 PE=3 SV=1 | 290 | 895 | 5.0E-11 |
sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 581 | 747 | 5.0E-11 |
sp|Q3SX45|ASB2_BOVIN | Ankyrin repeat and SOCS box protein 2 OS=Bos taurus GN=ASB2 PE=2 SV=1 | 688 | 915 | 5.0E-11 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 518 | 742 | 5.0E-11 |
sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 723 | 911 | 5.0E-11 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 418 | 676 | 5.0E-11 |
sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 483 | 711 | 5.0E-11 |
sp|Q2IBE6|CTTB2_PONAB | Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 | 506 | 705 | 5.0E-11 |
sp|P14360|V240_FOWPN | Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 | 523 | 744 | 5.0E-11 |
sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 420 | 590 | 5.0E-11 |
sp|Q5DU14|MYO16_MOUSE | Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 | 532 | 722 | 5.0E-11 |
sp|Q91ZT8|ASB9_MOUSE | Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 | 481 | 685 | 5.0E-11 |
sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 548 | 744 | 5.0E-11 |
sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 548 | 744 | 5.0E-11 |
sp|P0DJE3|LATA_LATHE | Alpha-latrotoxin-Lhe1a OS=Latrodectus hesperus PE=1 SV=2 | 585 | 918 | 6.0E-11 |
sp|P0C0T2|ANKS6_RAT | Ankyrin repeat and SAM domain-containing protein 6 OS=Rattus norvegicus GN=Anks6 PE=1 SV=2 | 482 | 915 | 6.0E-11 |
sp|Q5UPJ9|YL122_MIMIV | Putative ankyrin repeat protein L122 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L122 PE=3 SV=1 | 314 | 717 | 6.0E-11 |
sp|Q8WXK1|ASB15_HUMAN | Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 | 769 | 915 | 6.0E-11 |
sp|P59672|ANS1A_MOUSE | Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 | 507 | 744 | 6.0E-11 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 667 | 901 | 6.0E-11 |
sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 583 | 743 | 6.0E-11 |
sp|Q9Z2G0|FEM1B_MOUSE | Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 | 369 | 571 | 6.0E-11 |
sp|P0C6P7|FEM1B_RAT | Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 | 369 | 571 | 6.0E-11 |
sp|Q9UK73|FEM1B_HUMAN | Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 | 369 | 571 | 6.0E-11 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 483 | 711 | 6.0E-11 |
sp|Q07DY4|CTTB2_COLGU | Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 | 404 | 571 | 6.0E-11 |
sp|A0M8S4|CTTB2_PAPAN | Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 | 404 | 571 | 6.0E-11 |
sp|Q9CQM6|ANR61_MOUSE | Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 | 450 | 749 | 6.0E-11 |
sp|O73630|NFKB2_XENLA | Nuclear factor NF-kappa-B p100 subunit OS=Xenopus laevis GN=nfkb2 PE=2 SV=1 | 420 | 642 | 6.0E-11 |
sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 418 | 653 | 6.0E-11 |
sp|Q09YJ5|ASZ1_MUNMU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 | 449 | 619 | 6.0E-11 |
sp|Q8WXK1|ASB15_HUMAN | Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 | 371 | 748 | 7.0E-11 |
sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 774 | 917 | 7.0E-11 |
sp|Q00PJ1|CTTB2_ATEAB | Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 | 404 | 579 | 7.0E-11 |
sp|Q641X1|ANR61_RAT | Ankyrin repeat domain-containing protein 61 OS=Rattus norvegicus GN=Ankrd61 PE=2 SV=1 | 434 | 634 | 7.0E-11 |
sp|Q2IBA2|CTTB2_CHLAE | Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 | 404 | 571 | 7.0E-11 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 506 | 722 | 7.0E-11 |
sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 500 | 722 | 7.0E-11 |
sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 484 | 689 | 7.0E-11 |
sp|Q90623|MYPT1_CHICK | Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 | 486 | 726 | 7.0E-11 |
sp|A6QL64|AN36A_HUMAN | Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 | 567 | 744 | 7.0E-11 |
sp|A1X157|CTTB2_ECHTE | Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 7.0E-11 |
sp|O60237|MYPT2_HUMAN | Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 | 453 | 726 | 7.0E-11 |
sp|Q68LP1|MIB2_RAT | E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 | 418 | 655 | 7.0E-11 |
sp|Q4X251|AKR1_ASPFU | Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 | 689 | 912 | 7.0E-11 |
sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 634 | 877 | 8.0E-11 |
sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 587 | 747 | 8.0E-11 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 483 | 711 | 8.0E-11 |
sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 500 | 722 | 8.0E-11 |
sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 500 | 722 | 8.0E-11 |
sp|Q8NFD2|ANKK1_HUMAN | Ankyrin repeat and protein kinase domain-containing protein 1 OS=Homo sapiens GN=ANKK1 PE=2 SV=1 | 70 | 435 | 9.0E-11 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 612 | 918 | 9.0E-11 |
sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 339 | 754 | 9.0E-11 |
sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 292 | 510 | 9.0E-11 |
sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 476 | 821 | 9.0E-11 |
sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 418 | 571 | 9.0E-11 |
sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 500 | 713 | 9.0E-11 |
sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 500 | 722 | 9.0E-11 |
sp|Q9J5H8|V023_FOWPN | Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 | 425 | 636 | 9.0E-11 |
sp|B0G124|Y9043_DICDI | Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 | 773 | 895 | 9.0E-11 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 30 | 320 | 1.0E-10 |
sp|Q8BLA8|TRPA1_MOUSE | Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 | 28 | 604 | 1.0E-10 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 65 | 503 | 1.0E-10 |
sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 300 | 574 | 1.0E-10 |
sp|A6NK59|ASB14_HUMAN | Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 | 415 | 742 | 1.0E-10 |
sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 404 | 573 | 1.0E-10 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 529 | 753 | 1.0E-10 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 483 | 711 | 1.0E-10 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 529 | 753 | 1.0E-10 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 483 | 711 | 1.0E-10 |
sp|Q09YG9|CTTB2_SAIBB | Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 1.0E-10 |
sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 500 | 713 | 1.0E-10 |
sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 500 | 713 | 1.0E-10 |
sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 515 | 889 | 1.0E-10 |
sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 500 | 722 | 1.0E-10 |
sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 500 | 722 | 1.0E-10 |
sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 262 | 519 | 1.0E-10 |
sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 1.0E-10 |
sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 500 | 722 | 1.0E-10 |
sp|Q6GPE5|FEM1B_XENLA | Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 | 373 | 603 | 1.0E-10 |
sp|Q1RI12|Y921_RICBR | Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 | 453 | 883 | 1.0E-10 |
sp|Q9ERC1|MYO16_RAT | Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 | 532 | 781 | 1.0E-10 |
sp|Q9CQ31|ASB11_MOUSE | Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 | 484 | 654 | 1.0E-10 |
sp|Q8WXE0|CSKI2_HUMAN | Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 | 440 | 678 | 1.0E-10 |
sp|O14974|MYPT1_HUMAN | Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 | 486 | 726 | 1.0E-10 |
sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 548 | 744 | 1.0E-10 |
sp|Q6ZVH7|ESPNL_HUMAN | Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 | 521 | 877 | 1.0E-10 |
sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 582 | 801 | 1.0E-10 |
sp|Q6S5H5|POTEG_HUMAN | POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 | 548 | 744 | 1.0E-10 |
sp|Q7Z8U2|AKR1_ASPOR | Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 | 689 | 912 | 1.0E-10 |
sp|Q3UYR4|ESPNL_MOUSE | Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 | 556 | 877 | 1.0E-10 |
sp|A0M8T3|ASZ1_FELCA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 | 453 | 619 | 1.0E-10 |
sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 418 | 603 | 2.0E-10 |
sp|Q9J517|V218_FOWPN | Putative ankyrin repeat protein FPV218 OS=Fowlpox virus (strain NVSL) GN=FPV218 PE=3 SV=1 | 520 | 862 | 2.0E-10 |
sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 405 | 573 | 2.0E-10 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 548 | 742 | 2.0E-10 |
sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 739 | 886 | 2.0E-10 |
sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 587 | 747 | 2.0E-10 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 549 | 753 | 2.0E-10 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 417 | 637 | 2.0E-10 |
sp|O90760|V031_FOWPN | Putative ankyrin repeat protein FPV031 OS=Fowlpox virus (strain NVSL) GN=ANK3 PE=3 SV=1 | 515 | 674 | 2.0E-10 |
sp|Q07DW4|CTTB2_MUNRE | Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 2.0E-10 |
sp|Q09YJ3|CTTB2_MUNMU | Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 | 774 | 921 | 2.0E-10 |
sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 2.0E-10 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 590 | 915 | 2.0E-10 |
sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 418 | 655 | 2.0E-10 |
sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 500 | 722 | 2.0E-10 |
sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 500 | 722 | 2.0E-10 |
sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 2.0E-10 |
sp|Q9CQM6|ANR61_MOUSE | Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 | 416 | 589 | 2.0E-10 |
sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 582 | 801 | 2.0E-10 |
sp|Q6S5H5|POTEG_HUMAN | POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 | 500 | 722 | 2.0E-10 |
sp|Q5UQV3|YL371_MIMIV | Putative ankyrin repeat protein L371 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L371 PE=3 SV=1 | 420 | 657 | 2.0E-10 |
sp|Q8WXI3|ASB10_HUMAN | Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 | 713 | 874 | 2.0E-10 |
sp|Q86AT8|SPKA_DICDI | Stress-activated protein kinase alpha OS=Dictyostelium discoideum GN=spkA-1 PE=1 SV=1 | 551 | 728 | 2.0E-10 |
sp|A6NI47|POTEM_HUMAN | Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 | 548 | 744 | 2.0E-10 |
sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 548 | 744 | 2.0E-10 |
sp|Q2IBB1|ASZ1_CHLAE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 | 456 | 612 | 2.0E-10 |
sp|Q07E17|ASZ1_MUSPF | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 | 453 | 619 | 2.0E-10 |
sp|Q8WMX7|ASZ1_PAPAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 | 456 | 612 | 2.0E-10 |
sp|P17221|FEM1_CAEEL | Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 | 515 | 709 | 2.0E-10 |
sp|Q5TYW2|A20A1_HUMAN | Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 | 585 | 764 | 2.0E-10 |
sp|Q4UJ75|A20A4_HUMAN | Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 | 585 | 764 | 2.0E-10 |
sp|Q5B0V6|AKR1_EMENI | Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 | 689 | 894 | 2.0E-10 |
sp|G5E8K5|ANK3_MOUSE | Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 | 783 | 922 | 3.0E-10 |
sp|Q8BTI7|ANR52_MOUSE | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Mus musculus GN=Ankrd52 PE=1 SV=1 | 619 | 922 | 3.0E-10 |
sp|O95271|TNKS1_HUMAN | Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 | 636 | 920 | 3.0E-10 |
sp|Q6PFX9|TNKS1_MOUSE | Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 | 636 | 920 | 3.0E-10 |
sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 682 | 921 | 3.0E-10 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 413 | 568 | 3.0E-10 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 645 | 865 | 3.0E-10 |
sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 415 | 580 | 3.0E-10 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 551 | 828 | 3.0E-10 |
sp|Q09YJ3|CTTB2_MUNMU | Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 3.0E-10 |
sp|Q3V096|ANR42_MOUSE | Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 | 473 | 832 | 3.0E-10 |
sp|Q8BG95|MYPT2_MOUSE | Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus GN=Ppp1r12b PE=1 SV=2 | 632 | 832 | 3.0E-10 |
sp|Q2QL82|CTTB2_MICMU | Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 3.0E-10 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 518 | 696 | 3.0E-10 |
sp|Q108T9|CTTB2_LOXAF | Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 | 404 | 573 | 3.0E-10 |
sp|A6NI47|POTEM_HUMAN | Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 | 500 | 722 | 3.0E-10 |
sp|Q07E30|ASZ1_NEONE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 | 453 | 619 | 3.0E-10 |
sp|Q05753|AKRP_ARATH | Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 | 586 | 731 | 3.0E-10 |
sp|Q07DX6|ASZ1_NOMLE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 | 456 | 612 | 3.0E-10 |
sp|Q8WMX8|ASZ1_BOVIN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 | 449 | 711 | 3.0E-10 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 475 | 640 | 3.0E-10 |
sp|Q5JPF3|AN36C_HUMAN | Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 | 585 | 837 | 3.0E-10 |
sp|Q01317|NUC2_NEUCR | Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 | 286 | 591 | 3.0E-10 |
sp|Q9M8S6|SKOR_ARATH | Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 | 435 | 601 | 3.0E-10 |
sp|Q09YK4|CTTB2_ATEGE | Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 | 404 | 571 | 3.0E-10 |
sp|Q09YI3|ASZ1_SHEEP | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 | 449 | 619 | 3.0E-10 |
sp|Q8NB46|ANR52_HUMAN | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens GN=ANKRD52 PE=1 SV=3 | 619 | 922 | 4.0E-10 |
sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 431 | 655 | 4.0E-10 |
sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 371 | 586 | 4.0E-10 |
sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 265 | 539 | 4.0E-10 |
sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 640 | 883 | 4.0E-10 |
sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 759 | 886 | 4.0E-10 |
sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 418 | 571 | 4.0E-10 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 815 | 915 | 4.0E-10 |
sp|Q00PJ1|CTTB2_ATEAB | Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 | 506 | 714 | 4.0E-10 |
sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 574 | 711 | 4.0E-10 |
sp|Q9J5I7|V014_FOWPN | Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 | 497 | 744 | 4.0E-10 |
sp|Q9D1A4|ASB5_MOUSE | Ankyrin repeat and SOCS box protein 5 OS=Mus musculus GN=Asb5 PE=2 SV=1 | 582 | 816 | 4.0E-10 |
sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 500 | 722 | 4.0E-10 |
sp|Q5TYW2|A20A1_HUMAN | Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 | 456 | 642 | 4.0E-10 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 585 | 753 | 4.0E-10 |
sp|Q2QLA4|ASZ1_HORSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 | 453 | 619 | 4.0E-10 |
sp|Q5SQ80|A20A2_HUMAN | Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 | 585 | 764 | 4.0E-10 |
sp|Q5SQ80|A20A2_HUMAN | Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 | 456 | 642 | 4.0E-10 |
sp|Q2IBG0|ASZ1_EULMM | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Eulemur macaco macaco GN=ASZ1 PE=3 SV=1 | 453 | 612 | 4.0E-10 |
sp|Q2QLC6|ASZ1_CARPS | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 | 453 | 599 | 4.0E-10 |
sp|Q9ZCL3|Y714_RICPR | Putative ankyrin repeat protein RP714 OS=Rickettsia prowazekii (strain Madrid E) GN=RP714 PE=3 SV=1 | 826 | 921 | 4.0E-10 |
sp|Q9J5H5|V026_FOWPN | Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 | 553 | 742 | 4.0E-10 |
sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 303 | 643 | 5.0E-10 |
sp|Q9HCD6|TANC2_HUMAN | Protein TANC2 OS=Homo sapiens GN=TANC2 PE=1 SV=3 | 418 | 586 | 5.0E-10 |
sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 587 | 743 | 5.0E-10 |
sp|A6NK59|ASB14_HUMAN | Ankyrin repeat and SOCS box protein 14 OS=Homo sapiens GN=ASB14 PE=2 SV=2 | 660 | 902 | 5.0E-10 |
sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 403 | 573 | 5.0E-10 |
sp|Q07DW4|CTTB2_MUNRE | Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 | 774 | 921 | 5.0E-10 |
sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 5.0E-10 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 414 | 568 | 5.0E-10 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 417 | 637 | 5.0E-10 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 529 | 753 | 5.0E-10 |
sp|Q09YG9|CTTB2_SAIBB | Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 | 777 | 920 | 5.0E-10 |
sp|Q2IBD4|CTTB2_RAT | Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 | 404 | 583 | 5.0E-10 |
sp|Q07E15|CTTB2_MUSPF | Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 5.0E-10 |
sp|Q6GPE5|FEM1B_XENLA | Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 | 369 | 571 | 5.0E-10 |
sp|Q8WMX6|ASZ1_PANTR | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 | 456 | 612 | 5.0E-10 |
sp|Q2IBF5|ASZ1_GORGO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 | 456 | 612 | 5.0E-10 |
sp|Q5VUR7|A20A3_HUMAN | Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 | 585 | 764 | 5.0E-10 |
sp|Q5VUR7|A20A3_HUMAN | Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 | 456 | 642 | 5.0E-10 |
sp|P07207|NOTCH_DROME | Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 | 468 | 637 | 5.0E-10 |
sp|Q5UPG7|YL091_MIMIV | Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 | 461 | 849 | 5.0E-10 |
sp|Q9J504|V231_FOWPN | Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 | 774 | 915 | 5.0E-10 |
sp|Q8WWH4|ASZ1_HUMAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 | 456 | 612 | 5.0E-10 |
sp|Q9J5A7|V155_FOWPN | Putative ankyrin repeat protein FPV115 OS=Fowlpox virus (strain NVSL) GN=FPV115 PE=3 SV=1 | 619 | 915 | 6.0E-10 |
sp|Q8ZWC4|Y1861_PYRAE | Putative ankyrin repeat protein PAE1861 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=PAE1861 PE=3 SV=1 | 275 | 540 | 6.0E-10 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 322 | 537 | 6.0E-10 |
sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 487 | 799 | 6.0E-10 |
sp|Q6AWW5|Y5262_ARATH | Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 | 667 | 879 | 6.0E-10 |
sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 453 | 652 | 6.0E-10 |
sp|Q2IBE3|ASZ1_PONAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 | 456 | 612 | 6.0E-10 |
sp|Q07DY6|ASZ1_COLGU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 | 456 | 612 | 6.0E-10 |
sp|Q9TXQ1|TNKS1_CAEEL | Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 | 277 | 656 | 6.0E-10 |
sp|Q9C7A2|Y3236_ARATH | Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 | 404 | 673 | 6.0E-10 |
sp|Q2QLH1|ASZ1_OTOGA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 | 453 | 612 | 6.0E-10 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 771 | 915 | 7.0E-10 |
sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 418 | 643 | 7.0E-10 |
sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 598 | 880 | 7.0E-10 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 529 | 753 | 7.0E-10 |
sp|Q2QLF8|CTTB2_CALJA | Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 7.0E-10 |
sp|B9EJA2|CTTB2_MOUSE | Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 | 404 | 583 | 7.0E-10 |
sp|Q07E28|CTTB2_NEONE | Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 7.0E-10 |
sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 414 | 551 | 7.0E-10 |
sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 585 | 764 | 7.0E-10 |
sp|Q5ZLC8|ANR52_CHICK | Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 | 62 | 384 | 8.0E-10 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 534 | 689 | 8.0E-10 |
sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 403 | 602 | 8.0E-10 |
sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 514 | 711 | 8.0E-10 |
sp|Q5ZM55|FEM1B_CHICK | Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 | 689 | 920 | 8.0E-10 |
sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 774 | 917 | 8.0E-10 |
sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 487 | 799 | 8.0E-10 |
sp|Q6DD51|CSKI2_XENLA | Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 | 475 | 658 | 8.0E-10 |
sp|Q68LP1|MIB2_RAT | E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 | 631 | 869 | 8.0E-10 |
sp|Q09YK4|CTTB2_ATEGE | Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 8.0E-10 |
sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 520 | 703 | 8.0E-10 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 818 | 918 | 9.0E-10 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 520 | 740 | 9.0E-10 |
sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 434 | 651 | 9.0E-10 |
sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 292 | 510 | 9.0E-10 |
sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 9.0E-10 |
sp|Q07E28|CTTB2_NEONE | Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 9.0E-10 |
sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 9.0E-10 |
sp|O60237|MYPT2_HUMAN | Protein phosphatase 1 regulatory subunit 12B OS=Homo sapiens GN=PPP1R12B PE=1 SV=2 | 632 | 832 | 9.0E-10 |
sp|Q9D119|PPR27_MOUSE | Protein phosphatase 1 regulatory subunit 27 OS=Mus musculus GN=Ppp1r27 PE=2 SV=1 | 814 | 894 | 9.0E-10 |
sp|Q9J4Z5|V245_FOWPN | Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 | 687 | 927 | 1.0E-09 |
sp|Q8WXK1|ASB15_HUMAN | Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 | 668 | 915 | 1.0E-09 |
sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 590 | 911 | 1.0E-09 |
sp|P59672|ANS1A_MOUSE | Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 | 292 | 510 | 1.0E-09 |
sp|P59672|ANS1A_MOUSE | Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 | 682 | 914 | 1.0E-09 |
sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 692 | 926 | 1.0E-09 |
sp|P97819|PLPL9_MOUSE | 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 | 651 | 894 | 1.0E-09 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 721 | 907 | 1.0E-09 |
sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 414 | 540 | 1.0E-09 |
sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 1.0E-09 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 404 | 579 | 1.0E-09 |
sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 523 | 739 | 1.0E-09 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 549 | 753 | 1.0E-09 |
sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 453 | 655 | 1.0E-09 |
sp|Q8BIZ1|ANS1B_MOUSE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 | 292 | 510 | 1.0E-09 |
sp|Q2IBD4|CTTB2_RAT | Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 | 506 | 705 | 1.0E-09 |
sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 420 | 653 | 1.0E-09 |
sp|B9EJA2|CTTB2_MOUSE | Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 | 506 | 705 | 1.0E-09 |
sp|Q07E15|CTTB2_MUSPF | Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 1.0E-09 |
sp|A0M8S4|CTTB2_PAPAN | Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 | 774 | 903 | 1.0E-09 |
sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 1.0E-09 |
sp|Q4X251|AKR1_ASPFU | Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 | 476 | 652 | 1.0E-09 |
sp|Q6GPE5|FEM1B_XENLA | Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 | 785 | 920 | 1.0E-09 |
sp|Q8WXI3|ASB10_HUMAN | Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 | 484 | 787 | 1.0E-09 |
sp|Q65XV2|XB3_ORYSJ | E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 | 448 | 635 | 1.0E-09 |
sp|Q9Y6X6|MYO16_HUMAN | Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 | 523 | 705 | 1.0E-09 |
sp|Q10728|MYPT1_RAT | Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 | 486 | 726 | 1.0E-09 |
sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 520 | 703 | 1.0E-09 |
sp|P21001|B4_VACCC | Ankyrin repeat protein B4 OS=Vaccinia virus (strain Copenhagen) GN=B4R PE=3 SV=1 | 610 | 892 | 1.0E-09 |
sp|Q07E43|ASZ1_DASNO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 | 453 | 619 | 1.0E-09 |
sp|A1ZBY1|FEM1B_DROME | Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 | 509 | 711 | 1.0E-09 |
sp|Q9J502|V233_FOWPN | Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 | 497 | 689 | 1.0E-09 |
sp|Q9VCA8|ANKHM_DROME | Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 | 808 | 918 | 2.0E-09 |
sp|Q71S21|INVSB_XENLA | Inversin-B OS=Xenopus laevis GN=invs-b PE=1 SV=1 | 576 | 921 | 2.0E-09 |
sp|Q9J4Z5|V245_FOWPN | Putative ankyrin repeat protein FPV245 OS=Fowlpox virus (strain NVSL) GN=FPV245 PE=3 SV=1 | 310 | 607 | 2.0E-09 |
sp|Q9WV72|ASB3_MOUSE | Ankyrin repeat and SOCS box protein 3 OS=Mus musculus GN=Asb3 PE=1 SV=2 | 85 | 489 | 2.0E-09 |
sp|Q9Y575|ASB3_HUMAN | Ankyrin repeat and SOCS box protein 3 OS=Homo sapiens GN=ASB3 PE=1 SV=1 | 85 | 443 | 2.0E-09 |
sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 417 | 586 | 2.0E-09 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 791 | 921 | 2.0E-09 |
sp|Q3KP44|ANR55_HUMAN | Ankyrin repeat domain-containing protein 55 OS=Homo sapiens GN=ANKRD55 PE=2 SV=3 | 66 | 200 | 2.0E-09 |
sp|P97819|PLPL9_MOUSE | 85/88 kDa calcium-independent phospholipase A2 OS=Mus musculus GN=Pla2g6 PE=1 SV=3 | 576 | 846 | 2.0E-09 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 810 | 915 | 2.0E-09 |
sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 774 | 916 | 2.0E-09 |
sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 423 | 603 | 2.0E-09 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 259 | 574 | 2.0E-09 |
sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 417 | 637 | 2.0E-09 |
sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 417 | 637 | 2.0E-09 |
sp|Q5M9H0|ANKS3_RAT | Ankyrin repeat and SAM domain-containing protein 3 OS=Rattus norvegicus GN=Anks3 PE=1 SV=1 | 774 | 916 | 2.0E-09 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 482 | 705 | 2.0E-09 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 791 | 921 | 2.0E-09 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 417 | 637 | 2.0E-09 |
sp|Q8N2N9|AN36B_HUMAN | Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 | 492 | 722 | 2.0E-09 |
sp|Q8WZ74|CTTB2_HUMAN | Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 | 774 | 903 | 2.0E-09 |
sp|Q2IBF7|CTTB2_GORGO | Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 | 774 | 903 | 2.0E-09 |
sp|P98150|NFKB2_CHICK | Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 | 646 | 891 | 2.0E-09 |
sp|B9EJA2|CTTB2_MOUSE | Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 | 774 | 903 | 2.0E-09 |
sp|Q07DV1|CTTB2_AOTNA | Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 2.0E-09 |
sp|Q07DY4|CTTB2_COLGU | Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 | 774 | 903 | 2.0E-09 |
sp|Q2IBA2|CTTB2_CHLAE | Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 | 774 | 903 | 2.0E-09 |
sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 787 | 923 | 2.0E-09 |
sp|Q7Z8U2|AKR1_ASPOR | Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 | 474 | 652 | 2.0E-09 |
sp|P17221|FEM1_CAEEL | Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 | 713 | 932 | 2.0E-09 |
sp|P17221|FEM1_CAEEL | Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 | 282 | 501 | 2.0E-09 |
sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 520 | 703 | 2.0E-09 |
sp|Q9SQK3|EM506_ARATH | Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 | 772 | 902 | 2.0E-09 |
sp|Q9J5H9|V022_FOWPN | Putative ankyrin repeat protein FPV022 OS=Fowlpox virus (strain NVSL) GN=FPV022 PE=3 SV=1 | 497 | 915 | 2.0E-09 |
sp|Q9DBR7|MYPT1_MOUSE | Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 | 486 | 726 | 2.0E-09 |
sp|Q2T9W8|ANR61_BOVIN | Ankyrin repeat domain-containing protein 61 OS=Bos taurus GN=ANKRD61 PE=2 SV=1 | 452 | 655 | 2.0E-09 |
sp|Q2QL84|ASZ1_MICMU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 | 453 | 612 | 2.0E-09 |
sp|Q2IBB4|ASZ1_RHIFE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 | 453 | 619 | 2.0E-09 |
sp|Q9WTK5|NFKB2_MOUSE | Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus GN=Nfkb2 PE=1 SV=1 | 585 | 906 | 2.0E-09 |
sp|P24769|B4_VACCW | Ankyrin repeat protein B4 OS=Vaccinia virus (strain Western Reserve) GN=VACWR186 PE=3 SV=1 | 610 | 892 | 2.0E-09 |
sp|Q3EC11|ZDHC2_ARATH | Probable protein S-acyltransferase 23 OS=Arabidopsis thaliana GN=PAT23 PE=2 SV=2 | 718 | 906 | 2.0E-09 |
sp|O89019|INVS_MOUSE | Inversin OS=Mus musculus GN=Invs PE=1 SV=2 | 578 | 899 | 3.0E-09 |
sp|Q96Q27|ASB2_HUMAN | Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens GN=ASB2 PE=1 SV=1 | 688 | 915 | 3.0E-09 |
sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 774 | 915 | 3.0E-09 |
sp|P97570|PLPL9_RAT | 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 | 651 | 894 | 3.0E-09 |
sp|Q6ZW76|ANKS3_HUMAN | Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens GN=ANKS3 PE=1 SV=1 | 634 | 877 | 3.0E-09 |
sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 430 | 603 | 3.0E-09 |
sp|Q8TC84|FANK1_HUMAN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Homo sapiens GN=FANK1 PE=2 SV=3 | 640 | 869 | 3.0E-09 |
sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 520 | 915 | 3.0E-09 |
sp|Q1RHT6|Y997_RICBR | Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 | 486 | 745 | 3.0E-09 |
sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 66 | 200 | 3.0E-09 |
sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 772 | 911 | 3.0E-09 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 417 | 637 | 3.0E-09 |
sp|Q9Z2G0|FEM1B_MOUSE | Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 | 689 | 911 | 3.0E-09 |
sp|P0C6P7|FEM1B_RAT | Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 | 689 | 911 | 3.0E-09 |
sp|Q9W0T5|PYX_DROME | Transient receptor potential channel pyrexia OS=Drosophila melanogaster GN=pyx PE=2 SV=2 | 413 | 635 | 3.0E-09 |
sp|Q9UK73|FEM1B_HUMAN | Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 | 689 | 911 | 3.0E-09 |
sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 404 | 572 | 3.0E-09 |
sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 423 | 616 | 3.0E-09 |
sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 418 | 593 | 3.0E-09 |
sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 292 | 510 | 3.0E-09 |
sp|P14360|V240_FOWPN | Putative ankyrin repeat protein FPV240 OS=Fowlpox virus (strain NVSL) GN=FPV240 PE=3 SV=1 | 714 | 919 | 3.0E-09 |
sp|Q6DD51|CSKI2_XENLA | Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 | 486 | 720 | 3.0E-09 |
sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 418 | 568 | 3.0E-09 |
sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 262 | 519 | 3.0E-09 |
sp|Q9J5I7|V014_FOWPN | Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 | 620 | 923 | 3.0E-09 |
sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 683 | 918 | 3.0E-09 |
sp|Q17QS6|ASB5_BOVIN | Ankyrin repeat and SOCS box protein 5 OS=Bos taurus GN=ASB5 PE=2 SV=1 | 721 | 936 | 3.0E-09 |
sp|Q90623|MYPT1_CHICK | Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 | 453 | 637 | 3.0E-09 |
sp|A1X157|CTTB2_ECHTE | Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 | 404 | 573 | 3.0E-09 |
sp|Q9BXX3|AN30A_HUMAN | Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 | 585 | 744 | 3.0E-09 |
sp|Q3TYA6|MPP8_MOUSE | M-phase phosphoprotein 8 OS=Mus musculus GN=Mphosph8 PE=1 SV=1 | 441 | 571 | 3.0E-09 |
sp|G3V8T1|MPP8_RAT | M-phase phosphoprotein 8 OS=Rattus norvegicus GN=Mphosph8 PE=2 SV=1 | 441 | 571 | 3.0E-09 |
sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 436 | 568 | 3.0E-09 |
sp|Q9D738|ASB12_MOUSE | Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 | 377 | 541 | 3.0E-09 |
sp|P33823|VB04_VAR67 | Ankyrin repeat protein B4 OS=Variola virus (isolate Human/India/Ind3/1967) GN=B4R PE=3 SV=1 | 631 | 847 | 3.0E-09 |
sp|Q5T7N3|KANK4_HUMAN | KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens GN=KANK4 PE=2 SV=1 | 442 | 593 | 3.0E-09 |
sp|Q1LVW0|BTBBA_DANRE | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-A OS=Danio rerio GN=btbd11a PE=3 SV=2 | 474 | 614 | 3.0E-09 |
sp|Q8UVC3|INVS_CHICK | Inversin OS=Gallus gallus GN=INVS PE=2 SV=2 | 540 | 913 | 4.0E-09 |
sp|Q6JAN1|INVS_CANLF | Inversin OS=Canis lupus familiaris GN=INVS PE=1 SV=1 | 579 | 899 | 4.0E-09 |
sp|Q60J38|ANKHM_CAEBR | Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 | 313 | 603 | 4.0E-09 |
sp|A6QPE7|ANR65_BOVIN | Ankyrin repeat domain-containing protein 65 OS=Bos taurus GN=ANKRD65 PE=2 SV=1 | 75 | 376 | 4.0E-09 |
sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 585 | 801 | 4.0E-09 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 278 | 498 | 4.0E-09 |
sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 640 | 883 | 4.0E-09 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 75 | 199 | 4.0E-09 |
sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 685 | 882 | 4.0E-09 |
sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 815 | 915 | 4.0E-09 |
sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 506 | 705 | 4.0E-09 |
sp|P0C6S7|ANS1B_RAT | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 | 520 | 798 | 4.0E-09 |
sp|Q63618|ESPN_RAT | Espin OS=Rattus norvegicus GN=Espn PE=1 SV=2 | 434 | 651 | 4.0E-09 |
sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 418 | 586 | 4.0E-09 |
sp|Q07E15|CTTB2_MUSPF | Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 4.0E-09 |
sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 685 | 894 | 4.0E-09 |
sp|A6QL64|AN36A_HUMAN | Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 | 493 | 716 | 4.0E-09 |
sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 73 | 214 | 4.0E-09 |
sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 73 | 214 | 4.0E-09 |
sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 808 | 919 | 4.0E-09 |
sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 778 | 915 | 4.0E-09 |
sp|Q99466|NOTC4_HUMAN | Neurogenic locus notch homolog protein 4 OS=Homo sapiens GN=NOTCH4 PE=1 SV=2 | 709 | 919 | 4.0E-09 |
sp|Q5EA33|ANR49_BOVIN | Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 | 765 | 911 | 4.0E-09 |
sp|P97570|PLPL9_RAT | 85/88 kDa calcium-independent phospholipase A2 OS=Rattus norvegicus GN=Pla2g6 PE=1 SV=2 | 576 | 846 | 5.0E-09 |
sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 585 | 801 | 5.0E-09 |
sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 585 | 801 | 5.0E-09 |
sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 585 | 801 | 5.0E-09 |
sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 472 | 672 | 5.0E-09 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 773 | 895 | 5.0E-09 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 760 | 922 | 5.0E-09 |
sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 640 | 883 | 5.0E-09 |
sp|Q86YT6|MIB1_HUMAN | E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens GN=MIB1 PE=1 SV=1 | 760 | 922 | 5.0E-09 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 417 | 637 | 5.0E-09 |
sp|Q8C0T1|FM1AB_MOUSE | Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 | 761 | 918 | 5.0E-09 |
sp|Q2IBE6|CTTB2_PONAB | Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 | 774 | 903 | 5.0E-09 |
sp|Q00653|NFKB2_HUMAN | Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens GN=NFKB2 PE=1 SV=4 | 585 | 906 | 5.0E-09 |
sp|Q2QLB3|CTTB2_CALMO | Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 5.0E-09 |
sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 73 | 214 | 5.0E-09 |
sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 73 | 204 | 5.0E-09 |
sp|Q99549|MPP8_HUMAN | M-phase phosphoprotein 8 OS=Homo sapiens GN=MPHOSPH8 PE=1 SV=2 | 441 | 571 | 5.0E-09 |
sp|Q8R560|ANKR1_RAT | Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 | 416 | 587 | 5.0E-09 |
sp|Q876L5|AKR1_SACU7 | Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 | 483 | 655 | 5.0E-09 |
sp|Q8VE42|ANR49_MOUSE | Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 | 810 | 911 | 5.0E-09 |
sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 456 | 595 | 5.0E-09 |
sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 676 | 880 | 5.0E-09 |
sp|Q02357|ANK1_MOUSE | Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 | 79 | 404 | 6.0E-09 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 587 | 919 | 6.0E-09 |
sp|Q7TQP6|TNI3K_RAT | Serine/threonine-protein kinase TNNI3K OS=Rattus norvegicus GN=Tnni3k PE=2 SV=3 | 791 | 920 | 6.0E-09 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 531 | 845 | 6.0E-09 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 417 | 637 | 6.0E-09 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 285 | 642 | 6.0E-09 |
sp|Q07DX4|CTTB2_NOMLE | Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 | 774 | 903 | 6.0E-09 |
sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 685 | 882 | 6.0E-09 |
sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 418 | 586 | 6.0E-09 |
sp|Q1RI12|Y921_RICBR | Putative ankyrin repeat protein RBE_0921 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0921 PE=3 SV=1 | 393 | 873 | 6.0E-09 |
sp|Q9M8S6|SKOR_ARATH | Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 | 784 | 902 | 6.0E-09 |
sp|Q09YK4|CTTB2_ATEGE | Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 6.0E-09 |
sp|Q6UB99|ANR11_HUMAN | Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 | 815 | 934 | 6.0E-09 |
sp|Q4UKI1|Y1099_RICFE | Putative ankyrin repeat protein RF_1099 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_1099 PE=3 SV=1 | 393 | 559 | 6.0E-09 |
sp|Q4V890|FEM1A_RAT | Protein fem-1 homolog A OS=Rattus norvegicus GN=Fem1a PE=2 SV=1 | 761 | 912 | 7.0E-09 |
sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 7.0E-09 |
sp|Q108T9|CTTB2_LOXAF | Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 | 774 | 917 | 7.0E-09 |
sp|Q5UPH0|YL100_MIMIV | Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 | 224 | 656 | 7.0E-09 |
sp|A6NC57|ANR62_HUMAN | Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 | 585 | 744 | 7.0E-09 |
sp|Q96AX9|MIB2_HUMAN | E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 | 418 | 655 | 7.0E-09 |
sp|Q3UMT1|PP12C_MOUSE | Protein phosphatase 1 regulatory subunit 12C OS=Mus musculus GN=Ppp1r12c PE=1 SV=1 | 486 | 752 | 7.0E-09 |
sp|Q9Y574|ASB4_HUMAN | Ankyrin repeat and SOCS box protein 4 OS=Homo sapiens GN=ASB4 PE=2 SV=1 | 455 | 702 | 7.0E-09 |
sp|P16157|ANK1_HUMAN | Ankyrin-1 OS=Homo sapiens GN=ANK1 PE=1 SV=3 | 60 | 409 | 8.0E-09 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 76 | 443 | 8.0E-09 |
sp|Q9Y283|INVS_HUMAN | Inversin OS=Homo sapiens GN=INVS PE=1 SV=2 | 580 | 899 | 8.0E-09 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 567 | 893 | 8.0E-09 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 499 | 661 | 8.0E-09 |
sp|Q05753|AKRP_ARATH | Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 | 774 | 896 | 8.0E-09 |
sp|Q2T9W8|ANR61_BOVIN | Ankyrin repeat domain-containing protein 61 OS=Bos taurus GN=ANKRD61 PE=2 SV=1 | 567 | 746 | 8.0E-09 |
sp|Q86WC6|PPR27_HUMAN | Protein phosphatase 1 regulatory subunit 27 OS=Homo sapiens GN=PPP1R27 PE=1 SV=1 | 814 | 894 | 8.0E-09 |
sp|Q8VD46|ASZ1_MOUSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 | 441 | 619 | 8.0E-09 |
sp|Q9J5I9|V012_FOWPN | Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 | 773 | 883 | 8.0E-09 |
sp|P57044|ILK_CAVPO | Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 | 453 | 579 | 8.0E-09 |
sp|Q3SWY2|ILK_BOVIN | Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 | 453 | 579 | 8.0E-09 |
sp|Q13418|ILK_HUMAN | Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 | 453 | 579 | 8.0E-09 |
sp|Q5U2S6|ASB2_RAT | Ankyrin repeat and SOCS box protein 2 OS=Rattus norvegicus GN=Asb2 PE=2 SV=1 | 688 | 915 | 9.0E-09 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 774 | 920 | 9.0E-09 |
sp|Q2IBD4|CTTB2_RAT | Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 | 768 | 920 | 9.0E-09 |
sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 418 | 568 | 9.0E-09 |
sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 418 | 568 | 9.0E-09 |
sp|Q9TZC4|ILKH_CAEEL | Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 | 772 | 862 | 9.0E-09 |
sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 414 | 528 | 9.0E-09 |
sp|Q7Z8U2|AKR1_ASPOR | Palmitoyltransferase akr1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=akr1 PE=3 SV=2 | 659 | 897 | 9.0E-09 |
sp|Q9C7A2|Y3236_ARATH | Ankyrin repeat-containing protein At3g12360 OS=Arabidopsis thaliana GN=At3g12360 PE=2 SV=1 | 484 | 739 | 9.0E-09 |
sp|Q5R5V4|ILK_PONAB | Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 | 453 | 579 | 9.0E-09 |
sp|Q99J82|ILK_RAT | Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 | 453 | 579 | 9.0E-09 |
sp|O55222|ILK_MOUSE | Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 | 453 | 579 | 9.0E-09 |
sp|Q8K0L0|ASB2_MOUSE | Ankyrin repeat and SOCS box protein 2 OS=Mus musculus GN=Asb2 PE=1 SV=1 | 688 | 915 | 1.0E-08 |
sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 57 | 354 | 1.0E-08 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 82 | 351 | 1.0E-08 |
sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 634 | 877 | 1.0E-08 |
sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 568 | 753 | 1.0E-08 |
sp|Q07DW4|CTTB2_MUNRE | Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 1.0E-08 |
sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 568 | 753 | 1.0E-08 |
sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 682 | 879 | 1.0E-08 |
sp|Q6AWW5|Y5262_ARATH | Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 | 687 | 911 | 1.0E-08 |
sp|Q9Z2G1|FM1AA_MOUSE | Protein fem-1 homolog A-A OS=Mus musculus GN=Fem1aa PE=2 SV=1 | 761 | 918 | 1.0E-08 |
sp|Q10311|YD58_SCHPO | Ankyrin repeat-containing protein C6C3.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.08 PE=3 SV=1 | 658 | 868 | 1.0E-08 |
sp|Q6DD51|CSKI2_XENLA | Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 | 419 | 579 | 1.0E-08 |
sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 453 | 689 | 1.0E-08 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 1.0E-08 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 414 | 540 | 1.0E-08 |
sp|Q653P0|KOR1_ORYSJ | Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 | 789 | 934 | 1.0E-08 |
sp|Q91ZT8|ASB9_MOUSE | Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 | 452 | 672 | 1.0E-08 |
sp|A1X157|CTTB2_ECHTE | Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 | 774 | 917 | 1.0E-08 |
sp|Q9BXX3|AN30A_HUMAN | Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 | 292 | 484 | 1.0E-08 |
sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 300 | 519 | 1.0E-08 |
sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 418 | 595 | 1.0E-08 |
sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 721 | 910 | 1.0E-08 |
sp|Q55A55|Y9848_DICDI | Probable serine/threonine-protein kinase DDB_G0272092 OS=Dictyostelium discoideum GN=DDB_G0272092 PE=2 SV=1 | 554 | 726 | 1.0E-08 |
sp|Q08E43|ASB8_BOVIN | Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 | 409 | 579 | 1.0E-08 |
sp|Q9BXX2|AN30B_HUMAN | Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 | 499 | 721 | 1.0E-08 |
sp|Q5R6D7|ASB8_PONAB | Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 | 409 | 579 | 1.0E-08 |
sp|Q9VSA4|TONSL_DROME | Tonsoku-like protein OS=Drosophila melanogaster GN=CG7457 PE=1 SV=1 | 762 | 915 | 1.0E-08 |
sp|Q9H765|ASB8_HUMAN | Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 | 409 | 579 | 1.0E-08 |
sp|Q811D2|ANR26_MOUSE | Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 | 583 | 711 | 1.0E-08 |
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 575 | 915 | 2.0E-08 |
sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 292 | 591 | 2.0E-08 |
sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 774 | 912 | 2.0E-08 |
sp|Q9BGT9|ASB7_MACFA | Ankyrin repeat and SOCS box protein 7 OS=Macaca fascicularis GN=ASB7 PE=2 SV=1 | 489 | 747 | 2.0E-08 |
sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 506 | 741 | 2.0E-08 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 773 | 895 | 2.0E-08 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 548 | 689 | 2.0E-08 |
sp|O60733|PLPL9_HUMAN | 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 | 569 | 846 | 2.0E-08 |
sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 442 | 637 | 2.0E-08 |
sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 590 | 893 | 2.0E-08 |
sp|Q9J4Z4|V246_FOWPN | Putative ankyrin repeat protein FPV246 OS=Fowlpox virus (strain NVSL) GN=FPV246 PE=3 SV=1 | 618 | 866 | 2.0E-08 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 499 | 661 | 2.0E-08 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 602 | 742 | 2.0E-08 |
sp|Q00PJ1|CTTB2_ATEAB | Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 | 774 | 916 | 2.0E-08 |
sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 415 | 570 | 2.0E-08 |
sp|Q3SZE4|ASB11_BOVIN | Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 | 569 | 800 | 2.0E-08 |
sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 486 | 676 | 2.0E-08 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 516 | 913 | 2.0E-08 |
sp|B9EJA2|CTTB2_MOUSE | Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 | 685 | 878 | 2.0E-08 |
sp|Q6DD51|CSKI2_XENLA | Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 | 568 | 798 | 2.0E-08 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 678 | 865 | 2.0E-08 |
sp|Q108T9|CTTB2_LOXAF | Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 2.0E-08 |
sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 453 | 603 | 2.0E-08 |
sp|Q68LP1|MIB2_RAT | E3 ubiquitin-protein ligase MIB2 OS=Rattus norvegicus GN=Mib2 PE=1 SV=2 | 551 | 867 | 2.0E-08 |
sp|Q3UYR4|ESPNL_MOUSE | Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 | 589 | 923 | 2.0E-08 |
sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 670 | 877 | 2.0E-08 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 518 | 676 | 2.0E-08 |
sp|Q5UPG7|YL091_MIMIV | Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 | 418 | 744 | 2.0E-08 |
sp|Q5UPG7|YL091_MIMIV | Putative ankyrin repeat protein L91 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L91 PE=3 SV=1 | 631 | 866 | 2.0E-08 |
sp|Q9TXQ1|TNKS1_CAEEL | Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 | 518 | 884 | 2.0E-08 |
sp|Q8VE42|ANR49_MOUSE | Ankyrin repeat domain-containing protein 49 OS=Mus musculus GN=Ankrd49 PE=1 SV=1 | 486 | 609 | 2.0E-08 |
sp|Q811D2|ANR26_MOUSE | Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 | 500 | 643 | 2.0E-08 |
sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 415 | 644 | 2.0E-08 |
sp|Q4JHE0|XB36_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS36 OS=Oryza sativa subsp. japonica GN=XBOS36 PE=2 SV=1 | 448 | 799 | 2.0E-08 |
sp|Q38998|AKT1_ARATH | Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 | 531 | 722 | 2.0E-08 |
sp|Q9J512|V223_FOWPN | Putative ankyrin repeat protein FPV223 OS=Fowlpox virus (strain NVSL) GN=FPV223 PE=3 SV=1 | 495 | 636 | 2.0E-08 |
sp|Q9TU71|ANKR1_RABIT | Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 | 416 | 587 | 2.0E-08 |
sp|Q9QW30|NOTC2_RAT | Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus GN=Notch2 PE=1 SV=1 | 394 | 637 | 2.0E-08 |
sp|Q4R544|ASB8_MACFA | Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 | 409 | 579 | 2.0E-08 |
sp|Q04721|NOTC2_HUMAN | Neurogenic locus notch homolog protein 2 OS=Homo sapiens GN=NOTCH2 PE=1 SV=3 | 394 | 637 | 2.0E-08 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 66 | 203 | 3.0E-08 |
sp|Q9J5I3|V018_FOWPN | Putative ankyrin repeat protein FPV018 OS=Fowlpox virus (strain NVSL) GN=FPV018 PE=3 SV=1 | 418 | 689 | 3.0E-08 |
sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 682 | 905 | 3.0E-08 |
sp|Q8VHS6|ASB15_MOUSE | Ankyrin repeat and SOCS box protein 15 OS=Mus musculus GN=Asb15 PE=2 SV=2 | 668 | 902 | 3.0E-08 |
sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 435 | 620 | 3.0E-08 |
sp|Q1RHT6|Y997_RICBR | Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 | 315 | 569 | 3.0E-08 |
sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 514 | 711 | 3.0E-08 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 678 | 921 | 3.0E-08 |
sp|Q502M6|ANR29_DANRE | Ankyrin repeat domain-containing protein 29 OS=Danio rerio GN=ankrd29 PE=2 SV=1 | 783 | 926 | 3.0E-08 |
sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 292 | 484 | 3.0E-08 |
sp|Q3SZE4|ASB11_BOVIN | Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 | 418 | 639 | 3.0E-08 |
sp|Q2QLA2|CTTB2_HORSE | Cortactin-binding protein 2 OS=Equus caballus GN=CTTNBP2 PE=3 SV=1 | 585 | 805 | 3.0E-08 |
sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 669 | 915 | 3.0E-08 |
sp|Q8R516|MIB2_MOUSE | E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 | 674 | 915 | 3.0E-08 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 292 | 484 | 3.0E-08 |
sp|Q9CQ31|ASB11_MOUSE | Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 | 569 | 799 | 3.0E-08 |
sp|Q6ZVH7|ESPNL_HUMAN | Espin-like protein OS=Homo sapiens GN=ESPNL PE=2 SV=3 | 430 | 636 | 3.0E-08 |
sp|Q3UYR4|ESPNL_MOUSE | Espin-like protein OS=Mus musculus GN=Espnl PE=2 SV=1 | 439 | 636 | 3.0E-08 |
sp|Q8WXI3|ASB10_HUMAN | Ankyrin repeat and SOCS box protein 10 OS=Homo sapiens GN=ASB10 PE=1 SV=2 | 386 | 640 | 3.0E-08 |
sp|Q05753|AKRP_ARATH | Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 | 538 | 698 | 3.0E-08 |
sp|Q9M8S6|SKOR_ARATH | Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 | 456 | 635 | 3.0E-08 |
sp|Q9J5H5|V026_FOWPN | Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 | 719 | 923 | 3.0E-08 |
sp|Q9J5H5|V026_FOWPN | Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 | 488 | 641 | 3.0E-08 |
sp|Q9BXX2|AN30B_HUMAN | Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 | 292 | 484 | 3.0E-08 |
sp|Q63369|NFKB1_RAT | Nuclear factor NF-kappa-B p105 subunit (Fragment) OS=Rattus norvegicus GN=Nfkb1 PE=1 SV=1 | 701 | 905 | 3.0E-08 |
sp|Q9FY48|KEG_ARATH | E3 ubiquitin-protein ligase KEG OS=Arabidopsis thaliana GN=KEG PE=1 SV=2 | 404 | 683 | 3.0E-08 |
sp|Q8TAK5|GABP2_HUMAN | GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 | 73 | 204 | 3.0E-08 |
sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 73 | 214 | 3.0E-08 |
sp|Q5UQF1|YL483_MIMIV | Putative ankyrin repeat protein L483 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L483 PE=3 SV=1 | 616 | 915 | 3.0E-08 |
sp|Q52T38|ZDH22_ARATH | Protein S-acyltransferase 24 OS=Arabidopsis thaliana GN=PAT24 PE=2 SV=1 | 689 | 896 | 3.0E-08 |
sp|Q8WVL7|ANR49_HUMAN | Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 | 810 | 911 | 3.0E-08 |
sp|Q91ZT9|ASB8_MOUSE | Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 | 409 | 579 | 3.0E-08 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 76 | 347 | 4.0E-08 |
sp|Q71S22|INVSA_XENLA | Inversin-A OS=Xenopus laevis GN=invs-a PE=1 SV=1 | 580 | 921 | 4.0E-08 |
sp|Q08DV6|ASB3_BOVIN | Ankyrin repeat and SOCS box protein 3 OS=Bos taurus GN=ASB3 PE=2 SV=1 | 85 | 489 | 4.0E-08 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 798 | 920 | 4.0E-08 |
sp|Q5UP39|YR873_MIMIV | Putative ankyrin repeat protein R873 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R873 PE=3 SV=1 | 420 | 882 | 4.0E-08 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 292 | 573 | 4.0E-08 |
sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 685 | 894 | 4.0E-08 |
sp|Q8VHS5|ASB16_MOUSE | Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 | 713 | 915 | 4.0E-08 |
sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 518 | 655 | 4.0E-08 |
sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 418 | 586 | 4.0E-08 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 721 | 883 | 4.0E-08 |
sp|Q96AX9|MIB2_HUMAN | E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens GN=MIB2 PE=1 SV=3 | 520 | 799 | 4.0E-08 |
sp|Q8WXH4|ASB11_HUMAN | Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 | 569 | 800 | 4.0E-08 |
sp|O08764|ABTB2_RAT | Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Rattus norvegicus GN=Abtb2 PE=2 SV=1 | 474 | 604 | 4.0E-08 |
sp|Q54XX5|Y9849_DICDI | Probable serine/threonine-protein kinase DDB_G0278535 OS=Dictyostelium discoideum GN=DDB_G0278535 PE=3 SV=1 | 538 | 738 | 4.0E-08 |
sp|Q04861|NFKB1_CHICK | Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 | 418 | 568 | 4.0E-08 |
sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 431 | 616 | 4.0E-08 |
sp|Q5RFS1|ASB11_PONAB | Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 | 569 | 800 | 4.0E-08 |
sp|Q07DZ7|ASZ1_ORNAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 | 774 | 919 | 4.0E-08 |
sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 416 | 587 | 4.0E-08 |
sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 453 | 684 | 5.0E-08 |
sp|Q7T3P8|FEM1C_DANRE | Protein fem-1 homolog C OS=Danio rerio GN=fem1c PE=2 SV=2 | 419 | 571 | 5.0E-08 |
sp|Q09YJ3|CTTB2_MUNMU | Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 5.0E-08 |
sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 681 | 860 | 5.0E-08 |
sp|Q8WZ74|CTTB2_HUMAN | Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 | 685 | 878 | 5.0E-08 |
sp|Q2IBF7|CTTB2_GORGO | Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 5.0E-08 |
sp|Q2QL82|CTTB2_MICMU | Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 | 685 | 907 | 5.0E-08 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 773 | 915 | 5.0E-08 |
sp|A6QL64|AN36A_HUMAN | Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 | 450 | 649 | 5.0E-08 |
sp|Q5B0V6|AKR1_EMENI | Palmitoyltransferase akr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=akr1 PE=3 SV=2 | 476 | 652 | 5.0E-08 |
sp|Q9P0K7|RAI14_HUMAN | Ankycorbin OS=Homo sapiens GN=RAI14 PE=1 SV=2 | 453 | 689 | 5.0E-08 |
sp|Q14678|KANK1_HUMAN | KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 | 442 | 602 | 5.0E-08 |
sp|Q8IUH5|ZDH17_HUMAN | Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 | 339 | 553 | 5.0E-08 |
sp|Q5ZXN6|ANKX_LEGPH | Phosphocholine transferase AnkX OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ankX PE=1 SV=1 | 300 | 576 | 5.0E-08 |
sp|Q9NU02|ANKE1_HUMAN | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 | 827 | 919 | 5.0E-08 |
sp|Q9NU02|ANKE1_HUMAN | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 | 436 | 568 | 5.0E-08 |
sp|O35516|NOTC2_MOUSE | Neurogenic locus notch homolog protein 2 OS=Mus musculus GN=Notch2 PE=1 SV=1 | 394 | 637 | 5.0E-08 |
sp|Q6C520|AKR1_YARLI | Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 | 688 | 894 | 5.0E-08 |
sp|Q25338|LITD_LATTR | Delta-latroinsectotoxin-Lt1a OS=Latrodectus tredecimguttatus PE=1 SV=1 | 68 | 492 | 6.0E-08 |
sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 619 | 929 | 6.0E-08 |
sp|Q9BSK4|FEM1A_HUMAN | Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 | 717 | 915 | 6.0E-08 |
sp|P98150|NFKB2_CHICK | Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 | 446 | 650 | 6.0E-08 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 418 | 569 | 6.0E-08 |
sp|Q9J5H8|V023_FOWPN | Putative ankyrin repeat protein FPV023 OS=Fowlpox virus (strain NVSL) GN=FPV023 PE=3 SV=1 | 734 | 898 | 6.0E-08 |
sp|B0G124|Y9043_DICDI | Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 | 481 | 589 | 6.0E-08 |
sp|Q9CQ31|ASB11_MOUSE | Ankyrin repeat and SOCS box protein 11 OS=Mus musculus GN=Asb11 PE=2 SV=1 | 418 | 639 | 6.0E-08 |
sp|Q9BXX2|AN30B_HUMAN | Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 | 585 | 744 | 6.0E-08 |
sp|Q8WVL7|ANR49_HUMAN | Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 | 486 | 609 | 6.0E-08 |
sp|Q04861|NFKB1_CHICK | Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 | 618 | 829 | 6.0E-08 |
sp|Q8WXK4|ASB12_HUMAN | Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 | 398 | 541 | 6.0E-08 |
sp|Q91974|IKBA_CHICK | NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 | 418 | 568 | 6.0E-08 |
sp|P14368|V234_FOWPN | Putative ankyrin repeat protein FPV234 OS=Fowlpox virus (strain NVSL) GN=FPV234 PE=3 SV=2 | 456 | 690 | 6.0E-08 |
sp|Q337A0|XB33_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 | 665 | 884 | 6.0E-08 |
sp|Q53RE8|ANR39_HUMAN | Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 | 778 | 879 | 6.0E-08 |
sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 416 | 587 | 6.0E-08 |
sp|Q8C6Y6|ASB14_MOUSE | Ankyrin repeat and SOCS box protein 14 OS=Mus musculus GN=Asb14 PE=2 SV=2 | 301 | 589 | 7.0E-08 |
sp|Q91ZU0|ASB7_MOUSE | Ankyrin repeat and SOCS box protein 7 OS=Mus musculus GN=Asb7 PE=2 SV=2 | 489 | 747 | 7.0E-08 |
sp|Q5RCK5|ASB7_PONAB | Ankyrin repeat and SOCS box protein 7 OS=Pongo abelii GN=ASB7 PE=2 SV=1 | 489 | 747 | 7.0E-08 |
sp|O60733|PLPL9_HUMAN | 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 | 651 | 911 | 7.0E-08 |
sp|Q2IBE6|CTTB2_PONAB | Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 | 685 | 878 | 7.0E-08 |
sp|P98150|NFKB2_CHICK | Nuclear factor NF-kappa-B p100 subunit OS=Gallus gallus GN=NFKB2 PE=1 SV=1 | 703 | 915 | 7.0E-08 |
sp|A4D7T3|ASZ1_MACEU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 | 772 | 915 | 7.0E-08 |
sp|Q8R516|MIB2_MOUSE | E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 | 631 | 869 | 7.0E-08 |
sp|Q8WXE0|CSKI2_HUMAN | Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 | 486 | 744 | 7.0E-08 |
sp|Q86AT8|SPKA_DICDI | Stress-activated protein kinase alpha OS=Dictyostelium discoideum GN=spkA-1 PE=1 SV=1 | 411 | 638 | 7.0E-08 |
sp|Q05753|AKRP_ARATH | Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 | 685 | 837 | 7.0E-08 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 773 | 915 | 7.0E-08 |
sp|Q9TXQ1|TNKS1_CAEEL | Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 | 423 | 707 | 7.0E-08 |
sp|A1ZBY1|FEM1B_DROME | Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 | 784 | 915 | 7.0E-08 |
sp|Q9BXX3|AN30A_HUMAN | Ankyrin repeat domain-containing protein 30A OS=Homo sapiens GN=ANKRD30A PE=2 SV=3 | 773 | 911 | 7.0E-08 |
sp|Q63369|NFKB1_RAT | Nuclear factor NF-kappa-B p105 subunit (Fragment) OS=Rattus norvegicus GN=Nfkb1 PE=1 SV=1 | 418 | 595 | 7.0E-08 |
sp|Q91ZT9|ASB8_MOUSE | Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 | 523 | 689 | 7.0E-08 |
sp|Q554E7|ZDHC5_DICDI | Putative ZDHHC-type palmitoyltransferase 5 OS=Dictyostelium discoideum GN=DDB_G0275097 PE=3 SV=1 | 56 | 263 | 7.0E-08 |
sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 684 | 928 | 8.0E-08 |
sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 749 | 915 | 8.0E-08 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 577 | 759 | 8.0E-08 |
sp|Q5ZIJ9|MIB2_CHICK | E3 ubiquitin-protein ligase MIB2 OS=Gallus gallus GN=MIB2 PE=2 SV=1 | 78 | 404 | 8.0E-08 |
sp|Q07DX4|CTTB2_NOMLE | Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 8.0E-08 |
sp|Q07DV1|CTTB2_AOTNA | Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 8.0E-08 |
sp|Q9SQK3|EM506_ARATH | Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 | 419 | 541 | 8.0E-08 |
sp|Q08E43|ASB8_BOVIN | Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 | 523 | 689 | 8.0E-08 |
sp|Q8TAK5|GABP2_HUMAN | GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 | 520 | 643 | 8.0E-08 |
sp|Q91974|IKBA_CHICK | NF-kappa-B inhibitor alpha OS=Gallus gallus GN=NFKBIA PE=2 SV=1 | 718 | 883 | 8.0E-08 |
sp|Q7S3M5|AKR1_NEUCR | Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 | 518 | 692 | 8.0E-08 |
sp|Q8VHA6|ASB18_MOUSE | Ankyrin repeat and SOCS box protein 18 OS=Mus musculus GN=Asb18 PE=2 SV=1 | 713 | 915 | 8.0E-08 |
sp|Q9HLN1|Y196_THEAC | Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 | 785 | 933 | 8.0E-08 |
sp|Q8N961|ABTB2_HUMAN | Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Homo sapiens GN=ABTB2 PE=2 SV=2 | 474 | 627 | 8.0E-08 |
sp|Q875S9|AKR1_LACK1 | Palmitoyltransferase AKR1 OS=Lachancea kluyveri (strain ATCC 58438 / CBS 3082 / CCRC 21498 / NBRC 1685 / JCM 7257 / NCYC 543 / NRRL Y-12651) GN=AKR1 PE=3 SV=1 | 664 | 858 | 8.0E-08 |
sp|Q54KH3|ANR39_DICDI | Ankyrin repeat domain-containing protein 39 homolog OS=Dictyostelium discoideum GN=ankrd39 PE=3 SV=2 | 429 | 553 | 8.0E-08 |
sp|Q9H672|ASB7_HUMAN | Ankyrin repeat and SOCS box protein 7 OS=Homo sapiens GN=ASB7 PE=1 SV=2 | 489 | 747 | 9.0E-08 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 290 | 498 | 9.0E-08 |
sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 303 | 485 | 9.0E-08 |
sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 584 | 745 | 9.0E-08 |
sp|O44997|DAPK_CAEEL | Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 | 690 | 912 | 9.0E-08 |
sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 453 | 652 | 9.0E-08 |
sp|Q5TYW2|A20A1_HUMAN | Ankyrin repeat domain-containing protein 20A1 OS=Homo sapiens GN=ANKRD20A1 PE=2 SV=1 | 759 | 917 | 9.0E-08 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 292 | 473 | 9.0E-08 |
sp|Q5JPF3|AN36C_HUMAN | Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 | 500 | 718 | 9.0E-08 |
sp|Q5SQ80|A20A2_HUMAN | Ankyrin repeat domain-containing protein 20A2 OS=Homo sapiens GN=ANKRD20A2 PE=3 SV=1 | 759 | 917 | 9.0E-08 |
sp|Q5VUR7|A20A3_HUMAN | Ankyrin repeat domain-containing protein 20A3 OS=Homo sapiens GN=ANKRD20A3 PE=3 SV=1 | 759 | 917 | 9.0E-08 |
sp|A2VDR2|ACBD6_BOVIN | Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 | 45 | 140 | 9.0E-08 |
sp|Q9ERK0|RIPK4_MOUSE | Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus GN=Ripk4 PE=1 SV=2 | 262 | 576 | 1.0E-07 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 414 | 557 | 1.0E-07 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 764 | 918 | 1.0E-07 |
sp|Q9H9B1|EHMT1_HUMAN | Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens GN=EHMT1 PE=1 SV=4 | 82 | 351 | 1.0E-07 |
sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 301 | 576 | 1.0E-07 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 299 | 489 | 1.0E-07 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 74 | 341 | 1.0E-07 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 760 | 922 | 1.0E-07 |
sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 710 | 881 | 1.0E-07 |
sp|Q00PJ1|CTTB2_ATEAB | Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 1.0E-07 |
sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 476 | 637 | 1.0E-07 |
sp|Q6AWW5|Y5262_ARATH | Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 | 484 | 740 | 1.0E-07 |
sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 678 | 914 | 1.0E-07 |
sp|Q7Z020|TRPA1_DROME | Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=4 | 543 | 865 | 1.0E-07 |
sp|Q2QLF8|CTTB2_CALJA | Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 1.0E-07 |
sp|Q8VHS5|ASB16_MOUSE | Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 | 416 | 653 | 1.0E-07 |
sp|Q07E28|CTTB2_NEONE | Cortactin-binding protein 2 OS=Neofelis nebulosa GN=CTTNBP2 PE=3 SV=1 | 585 | 805 | 1.0E-07 |
sp|A0M8T5|CTTB2_FELCA | Cortactin-binding protein 2 OS=Felis catus GN=CTTNBP2 PE=3 SV=1 | 585 | 805 | 1.0E-07 |
sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 791 | 926 | 1.0E-07 |
sp|O73630|NFKB2_XENLA | Nuclear factor NF-kappa-B p100 subunit OS=Xenopus laevis GN=nfkb2 PE=2 SV=1 | 537 | 829 | 1.0E-07 |
sp|O73630|NFKB2_XENLA | Nuclear factor NF-kappa-B p100 subunit OS=Xenopus laevis GN=nfkb2 PE=2 SV=1 | 703 | 935 | 1.0E-07 |
sp|A1X157|CTTB2_ECHTE | Cortactin-binding protein 2 OS=Echinops telfairi GN=CTTNBP2 PE=3 SV=1 | 683 | 878 | 1.0E-07 |
sp|Q5UQV3|YL371_MIMIV | Putative ankyrin repeat protein L371 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L371 PE=3 SV=1 | 491 | 743 | 1.0E-07 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 799 | 918 | 1.0E-07 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 418 | 538 | 1.0E-07 |
sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 480 | 682 | 1.0E-07 |
sp|Q9WTK5|NFKB2_MOUSE | Nuclear factor NF-kappa-B p100 subunit OS=Mus musculus GN=Nfkb2 PE=1 SV=1 | 446 | 653 | 1.0E-07 |
sp|Q5EA33|ANR49_BOVIN | Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 | 407 | 562 | 1.0E-07 |
sp|Q5EA33|ANR49_BOVIN | Ankyrin repeat domain-containing protein 49 OS=Bos taurus GN=ANKRD49 PE=2 SV=1 | 486 | 609 | 1.0E-07 |
sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 705 | 921 | 1.0E-07 |
sp|Q9BXX2|AN30B_HUMAN | Ankyrin repeat domain-containing protein 30B OS=Homo sapiens GN=ANKRD30B PE=2 SV=3 | 772 | 911 | 1.0E-07 |
sp|Q5R6D7|ASB8_PONAB | Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 | 523 | 689 | 1.0E-07 |
sp|Q9H765|ASB8_HUMAN | Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 | 523 | 689 | 1.0E-07 |
sp|Q5UPA0|YL025_MIMIV | Putative ankyrin repeat protein L25 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L25 PE=3 SV=1 | 614 | 937 | 1.0E-07 |
sp|Q38998|AKT1_ARATH | Potassium channel AKT1 OS=Arabidopsis thaliana GN=AKT1 PE=1 SV=2 | 622 | 880 | 1.0E-07 |
sp|Q54XX5|Y9849_DICDI | Probable serine/threonine-protein kinase DDB_G0278535 OS=Dictyostelium discoideum GN=DDB_G0278535 PE=3 SV=1 | 687 | 912 | 1.0E-07 |
sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 452 | 660 | 1.0E-07 |
sp|Q9HLN1|Y196_THEAC | Putative ankyrin repeat protein Ta0196 OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=Ta0196 PE=3 SV=1 | 785 | 914 | 1.0E-07 |
sp|Q7TQI7|ABTB2_MOUSE | Ankyrin repeat and BTB/POZ domain-containing protein 2 OS=Mus musculus GN=Abtb2 PE=1 SV=1 | 474 | 604 | 1.0E-07 |
sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 791 | 919 | 1.0E-07 |
sp|Q80TN5|ZDH17_MOUSE | Palmitoyltransferase ZDHHC17 OS=Mus musculus GN=Zdhhc17 PE=1 SV=2 | 339 | 553 | 1.0E-07 |
sp|E9PTT0|ZDH17_RAT | Palmitoyltransferase ZDHHC17 OS=Rattus norvegicus GN=Zdhhc17 PE=1 SV=1 | 339 | 553 | 1.0E-07 |
sp|Q6P9J5|KANK4_MOUSE | KN motif and ankyrin repeat domain-containing protein 4 OS=Mus musculus GN=Kank4 PE=1 SV=1 | 442 | 589 | 1.0E-07 |
sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 416 | 587 | 1.0E-07 |
sp|Q7EZ44|XB35_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 | 585 | 854 | 1.0E-07 |
sp|Q09YK6|ASZ1_ATEGE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 | 456 | 612 | 1.0E-07 |
sp|Q1RJR6|Y317_RICBR | Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 | 53 | 175 | 1.0E-07 |
sp|Q8CGB3|UACA_MOUSE | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 | 300 | 512 | 1.0E-07 |
sp|Q5XJ13|ANKS6_DANRE | Ankyrin repeat and SAM domain-containing protein 6 OS=Danio rerio GN=anks6 PE=2 SV=1 | 632 | 893 | 1.0E-07 |
sp|Q876A6|AKR1_NAUCC | Palmitoyltransferase AKR1 OS=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) GN=AKR1 PE=3 SV=3 | 489 | 655 | 1.0E-07 |
sp|Q95N27|PP16B_BOVIN | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Bos taurus GN=PPP1R16B PE=1 SV=1 | 465 | 671 | 2.0E-07 |
sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 681 | 903 | 2.0E-07 |
sp|Q8VHQ3|PP16B_MOUSE | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Mus musculus GN=Ppp1r16b PE=1 SV=1 | 465 | 671 | 2.0E-07 |
sp|Q54HW1|PSD10_DICDI | 26S proteasome non-ATPase regulatory subunit 10 OS=Dictyostelium discoideum GN=psmD10 PE=2 SV=1 | 770 | 919 | 2.0E-07 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 560 | 856 | 2.0E-07 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 418 | 556 | 2.0E-07 |
sp|Q1RHT6|Y997_RICBR | Putative ankyrin repeat protein RBE_0997 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0997 PE=3 SV=1 | 520 | 852 | 2.0E-07 |
sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 783 | 926 | 2.0E-07 |
sp|Q8N6D5|ANR29_HUMAN | Ankyrin repeat domain-containing protein 29 OS=Homo sapiens GN=ANKRD29 PE=2 SV=2 | 531 | 744 | 2.0E-07 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 77 | 346 | 2.0E-07 |
sp|O44997|DAPK_CAEEL | Death-associated protein kinase dapk-1 OS=Caenorhabditis elegans GN=dapk-1 PE=2 SV=2 | 584 | 930 | 2.0E-07 |
sp|P0C550|AKT1_ORYSI | Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 | 646 | 836 | 2.0E-07 |
sp|Q0JKV1|AKT1_ORYSJ | Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 | 646 | 836 | 2.0E-07 |
sp|Q9BSK4|FEM1A_HUMAN | Protein fem-1 homolog A OS=Homo sapiens GN=FEM1A PE=1 SV=1 | 687 | 894 | 2.0E-07 |
sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 678 | 914 | 2.0E-07 |
sp|Q2QLB3|CTTB2_CALMO | Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 2.0E-07 |
sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 453 | 570 | 2.0E-07 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 721 | 907 | 2.0E-07 |
sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 794 | 915 | 2.0E-07 |
sp|Q812A3|ANR23_MOUSE | Ankyrin repeat domain-containing protein 23 OS=Mus musculus GN=Ankrd23 PE=2 SV=1 | 418 | 571 | 2.0E-07 |
sp|Q4X251|AKR1_ASPFU | Palmitoyltransferase akr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=akr1 PE=3 SV=2 | 664 | 857 | 2.0E-07 |
sp|Q5UQV3|YL371_MIMIV | Putative ankyrin repeat protein L371 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L371 PE=3 SV=1 | 689 | 915 | 2.0E-07 |
sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 759 | 917 | 2.0E-07 |
sp|A1ZBY1|FEM1B_DROME | Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 | 672 | 880 | 2.0E-07 |
sp|A1ZBY1|FEM1B_DROME | Protein fem-1 homolog B OS=Drosophila melanogaster GN=Fem-1 PE=2 SV=1 | 779 | 915 | 2.0E-07 |
sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 520 | 642 | 2.0E-07 |
sp|Q8VD46|ASZ1_MOUSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 | 469 | 652 | 2.0E-07 |
sp|P57044|ILK_CAVPO | Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 | 798 | 915 | 2.0E-07 |
sp|Q3SWY2|ILK_BOVIN | Integrin-linked protein kinase OS=Bos taurus GN=ILK PE=2 SV=1 | 798 | 915 | 2.0E-07 |
sp|Q13418|ILK_HUMAN | Integrin-linked protein kinase OS=Homo sapiens GN=ILK PE=1 SV=2 | 798 | 915 | 2.0E-07 |
sp|Q5R5V4|ILK_PONAB | Integrin-linked protein kinase OS=Pongo abelii GN=ILK PE=2 SV=1 | 798 | 915 | 2.0E-07 |
sp|Q99J82|ILK_RAT | Integrin-linked protein kinase OS=Rattus norvegicus GN=Ilk PE=2 SV=1 | 798 | 915 | 2.0E-07 |
sp|O55222|ILK_MOUSE | Integrin-linked protein kinase OS=Mus musculus GN=Ilk PE=1 SV=2 | 798 | 915 | 2.0E-07 |
sp|Q4R544|ASB8_MACFA | Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 | 523 | 689 | 2.0E-07 |
sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 520 | 643 | 2.0E-07 |
sp|Q8WXH4|ASB11_HUMAN | Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 | 418 | 639 | 2.0E-07 |
sp|Q6C520|AKR1_YARLI | Palmitoyltransferase AKR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AKR1 PE=3 SV=1 | 519 | 733 | 2.0E-07 |
sp|Q1LZH7|KANK2_BOVIN | KN motif and ankyrin repeat domain-containing protein 2 OS=Bos taurus GN=KANK2 PE=2 SV=1 | 442 | 608 | 2.0E-07 |
sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 416 | 587 | 2.0E-07 |
sp|P50086|PSD10_YEAST | Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 | 688 | 885 | 2.0E-07 |
sp|P39010|AKR1_YEAST | Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 | 475 | 655 | 2.0E-07 |
sp|Q5UPB9|YL042_MIMIV | Putative ankyrin repeat protein L42 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L42 PE=3 SV=1 | 419 | 637 | 2.0E-07 |
sp|Q9BZL4|PP12C_HUMAN | Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 | 528 | 726 | 2.0E-07 |
sp|Q5URB8|YR841_MIMIV | Putative ankyrin repeat protein R841 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R841 PE=3 SV=1 | 607 | 897 | 2.0E-07 |
sp|Q9Z205|RFXK_MOUSE | DNA-binding protein RFXANK OS=Mus musculus GN=Rfxank PE=2 SV=1 | 785 | 906 | 2.0E-07 |
sp|Q5UR87|YR634_MIMIV | Putative ankyrin repeat protein R634 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R634 PE=3 SV=1 | 556 | 915 | 2.0E-07 |
sp|Q5UPU4|YR267_MIMIV | Putative ankyrin repeat protein R267 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R267 PE=3 SV=1 | 456 | 706 | 2.0E-07 |
sp|Q96NS5|ASB16_HUMAN | Ankyrin repeat and SOCS box protein 16 OS=Homo sapiens GN=ASB16 PE=1 SV=2 | 485 | 699 | 2.0E-07 |
sp|Q6DRG7|MYPT1_DANRE | Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 | 453 | 679 | 2.0E-07 |
sp|Q9J507|V228_FOWPN | Putative ankyrin repeat protein FPV228 OS=Fowlpox virus (strain NVSL) GN=FPV228 PE=3 SV=1 | 189 | 571 | 3.0E-07 |
sp|Q96T49|PP16B_HUMAN | Protein phosphatase 1 regulatory inhibitor subunit 16B OS=Homo sapiens GN=PPP1R16B PE=1 SV=1 | 396 | 671 | 3.0E-07 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 777 | 915 | 3.0E-07 |
sp|Q96JP0|FEM1C_HUMAN | Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 | 684 | 877 | 3.0E-07 |
sp|A7MB89|FEM1C_BOVIN | Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 | 684 | 877 | 3.0E-07 |
sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 769 | 914 | 3.0E-07 |
sp|Q5GIG6|TNI3K_MOUSE | Serine/threonine-protein kinase TNNI3K OS=Mus musculus GN=Tnni3k PE=2 SV=4 | 791 | 920 | 3.0E-07 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 697 | 898 | 3.0E-07 |
sp|Q66H07|FANK1_RAT | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Rattus norvegicus GN=Fank1 PE=2 SV=1 | 749 | 915 | 3.0E-07 |
sp|Q9GKW8|AND1A_MACFA | Ankyrin repeat and death domain-containing protein 1A (Fragment) OS=Macaca fascicularis GN=ANKDD1A PE=2 SV=3 | 74 | 199 | 3.0E-07 |
sp|Q6UB98|ANR12_HUMAN | Ankyrin repeat domain-containing protein 12 OS=Homo sapiens GN=ANKRD12 PE=1 SV=3 | 518 | 603 | 3.0E-07 |
sp|Q9VFD5|FEM1A_DROME | Protein fem-1 homolog CG6966 OS=Drosophila melanogaster GN=CG6966 PE=2 SV=2 | 620 | 877 | 3.0E-07 |
sp|Q09YG9|CTTB2_SAIBB | Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 3.0E-07 |
sp|Q3V096|ANR42_MOUSE | Ankyrin repeat domain-containing protein 42 OS=Mus musculus GN=Ankrd42 PE=2 SV=1 | 418 | 652 | 3.0E-07 |
sp|P0C550|AKT1_ORYSI | Potassium channel AKT1 OS=Oryza sativa subsp. indica GN=AKT1 PE=2 SV=1 | 420 | 602 | 3.0E-07 |
sp|Q0JKV1|AKT1_ORYSJ | Potassium channel AKT1 OS=Oryza sativa subsp. japonica GN=AKT1 PE=2 SV=1 | 420 | 602 | 3.0E-07 |
sp|Q8WXD9|CSKI1_HUMAN | Caskin-1 OS=Homo sapiens GN=CASKIN1 PE=1 SV=1 | 678 | 914 | 3.0E-07 |
sp|Q96I34|PP16A_HUMAN | Protein phosphatase 1 regulatory subunit 16A OS=Homo sapiens GN=PPP1R16A PE=1 SV=1 | 383 | 656 | 3.0E-07 |
sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 475 | 655 | 3.0E-07 |
sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 475 | 655 | 3.0E-07 |
sp|Q8IVF6|AN18A_HUMAN | Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 | 721 | 881 | 3.0E-07 |
sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 475 | 655 | 3.0E-07 |
sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 418 | 568 | 3.0E-07 |
sp|Q6GPE5|FEM1B_XENLA | Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 | 273 | 503 | 3.0E-07 |
sp|Q6GPE5|FEM1B_XENLA | Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 | 551 | 739 | 3.0E-07 |
sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 721 | 883 | 3.0E-07 |
sp|Q4UJ75|A20A4_HUMAN | Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 | 759 | 917 | 3.0E-07 |
sp|Q9M8S6|SKOR_ARATH | Potassium channel SKOR OS=Arabidopsis thaliana GN=SKOR PE=1 SV=1 | 515 | 661 | 3.0E-07 |
sp|Q9TXQ1|TNKS1_CAEEL | Tankyrase-like protein OS=Caenorhabditis elegans GN=tank-1 PE=2 SV=1 | 590 | 902 | 3.0E-07 |
sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 451 | 655 | 3.0E-07 |
sp|Q7ZT11|ANKR1_CHICK | Ankyrin repeat domain-containing protein 1 OS=Gallus gallus GN=ANKRD1 PE=2 SV=1 | 531 | 703 | 3.0E-07 |
sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 769 | 913 | 3.0E-07 |
sp|Q5ZXN6|ANKX_LEGPH | Phosphocholine transferase AnkX OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ankX PE=1 SV=1 | 482 | 922 | 3.0E-07 |
sp|Q7S3M5|AKR1_NEUCR | Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 | 689 | 894 | 3.0E-07 |
sp|P77736|YAHD_ECOLI | Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 | 421 | 603 | 3.0E-07 |
sp|P25799|NFKB1_MOUSE | Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus GN=Nfkb1 PE=1 SV=2 | 701 | 905 | 3.0E-07 |
sp|Q80VM7|ANR24_MOUSE | Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 | 726 | 915 | 3.0E-07 |
sp|Q21920|ANKHM_CAEEL | Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=3 SV=3 | 298 | 569 | 4.0E-07 |
sp|Q5DW34|EHMT1_MOUSE | Histone-lysine N-methyltransferase EHMT1 OS=Mus musculus GN=Ehmt1 PE=1 SV=2 | 684 | 899 | 4.0E-07 |
sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 415 | 674 | 4.0E-07 |
sp|Q8CEF1|FEM1C_MOUSE | Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 | 684 | 877 | 4.0E-07 |
sp|Q8WXK3|ASB13_HUMAN | Ankyrin repeat and SOCS box protein 13 OS=Homo sapiens GN=ASB13 PE=1 SV=2 | 790 | 915 | 4.0E-07 |
sp|Q8VBX0|ASB13_MOUSE | Ankyrin repeat and SOCS box protein 13 OS=Mus musculus GN=Asb13 PE=2 SV=1 | 790 | 915 | 4.0E-07 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 760 | 922 | 4.0E-07 |
sp|Q9DAM9|FANK1_MOUSE | Fibronectin type 3 and ankyrin repeat domains 1 protein OS=Mus musculus GN=Fank1 PE=1 SV=1 | 749 | 915 | 4.0E-07 |
sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 692 | 883 | 4.0E-07 |
sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 551 | 794 | 4.0E-07 |
sp|Q8VHK1|CSKI2_MOUSE | Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 | 486 | 744 | 4.0E-07 |
sp|Q07DX4|CTTB2_NOMLE | Cortactin-binding protein 2 OS=Nomascus leucogenys GN=CTTNBP2 PE=3 SV=1 | 585 | 805 | 4.0E-07 |
sp|Q09YI1|CTTB2_SHEEP | Cortactin-binding protein 2 OS=Ovis aries GN=CTTNBP2 PE=3 SV=1 | 577 | 759 | 4.0E-07 |
sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 475 | 655 | 4.0E-07 |
sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 681 | 877 | 4.0E-07 |
sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 418 | 568 | 4.0E-07 |
sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 74 | 203 | 4.0E-07 |
sp|Q90623|MYPT1_CHICK | Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 | 635 | 832 | 4.0E-07 |
sp|Q2QLC6|ASZ1_CARPS | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 | 692 | 894 | 4.0E-07 |
sp|Q10728|MYPT1_RAT | Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 | 635 | 832 | 4.0E-07 |
sp|Q9DBR7|MYPT1_MOUSE | Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 | 635 | 832 | 4.0E-07 |
sp|Q2IBB4|ASZ1_RHIFE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 | 810 | 894 | 4.0E-07 |
sp|Q876L5|AKR1_SACU7 | Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 | 680 | 858 | 4.0E-07 |
sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 518 | 655 | 4.0E-07 |
sp|Q04861|NFKB1_CHICK | Nuclear factor NF-kappa-B p105 subunit OS=Gallus gallus GN=NFKB1 PE=2 SV=2 | 518 | 658 | 4.0E-07 |
sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 723 | 912 | 4.0E-07 |
sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 453 | 655 | 4.0E-07 |
sp|Q9NU02|ANKE1_HUMAN | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 | 587 | 706 | 4.0E-07 |
sp|Q8VHA6|ASB18_MOUSE | Ankyrin repeat and SOCS box protein 18 OS=Mus musculus GN=Asb18 PE=2 SV=1 | 484 | 692 | 4.0E-07 |
sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 448 | 620 | 4.0E-07 |
sp|Q9QZH2|BARD1_RAT | BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 | 78 | 171 | 4.0E-07 |
sp|P0C7A6|BTBBB_DANRE | Ankyrin repeat and BTB/POZ domain-containing protein BTBD11-B OS=Danio rerio GN=btbd11b PE=3 SV=1 | 473 | 604 | 4.0E-07 |
sp|Q9WV71|ASB4_MOUSE | Ankyrin repeat and SOCS box protein 4 OS=Mus musculus GN=Asb4 PE=1 SV=1 | 713 | 919 | 4.0E-07 |
sp|Q6KAE5|XB32_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 | 486 | 710 | 4.0E-07 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 70 | 203 | 5.0E-07 |
sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 292 | 540 | 5.0E-07 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 697 | 898 | 5.0E-07 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 418 | 538 | 5.0E-07 |
sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 773 | 911 | 5.0E-07 |
sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 453 | 620 | 5.0E-07 |
sp|Q91ZT8|ASB9_MOUSE | Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 | 415 | 580 | 5.0E-07 |
sp|Q6S8J7|POTEA_HUMAN | POTE ankyrin domain family member A OS=Homo sapiens GN=POTEA PE=2 SV=1 | 472 | 642 | 5.0E-07 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 773 | 915 | 5.0E-07 |
sp|Q09YK4|CTTB2_ATEGE | Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 5.0E-07 |
sp|Q9J5I9|V012_FOWPN | Putative ankyrin repeat protein FPV012 OS=Fowlpox virus (strain NVSL) GN=FPV012 PE=3 SV=1 | 515 | 643 | 5.0E-07 |
sp|Q8TAK5|GABP2_HUMAN | GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 | 792 | 883 | 5.0E-07 |
sp|Q8WXK4|ASB12_HUMAN | Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 | 827 | 924 | 5.0E-07 |
sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 516 | 655 | 5.0E-07 |
sp|Q7EZ44|XB35_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 | 449 | 635 | 5.0E-07 |
sp|P77736|YAHD_ECOLI | Putative ankyrin repeat protein YahD OS=Escherichia coli (strain K12) GN=yahD PE=3 SV=1 | 487 | 676 | 5.0E-07 |
sp|Q9H9E1|ANRA2_HUMAN | Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 | 420 | 571 | 5.0E-07 |
sp|P25963|IKBA_HUMAN | NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 | 418 | 586 | 5.0E-07 |
sp|O14593|RFXK_HUMAN | DNA-binding protein RFXANK OS=Homo sapiens GN=RFXANK PE=1 SV=2 | 683 | 913 | 5.0E-07 |
sp|Q2KI79|ANRA2_BOVIN | Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 | 420 | 571 | 5.0E-07 |
sp|P55273|CDN2D_HUMAN | Cyclin-dependent kinase 4 inhibitor D OS=Homo sapiens GN=CDKN2D PE=1 SV=1 | 460 | 571 | 5.0E-07 |
sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 55 | 203 | 6.0E-07 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 721 | 898 | 6.0E-07 |
sp|Q80SY4|MIB1_MOUSE | E3 ubiquitin-protein ligase MIB1 OS=Mus musculus GN=Mib1 PE=1 SV=1 | 689 | 914 | 6.0E-07 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 76 | 216 | 6.0E-07 |
sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 769 | 924 | 6.0E-07 |
sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 556 | 706 | 6.0E-07 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 799 | 918 | 6.0E-07 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 569 | 759 | 6.0E-07 |
sp|Q5DU14|MYO16_MOUSE | Unconventional myosin-XVI OS=Mus musculus GN=Myo16 PE=1 SV=2 | 435 | 663 | 6.0E-07 |
sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 475 | 655 | 6.0E-07 |
sp|B0G124|Y9043_DICDI | Ankyrin repeat-containing protein DDB_G0279043 OS=Dictyostelium discoideum GN=DDB_G0279043 PE=3 SV=1 | 523 | 654 | 6.0E-07 |
sp|O14974|MYPT1_HUMAN | Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 | 635 | 832 | 6.0E-07 |
sp|O14974|MYPT1_HUMAN | Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens GN=PPP1R12A PE=1 SV=1 | 723 | 913 | 6.0E-07 |
sp|Q2IBB1|ASZ1_CHLAE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 | 772 | 915 | 6.0E-07 |
sp|Q8WMX7|ASZ1_PAPAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 | 772 | 915 | 6.0E-07 |
sp|Q10728|MYPT1_RAT | Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus GN=Ppp1r12a PE=1 SV=2 | 723 | 913 | 6.0E-07 |
sp|Q9DBR7|MYPT1_MOUSE | Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus GN=Ppp1r12a PE=1 SV=2 | 723 | 913 | 6.0E-07 |
sp|Q08E43|ASB8_BOVIN | Ankyrin repeat and SOCS box protein 8 OS=Bos taurus GN=ASB8 PE=2 SV=1 | 617 | 747 | 6.0E-07 |
sp|Q5R6D7|ASB8_PONAB | Ankyrin repeat and SOCS box protein 8 OS=Pongo abelii GN=ASB8 PE=2 SV=1 | 617 | 747 | 6.0E-07 |
sp|Q9H765|ASB8_HUMAN | Ankyrin repeat and SOCS box protein 8 OS=Homo sapiens GN=ASB8 PE=2 SV=1 | 617 | 747 | 6.0E-07 |
sp|Q5RFS1|ASB11_PONAB | Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 | 418 | 639 | 6.0E-07 |
sp|Q07DZ7|ASZ1_ORNAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ornithorhynchus anatinus GN=ASZ1 PE=3 SV=1 | 618 | 744 | 6.0E-07 |
sp|Q7S3M5|AKR1_NEUCR | Palmitoyltransferase akr1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ptr-1 PE=3 SV=2 | 478 | 652 | 6.0E-07 |
sp|Q6DRG7|MYPT1_DANRE | Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio GN=ppp1r12a PE=2 SV=2 | 635 | 832 | 6.0E-07 |
sp|Q94B55|XB31_ARATH | Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 | 563 | 744 | 6.0E-07 |
sp|Q7T0Q1|MTPN_XENLA | Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 | 420 | 536 | 6.0E-07 |
sp|Q6NLQ8|XB32_ARATH | E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 | 449 | 635 | 6.0E-07 |
sp|P19838|NFKB1_HUMAN | Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens GN=NFKB1 PE=1 SV=2 | 645 | 905 | 6.0E-07 |
sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 687 | 887 | 7.0E-07 |
sp|Q2IBB2|CTTB2_RHIFE | Cortactin-binding protein 2 OS=Rhinolophus ferrumequinum GN=CTTNBP2 PE=3 SV=1 | 587 | 805 | 7.0E-07 |
sp|Q00PJ1|CTTB2_ATEAB | Cortactin-binding protein 2 OS=Atelerix albiventris GN=CTTNBP2 PE=3 SV=1 | 575 | 759 | 7.0E-07 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 796 | 922 | 7.0E-07 |
sp|Q5ZM55|FEM1B_CHICK | Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 | 661 | 937 | 7.0E-07 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 76 | 195 | 7.0E-07 |
sp|Q2QL82|CTTB2_MICMU | Cortactin-binding protein 2 OS=Microcebus murinus GN=CTTNBP2 PE=3 SV=1 | 575 | 764 | 7.0E-07 |
sp|Q07DY4|CTTB2_COLGU | Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 | 444 | 607 | 7.0E-07 |
sp|A0M8S4|CTTB2_PAPAN | Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 | 444 | 607 | 7.0E-07 |
sp|Q2IBA2|CTTB2_CHLAE | Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 | 444 | 607 | 7.0E-07 |
sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 590 | 747 | 7.0E-07 |
sp|Q07DZ5|CTTB2_ORNAN | Cortactin-binding protein 2 OS=Ornithorhynchus anatinus GN=CTTNBP2 PE=3 SV=1 | 577 | 889 | 7.0E-07 |
sp|Q653P0|KOR1_ORYSJ | Potassium channel KOR1 OS=Oryza sativa subsp. japonica GN=Os06g0250600 PE=2 SV=1 | 515 | 677 | 7.0E-07 |
sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 475 | 655 | 7.0E-07 |
sp|Q2QLA4|ASZ1_HORSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 | 772 | 915 | 7.0E-07 |
sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 451 | 655 | 7.0E-07 |
sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 418 | 573 | 7.0E-07 |
sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 551 | 653 | 7.0E-07 |
sp|P81069|GABP2_MOUSE | GA-binding protein subunit beta-2 OS=Mus musculus GN=Gabpb2 PE=1 SV=2 | 787 | 883 | 7.0E-07 |
sp|Q91ZT9|ASB8_MOUSE | Ankyrin repeat and SOCS box protein 8 OS=Mus musculus GN=Asb8 PE=2 SV=1 | 617 | 747 | 7.0E-07 |
sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 464 | 653 | 7.0E-07 |
sp|Q7XUW4|KOR2_ORYSJ | Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 | 435 | 606 | 7.0E-07 |
sp|Q4UMH6|Y381_RICFE | Putative ankyrin repeat protein RF_0381 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=RF_0381 PE=3 SV=1 | 59 | 384 | 8.0E-07 |
sp|Q96JP0|FEM1C_HUMAN | Protein fem-1 homolog C OS=Homo sapiens GN=FEM1C PE=1 SV=1 | 352 | 571 | 8.0E-07 |
sp|A7MB89|FEM1C_BOVIN | Protein fem-1 homolog C OS=Bos taurus GN=FEM1C PE=2 SV=1 | 352 | 571 | 8.0E-07 |
sp|A5PMU4|ANS1B_DANRE | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 | 69 | 208 | 8.0E-07 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 796 | 922 | 8.0E-07 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 76 | 216 | 8.0E-07 |
sp|Q6AWW5|Y5262_ARATH | Ankyrin repeat-containing protein At5g02620 OS=Arabidopsis thaliana GN=At5g02620 PE=1 SV=1 | 45 | 321 | 8.0E-07 |
sp|Q8N2N9|AN36B_HUMAN | Ankyrin repeat domain-containing protein 36B OS=Homo sapiens GN=ANKRD36B PE=1 SV=4 | 418 | 571 | 8.0E-07 |
sp|Q2QLB3|CTTB2_CALMO | Cortactin-binding protein 2 OS=Callicebus moloch GN=CTTNBP2 PE=3 SV=1 | 585 | 739 | 8.0E-07 |
sp|A4D7T3|ASZ1_MACEU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 | 590 | 744 | 8.0E-07 |
sp|Q8R516|MIB2_MOUSE | E3 ubiquitin-protein ligase MIB2 OS=Mus musculus GN=Mib2 PE=1 SV=2 | 551 | 867 | 8.0E-07 |
sp|Q4R3S3|ANKR7_MACFA | Ankyrin repeat domain-containing protein 7 OS=Macaca fascicularis GN=ANKRD7 PE=2 SV=1 | 773 | 915 | 8.0E-07 |
sp|Q9J5I7|V014_FOWPN | Putative ankyrin repeat protein FPV014 OS=Fowlpox virus (strain NVSL) GN=FPV014 PE=3 SV=1 | 797 | 926 | 8.0E-07 |
sp|Q2IBF8|CTTB2_EULMM | Cortactin-binding protein 2 OS=Eulemur macaco macaco GN=CTTNBP2 PE=3 SV=1 | 557 | 759 | 8.0E-07 |
sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 418 | 568 | 8.0E-07 |
sp|Q07DX6|ASZ1_NOMLE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 | 772 | 915 | 8.0E-07 |
sp|Q8WMX6|ASZ1_PANTR | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 | 772 | 915 | 8.0E-07 |
sp|Q2IBF5|ASZ1_GORGO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 | 772 | 915 | 8.0E-07 |
sp|Q1RMI3|GABP1_BOVIN | GA-binding protein subunit beta-1 OS=Bos taurus GN=GABPB1 PE=2 SV=1 | 418 | 566 | 8.0E-07 |
sp|Q80VM7|ANR24_MOUSE | Ankyrin repeat domain-containing protein 24 OS=Mus musculus GN=Ankrd24 PE=2 SV=4 | 514 | 714 | 8.0E-07 |
sp|Q99NH0|ANR17_MOUSE | Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 | 59 | 515 | 9.0E-07 |
sp|A2AS55|ANR16_MOUSE | Ankyrin repeat domain-containing protein 16 OS=Mus musculus GN=Ankrd16 PE=2 SV=1 | 746 | 911 | 9.0E-07 |
sp|Q804S5|MIB1_DANRE | E3 ubiquitin-protein ligase mib1 OS=Danio rerio GN=mib1 PE=1 SV=1 | 707 | 914 | 9.0E-07 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 76 | 216 | 9.0E-07 |
sp|Q5U312|RAI14_RAT | Ankycorbin OS=Rattus norvegicus GN=Rai14 PE=1 SV=2 | 112 | 203 | 9.0E-07 |
sp|Q108T9|CTTB2_LOXAF | Cortactin-binding protein 2 OS=Loxodonta africana GN=CTTNBP2 PE=3 SV=1 | 575 | 759 | 9.0E-07 |
sp|O73630|NFKB2_XENLA | Nuclear factor NF-kappa-B p100 subunit OS=Xenopus laevis GN=nfkb2 PE=2 SV=1 | 418 | 579 | 9.0E-07 |
sp|Q8WWX0|ASB5_HUMAN | Ankyrin repeat and SOCS box protein 5 OS=Homo sapiens GN=ASB5 PE=2 SV=1 | 721 | 936 | 9.0E-07 |
sp|Q07E43|ASZ1_DASNO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 | 590 | 744 | 9.0E-07 |
sp|Q8R560|ANKR1_RAT | Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 | 464 | 660 | 9.0E-07 |
sp|Q53RE8|ANR39_HUMAN | Ankyrin repeat domain-containing protein 39 OS=Homo sapiens GN=ANKRD39 PE=1 SV=1 | 58 | 171 | 9.0E-07 |
sp|Q7EZ44|XB35_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS35 OS=Oryza sativa subsp. japonica GN=XBOS35 PE=2 SV=1 | 70 | 388 | 9.0E-07 |
sp|O75179|ANR17_HUMAN | Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 | 59 | 515 | 1.0E-06 |
sp|Q18297|TRPA1_CAEEL | Transient receptor potential cation channel subfamily A member 1 homolog OS=Caenorhabditis elegans GN=trpa-1 PE=2 SV=5 | 59 | 515 | 1.0E-06 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 262 | 576 | 1.0E-06 |
sp|Q8UVC1|INVS_DANRE | Inversin OS=Danio rerio GN=invs PE=2 SV=1 | 52 | 203 | 1.0E-06 |
sp|Q8Q0U0|Y045_METMA | Putative ankyrin repeat protein MM_0045 OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=MM_0045 PE=3 SV=1 | 85 | 380 | 1.0E-06 |
sp|Q80YE7|DAPK1_MOUSE | Death-associated protein kinase 1 OS=Mus musculus GN=Dapk1 PE=1 SV=3 | 59 | 351 | 1.0E-06 |
sp|Q96KQ7|EHMT2_HUMAN | Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens GN=EHMT2 PE=1 SV=3 | 75 | 203 | 1.0E-06 |
sp|Q9Z148|EHMT2_MOUSE | Histone-lysine N-methyltransferase EHMT2 OS=Mus musculus GN=Ehmt2 PE=1 SV=2 | 75 | 203 | 1.0E-06 |
sp|Q6B858|FANK1_BOVIN | Fibronectin type 3 and ankyrin repeat domains protein 1 OS=Bos taurus GN=FANK1 PE=2 SV=2 | 301 | 489 | 1.0E-06 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 112 | 214 | 1.0E-06 |
sp|Q9Z2X3|PSD10_RAT | 26S proteasome non-ATPase regulatory subunit 10 OS=Rattus norvegicus GN=Psmd10 PE=2 SV=1 | 278 | 498 | 1.0E-06 |
sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 688 | 915 | 1.0E-06 |
sp|Q6P9Z4|FEM1A_DANRE | Protein fem-1 homolog A OS=Danio rerio GN=fem1a PE=2 SV=1 | 590 | 814 | 1.0E-06 |
sp|Q923M0|PP16A_MOUSE | Protein phosphatase 1 regulatory subunit 16A OS=Mus musculus GN=Ppp1r16a PE=1 SV=1 | 465 | 656 | 1.0E-06 |
sp|Q6DCL5|HACE1_XENLA | E3 ubiquitin-protein ligase HACE1 OS=Xenopus laevis GN=hace1 PE=2 SV=1 | 37 | 216 | 1.0E-06 |
sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 418 | 579 | 1.0E-06 |
sp|Q28BK1|HACE1_XENTR | E3 ubiquitin-protein ligase HACE1 OS=Xenopus tropicalis GN=hace1 PE=2 SV=1 | 37 | 216 | 1.0E-06 |
sp|Q9ET47|ESPN_MOUSE | Espin OS=Mus musculus GN=Espn PE=1 SV=2 | 61 | 209 | 1.0E-06 |
sp|Q09YM8|CTTB2_RABIT | Cortactin-binding protein 2 OS=Oryctolagus cuniculus GN=CTTNBP2 PE=3 SV=1 | 685 | 902 | 1.0E-06 |
sp|E1C656|HACE1_CHICK | E3 ubiquitin-protein ligase HACE1 OS=Gallus gallus GN=HACE1 PE=2 SV=1 | 76 | 216 | 1.0E-06 |
sp|Q9Z2G0|FEM1B_MOUSE | Protein fem-1 homolog B OS=Mus musculus GN=Fem1b PE=1 SV=1 | 273 | 502 | 1.0E-06 |
sp|P0C6P7|FEM1B_RAT | Protein fem-1 homolog B OS=Rattus norvegicus GN=Fem1b PE=1 SV=1 | 273 | 502 | 1.0E-06 |
sp|Q9UK73|FEM1B_HUMAN | Protein fem-1 homolog B OS=Homo sapiens GN=FEM1B PE=1 SV=1 | 273 | 502 | 1.0E-06 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 796 | 922 | 1.0E-06 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 796 | 922 | 1.0E-06 |
sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 773 | 915 | 1.0E-06 |
sp|Q8C0T1|FM1AB_MOUSE | Protein fem-1 homolog A-B OS=Mus musculus GN=Fem1ab PE=2 SV=1 | 687 | 880 | 1.0E-06 |
sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 681 | 877 | 1.0E-06 |
sp|Q2QLF8|CTTB2_CALJA | Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 | 585 | 743 | 1.0E-06 |
sp|B9EJA2|CTTB2_MOUSE | Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 | 577 | 764 | 1.0E-06 |
sp|Q9TZC4|ILKH_CAEEL | Integrin-linked protein kinase homolog pat-4 OS=Caenorhabditis elegans GN=pat-4 PE=1 SV=1 | 475 | 601 | 1.0E-06 |
sp|Q07E15|CTTB2_MUSPF | Cortactin-binding protein 2 OS=Mustela putorius furo GN=CTTNBP2 PE=3 SV=1 | 575 | 759 | 1.0E-06 |
sp|Q07DV1|CTTB2_AOTNA | Cortactin-binding protein 2 OS=Aotus nancymaae GN=CTTNBP2 PE=3 SV=1 | 585 | 739 | 1.0E-06 |
sp|Q07DY4|CTTB2_COLGU | Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 1.0E-06 |
sp|A0M8S4|CTTB2_PAPAN | Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 1.0E-06 |
sp|Q2IBA2|CTTB2_CHLAE | Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 | 685 | 878 | 1.0E-06 |
sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 518 | 676 | 1.0E-06 |
sp|Q5UQ08|YR787_MIMIV | Putative ankyrin repeat protein R787 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R787 PE=3 SV=1 | 412 | 641 | 1.0E-06 |
sp|Q6S8J3|POTEE_HUMAN | POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 | 475 | 655 | 1.0E-06 |
sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 418 | 568 | 1.0E-06 |
sp|Q9CQM6|ANR61_MOUSE | Ankyrin repeat domain-containing protein 61 OS=Mus musculus GN=Ankrd61 PE=2 SV=1 | 414 | 552 | 1.0E-06 |
sp|A6QL64|AN36A_HUMAN | Ankyrin repeat domain-containing protein 36A OS=Homo sapiens GN=ANKRD36 PE=2 SV=3 | 418 | 599 | 1.0E-06 |
sp|Q9ERC1|MYO16_RAT | Unconventional myosin-XVI OS=Rattus norvegicus GN=Myo16 PE=1 SV=1 | 435 | 663 | 1.0E-06 |
sp|Q8WXE0|CSKI2_HUMAN | Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 | 419 | 610 | 1.0E-06 |
sp|Q862Z2|ASB5_RABIT | Ankyrin repeat and SOCS box protein 5 OS=Oryctolagus cuniculus GN=ASB5 PE=2 SV=1 | 721 | 936 | 1.0E-06 |
sp|Q6S5H5|POTEG_HUMAN | POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 | 418 | 568 | 1.0E-06 |
sp|Q05753|AKRP_ARATH | Ankyrin repeat domain-containing protein, chloroplastic OS=Arabidopsis thaliana GN=AKRP PE=1 SV=2 | 519 | 656 | 1.0E-06 |
sp|Q01317|NUC2_NEUCR | Ankyrin repeat protein nuc-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nuc-2 PE=3 SV=2 | 789 | 915 | 1.0E-06 |
sp|Q8WWH4|ASZ1_HUMAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 | 772 | 915 | 1.0E-06 |
sp|Q2IBE3|ASZ1_PONAB | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pongo abelii GN=ASZ1 PE=3 SV=1 | 772 | 915 | 1.0E-06 |
sp|Q00420|GABP1_MOUSE | GA-binding protein subunit beta-1 OS=Mus musculus GN=Gabpb1 PE=1 SV=2 | 418 | 566 | 1.0E-06 |
sp|Q9J502|V233_FOWPN | Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 | 355 | 679 | 1.0E-06 |
sp|Q06547|GABP1_HUMAN | GA-binding protein subunit beta-1 OS=Homo sapiens GN=GABPB1 PE=1 SV=2 | 451 | 621 | 1.0E-06 |
sp|Q9D738|ASB12_MOUSE | Ankyrin repeat and SOCS box protein 12 OS=Mus musculus GN=Asb12 PE=2 SV=1 | 827 | 924 | 1.0E-06 |
sp|P31695|NOTC4_MOUSE | Neurogenic locus notch homolog protein 4 OS=Mus musculus GN=Notch4 PE=1 SV=2 | 687 | 900 | 1.0E-06 |
sp|Q876L5|AKR1_SACU7 | Palmitoyltransferase AKR1 OS=Saccharomyces uvarum (strain ATCC 76518 / CBS 7001 / CLIB 283 / NBRC 10550 / MCYC 623 / NCYC 2669 / NRRL Y-11845) GN=AKR1 PE=3 SV=2 | 403 | 583 | 1.0E-06 |
sp|A6NC57|ANR62_HUMAN | Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 | 418 | 575 | 1.0E-06 |
sp|Q8VD46|ASZ1_MOUSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 | 692 | 894 | 1.0E-06 |
sp|Q8VD46|ASZ1_MOUSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 | 523 | 738 | 1.0E-06 |
sp|Q8VD46|ASZ1_MOUSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mus musculus GN=Asz1 PE=1 SV=2 | 772 | 915 | 1.0E-06 |
sp|Q4R544|ASB8_MACFA | Ankyrin repeat and SOCS box protein 8 OS=Macaca fascicularis GN=ASB8 PE=2 SV=1 | 617 | 747 | 1.0E-06 |
sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 112 | 198 | 1.0E-06 |
sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 653 | 863 | 1.0E-06 |
sp|Q09YK6|ASZ1_ATEGE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 | 774 | 915 | 1.0E-06 |
sp|Q1RJR6|Y317_RICBR | Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 | 69 | 203 | 1.0E-06 |
sp|Q8CGB3|UACA_MOUSE | Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Mus musculus GN=Uaca PE=1 SV=2 | 520 | 730 | 1.0E-06 |
sp|P19838|NFKB1_HUMAN | Nuclear factor NF-kappa-B p105 subunit OS=Homo sapiens GN=NFKB1 PE=1 SV=2 | 418 | 561 | 1.0E-06 |
sp|Q7XUW4|KOR2_ORYSJ | Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 | 789 | 937 | 1.0E-06 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 51 | 193 | 2.0E-06 |
sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 72 | 203 | 2.0E-06 |
sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 70 | 208 | 2.0E-06 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 59 | 204 | 2.0E-06 |
sp|Q9J516|V219_FOWPN | Putative ankyrin repeat protein FPV219 OS=Fowlpox virus (strain NVSL) GN=FPV219 PE=3 SV=1 | 789 | 924 | 2.0E-06 |
sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 70 | 193 | 2.0E-06 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 810 | 920 | 2.0E-06 |
sp|Q495B1|AKD1A_HUMAN | Ankyrin repeat and death domain-containing protein 1A OS=Homo sapiens GN=ANKDD1A PE=2 SV=2 | 58 | 346 | 2.0E-06 |
sp|Q9CZK6|ANKS3_MOUSE | Ankyrin repeat and SAM domain-containing protein 3 OS=Mus musculus GN=Anks3 PE=1 SV=2 | 78 | 208 | 2.0E-06 |
sp|F8W2M1|HACE1_DANRE | E3 ubiquitin-protein ligase HACE1 OS=Danio rerio GN=hace1 PE=3 SV=2 | 37 | 216 | 2.0E-06 |
sp|B1AK53|ESPN_HUMAN | Espin OS=Homo sapiens GN=ESPN PE=1 SV=1 | 76 | 234 | 2.0E-06 |
sp|Q2QLG9|CTTB2_OTOGA | Cortactin-binding protein 2 OS=Otolemur garnettii GN=CTTNBP2 PE=3 SV=1 | 513 | 805 | 2.0E-06 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 50 | 244 | 2.0E-06 |
sp|Q09YJ3|CTTB2_MUNMU | Cortactin-binding protein 2 OS=Muntiacus muntjak GN=CTTNBP2 PE=3 SV=1 | 585 | 739 | 2.0E-06 |
sp|Q5ZM55|FEM1B_CHICK | Protein fem-1 homolog B OS=Gallus gallus GN=FEM1B PE=2 SV=1 | 273 | 503 | 2.0E-06 |
sp|Q09YG9|CTTB2_SAIBB | Cortactin-binding protein 2 OS=Saimiri boliviensis boliviensis GN=CTTNBP2 PE=3 SV=1 | 526 | 739 | 2.0E-06 |
sp|Q8VHK1|CSKI2_MOUSE | Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 | 302 | 510 | 2.0E-06 |
sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 553 | 851 | 2.0E-06 |
sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 60 | 169 | 2.0E-06 |
sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 60 | 169 | 2.0E-06 |
sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 60 | 169 | 2.0E-06 |
sp|A0M8S4|CTTB2_PAPAN | Cortactin-binding protein 2 OS=Papio anubis GN=CTTNBP2 PE=3 SV=1 | 540 | 759 | 2.0E-06 |
sp|Q2IBA2|CTTB2_CHLAE | Cortactin-binding protein 2 OS=Chlorocebus aethiops GN=CTTNBP2 PE=3 SV=1 | 540 | 759 | 2.0E-06 |
sp|Q9EP71|RAI14_MOUSE | Ankycorbin OS=Mus musculus GN=Rai14 PE=1 SV=1 | 112 | 203 | 2.0E-06 |
sp|Q9GZV1|ANKR2_HUMAN | Ankyrin repeat domain-containing protein 2 OS=Homo sapiens GN=ANKRD2 PE=1 SV=3 | 510 | 688 | 2.0E-06 |
sp|P17442|PHO81_YEAST | Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 | 681 | 880 | 2.0E-06 |
sp|Q6GPE5|FEM1B_XENLA | Protein fem-1 homolog B OS=Xenopus laevis GN=fem1b PE=2 SV=1 | 661 | 905 | 2.0E-06 |
sp|Q8WXE0|CSKI2_HUMAN | Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 | 575 | 786 | 2.0E-06 |
sp|P17221|FEM1_CAEEL | Sex-determining protein fem-1 OS=Caenorhabditis elegans GN=fem-1 PE=1 SV=1 | 370 | 568 | 2.0E-06 |
sp|Q2QLA4|ASZ1_HORSE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Equus caballus GN=ASZ1 PE=3 SV=1 | 556 | 738 | 2.0E-06 |
sp|Q07DY6|ASZ1_COLGU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Colobus guereza GN=ASZ1 PE=3 SV=1 | 772 | 915 | 2.0E-06 |
sp|Q07E43|ASZ1_DASNO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 | 803 | 929 | 2.0E-06 |
sp|Q07E43|ASZ1_DASNO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Dasypus novemcinctus GN=ASZ1 PE=3 SV=1 | 772 | 915 | 2.0E-06 |
sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 592 | 706 | 2.0E-06 |
sp|P57044|ILK_CAVPO | Integrin-linked protein kinase OS=Cavia porcellus GN=ILK PE=2 SV=1 | 520 | 653 | 2.0E-06 |
sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 418 | 556 | 2.0E-06 |
sp|Q0V8G2|GABP2_BOVIN | GA-binding protein subunit beta-2 OS=Bos taurus GN=GABPB2 PE=2 SV=2 | 792 | 883 | 2.0E-06 |
sp|Q8WXK4|ASB12_HUMAN | Ankyrin repeat and SOCS box protein 12 OS=Homo sapiens GN=ASB12 PE=1 SV=2 | 475 | 603 | 2.0E-06 |
sp|Q337A0|XB33_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS33 OS=Oryza sativa subsp. japonica GN=XBOS33 PE=2 SV=1 | 451 | 724 | 2.0E-06 |
sp|Q54BA2|Y3800_DICDI | Ankyrin repeat, bromo and BTB domain-containing protein DDB_G0293800 OS=Dictyostelium discoideum GN=DDB_G0293800 PE=3 SV=1 | 429 | 598 | 2.0E-06 |
sp|P39010|AKR1_YEAST | Palmitoyltransferase AKR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AKR1 PE=1 SV=1 | 680 | 858 | 2.0E-06 |
sp|Q9H9E1|ANRA2_HUMAN | Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 | 414 | 502 | 2.0E-06 |
sp|Q9H9E1|ANRA2_HUMAN | Ankyrin repeat family A protein 2 OS=Homo sapiens GN=ANKRA2 PE=1 SV=1 | 720 | 906 | 2.0E-06 |
sp|Q2KI79|ANRA2_BOVIN | Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 | 414 | 502 | 2.0E-06 |
sp|Q2KI79|ANRA2_BOVIN | Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 | 812 | 915 | 2.0E-06 |
sp|Q2KI79|ANRA2_BOVIN | Ankyrin repeat family A protein 2 OS=Bos taurus GN=ANKRA2 PE=2 SV=1 | 720 | 906 | 2.0E-06 |
sp|Q7T0Q1|MTPN_XENLA | Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 | 451 | 568 | 2.0E-06 |
sp|Q7XUW4|KOR2_ORYSJ | Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 | 367 | 644 | 2.0E-06 |
sp|A2A690|TANC2_MOUSE | Protein TANC2 OS=Mus musculus GN=Tanc2 PE=1 SV=1 | 301 | 511 | 3.0E-06 |
sp|Q9C0D5|TANC1_HUMAN | Protein TANC1 OS=Homo sapiens GN=TANC1 PE=1 SV=3 | 72 | 203 | 3.0E-06 |
sp|Q9VUX2|MIB_DROME | E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 | 760 | 924 | 3.0E-06 |
sp|O75832|PSD10_HUMAN | 26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens GN=PSMD10 PE=1 SV=1 | 811 | 915 | 3.0E-06 |
sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 587 | 822 | 3.0E-06 |
sp|Q6GNY1|MIB1_XENLA | E3 ubiquitin-protein ligase mib1 OS=Xenopus laevis GN=mib1 PE=2 SV=1 | 297 | 567 | 3.0E-06 |
sp|Q96NW4|ANR27_HUMAN | Ankyrin repeat domain-containing protein 27 OS=Homo sapiens GN=ANKRD27 PE=1 SV=2 | 59 | 204 | 3.0E-06 |
sp|Q8IYU2|HACE1_HUMAN | E3 ubiquitin-protein ligase HACE1 OS=Homo sapiens GN=HACE1 PE=1 SV=2 | 75 | 312 | 3.0E-06 |
sp|Q978J0|Y1425_THEVO | Putative ankyrin repeat protein TV1425 OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=TV1425 PE=1 SV=1 | 418 | 551 | 3.0E-06 |
sp|Q3U0D9|HACE1_MOUSE | E3 ubiquitin-protein ligase HACE1 OS=Mus musculus GN=Hace1 PE=1 SV=1 | 75 | 312 | 3.0E-06 |
sp|D3ZBM7|HACE1_RAT | E3 ubiquitin-protein ligase HACE1 OS=Rattus norvegicus GN=Hace1 PE=3 SV=1 | 75 | 312 | 3.0E-06 |
sp|Q8VHK1|CSKI2_MOUSE | Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 | 419 | 610 | 3.0E-06 |
sp|Q8WZ74|CTTB2_HUMAN | Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 | 585 | 739 | 3.0E-06 |
sp|Q2IBF7|CTTB2_GORGO | Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 | 585 | 739 | 3.0E-06 |
sp|Q9Y2G4|ANKR6_HUMAN | Ankyrin repeat domain-containing protein 6 OS=Homo sapiens GN=ANKRD6 PE=1 SV=3 | 74 | 203 | 3.0E-06 |
sp|A4D7T3|ASZ1_MACEU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Macropus eugenii GN=ASZ1 PE=3 SV=1 | 556 | 706 | 3.0E-06 |
sp|Q07DY4|CTTB2_COLGU | Cortactin-binding protein 2 OS=Colobus guereza GN=CTTNBP2 PE=3 SV=1 | 540 | 759 | 3.0E-06 |
sp|Q3UMR0|ANR27_MOUSE | Ankyrin repeat domain-containing protein 27 OS=Mus musculus GN=Ankrd27 PE=1 SV=2 | 59 | 208 | 3.0E-06 |
sp|Q07E41|CTTB2_DASNO | Cortactin-binding protein 2 OS=Dasypus novemcinctus GN=CTTNBP2 PE=3 SV=1 | 796 | 914 | 3.0E-06 |
sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 475 | 655 | 3.0E-06 |
sp|Q5UPH0|YL100_MIMIV | Putative ankyrin repeat protein L100 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L100 PE=3 SV=1 | 486 | 744 | 3.0E-06 |
sp|A0M8T3|ASZ1_FELCA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 | 692 | 894 | 3.0E-06 |
sp|A0M8T3|ASZ1_FELCA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Felis catus GN=ASZ1 PE=3 SV=1 | 772 | 915 | 3.0E-06 |
sp|Q07E30|ASZ1_NEONE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Neofelis nebulosa GN=ASZ1 PE=3 SV=1 | 772 | 915 | 3.0E-06 |
sp|Q2QLC6|ASZ1_CARPS | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Carollia perspicillata GN=ASZ1 PE=3 SV=1 | 590 | 744 | 3.0E-06 |
sp|Q8WMX6|ASZ1_PANTR | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Pan troglodytes GN=ASZ1 PE=2 SV=1 | 556 | 706 | 3.0E-06 |
sp|Q2IBF5|ASZ1_GORGO | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Gorilla gorilla gorilla GN=ASZ1 PE=3 SV=1 | 556 | 706 | 3.0E-06 |
sp|Q9J504|V231_FOWPN | Putative ankyrin repeat protein FPV231 OS=Fowlpox virus (strain NVSL) GN=FPV231 PE=3 SV=1 | 560 | 723 | 3.0E-06 |
sp|Q8WWH4|ASZ1_HUMAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 | 556 | 706 | 3.0E-06 |
sp|Q8WWH4|ASZ1_HUMAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Homo sapiens GN=ASZ1 PE=2 SV=1 | 692 | 894 | 3.0E-06 |
sp|Q5CZ79|AN20B_HUMAN | Ankyrin repeat domain-containing protein 20B OS=Homo sapiens GN=ANKRD20A8P PE=2 SV=2 | 418 | 575 | 3.0E-06 |
sp|A6NC57|ANR62_HUMAN | Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 | 678 | 888 | 3.0E-06 |
sp|Q8TAK5|GABP2_HUMAN | GA-binding protein subunit beta-2 OS=Homo sapiens GN=GABPB2 PE=1 SV=1 | 418 | 557 | 3.0E-06 |
sp|Q4KL97|ANKR1_XENLA | Ankyrin repeat domain-containing protein 1 OS=Xenopus laevis GN=ankrd1 PE=2 SV=1 | 578 | 744 | 3.0E-06 |
sp|Q5ZXN6|ANKX_LEGPH | Phosphocholine transferase AnkX OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=ankX PE=1 SV=1 | 418 | 801 | 3.0E-06 |
sp|Q54KH3|ANR39_DICDI | Ankyrin repeat domain-containing protein 39 homolog OS=Dictyostelium discoideum GN=ankrd39 PE=3 SV=2 | 524 | 655 | 3.0E-06 |
sp|Q09YK6|ASZ1_ATEGE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ateles geoffroyi GN=ASZ1 PE=3 SV=1 | 556 | 706 | 3.0E-06 |
sp|P50086|PSD10_YEAST | Probable 26S proteasome regulatory subunit p28 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAS6 PE=1 SV=1 | 516 | 707 | 3.0E-06 |
sp|Q9QZH2|BARD1_RAT | BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 | 518 | 645 | 3.0E-06 |
sp|Q7T0Q1|MTPN_XENLA | Myotrophin OS=Xenopus laevis GN=mtpn PE=3 SV=1 | 832 | 922 | 3.0E-06 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 52 | 351 | 4.0E-06 |
sp|Q92625|ANS1A_HUMAN | Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 | 682 | 914 | 4.0E-06 |
sp|Q8WXK1|ASB15_HUMAN | Ankyrin repeat and SOCS box protein 15 OS=Homo sapiens GN=ASB15 PE=2 SV=3 | 297 | 536 | 4.0E-06 |
sp|P0C927|ASB14_RAT | Ankyrin repeat and SOCS box protein 14 OS=Rattus norvegicus GN=Asb14 PE=3 SV=1 | 785 | 915 | 4.0E-06 |
sp|Q8CEF1|FEM1C_MOUSE | Protein fem-1 homolog C OS=Mus musculus GN=Fem1c PE=2 SV=1 | 369 | 571 | 4.0E-06 |
sp|Q9Z2X2|PSD10_MOUSE | 26S proteasome non-ATPase regulatory subunit 10 OS=Mus musculus GN=Psmd10 PE=1 SV=3 | 811 | 915 | 4.0E-06 |
sp|Q96DX5|ASB9_HUMAN | Ankyrin repeat and SOCS box protein 9 OS=Homo sapiens GN=ASB9 PE=1 SV=1 | 618 | 829 | 4.0E-06 |
sp|Q8VHK1|CSKI2_MOUSE | Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 | 587 | 786 | 4.0E-06 |
sp|B9EJA2|CTTB2_MOUSE | Cortactin-binding protein 2 OS=Mus musculus GN=Cttnbp2 PE=1 SV=2 | 531 | 739 | 4.0E-06 |
sp|Q6S5H4|POTEB_HUMAN | POTE ankyrin domain family member B OS=Homo sapiens GN=POTEB PE=2 SV=1 | 681 | 877 | 4.0E-06 |
sp|A0JP26|POTB3_HUMAN | POTE ankyrin domain family member B3 OS=Homo sapiens GN=POTEB3 PE=2 SV=2 | 681 | 877 | 4.0E-06 |
sp|Q86SG2|ANR23_HUMAN | Ankyrin repeat domain-containing protein 23 OS=Homo sapiens GN=ANKRD23 PE=1 SV=1 | 418 | 574 | 4.0E-06 |
sp|Q91ZT8|ASB9_MOUSE | Ankyrin repeat and SOCS box protein 9 OS=Mus musculus GN=Asb9 PE=1 SV=2 | 435 | 614 | 4.0E-06 |
sp|O73630|NFKB2_XENLA | Nuclear factor NF-kappa-B p100 subunit OS=Xenopus laevis GN=nfkb2 PE=2 SV=1 | 325 | 553 | 4.0E-06 |
sp|Q69ZU8|ANKR6_MOUSE | Ankyrin repeat domain-containing protein 6 OS=Mus musculus GN=Ankrd6 PE=1 SV=2 | 553 | 851 | 4.0E-06 |
sp|Q6S5H5|POTEG_HUMAN | POTE ankyrin domain family member G OS=Homo sapiens GN=POTEG PE=2 SV=5 | 475 | 655 | 4.0E-06 |
sp|Q2IBB1|ASZ1_CHLAE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Chlorocebus aethiops GN=ASZ1 PE=3 SV=1 | 556 | 706 | 4.0E-06 |
sp|Q8WMX7|ASZ1_PAPAN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Papio anubis GN=ASZ1 PE=2 SV=1 | 556 | 706 | 4.0E-06 |
sp|Q8WMX8|ASZ1_BOVIN | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Bos taurus GN=ASZ1 PE=2 SV=1 | 723 | 894 | 4.0E-06 |
sp|Q09YI3|ASZ1_SHEEP | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Ovis aries GN=ASZ1 PE=3 SV=1 | 723 | 894 | 4.0E-06 |
sp|Q9Y6X6|MYO16_HUMAN | Unconventional myosin-XVI OS=Homo sapiens GN=MYO16 PE=2 SV=3 | 435 | 650 | 4.0E-06 |
sp|Q9D2J7|ANKE1_MOUSE | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Mus musculus GN=Ankef1 PE=2 SV=1 | 630 | 746 | 4.0E-06 |
sp|Q5BKI6|ANKR1_XENTR | Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 | 112 | 198 | 4.0E-06 |
sp|Q9TU71|ANKR1_RABIT | Ankyrin repeat domain-containing protein 1 OS=Oryctolagus cuniculus GN=ANKRD1 PE=2 SV=1 | 707 | 914 | 4.0E-06 |
sp|A2VDR2|ACBD6_BOVIN | Acyl-CoA-binding domain-containing protein 6 OS=Bos taurus GN=ACBD6 PE=2 SV=1 | 113 | 203 | 4.0E-06 |
sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 510 | 730 | 4.0E-06 |
sp|Q1RJR6|Y317_RICBR | Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 | 475 | 606 | 4.0E-06 |
sp|Q9BZL4|PP12C_HUMAN | Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens GN=PPP1R12C PE=1 SV=1 | 475 | 644 | 4.0E-06 |
sp|P25799|NFKB1_MOUSE | Nuclear factor NF-kappa-B p105 subunit OS=Mus musculus GN=Nfkb1 PE=1 SV=2 | 418 | 561 | 4.0E-06 |
sp|Q6KAE5|XB32_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 | 53 | 376 | 4.0E-06 |
sp|Q6KAE5|XB32_ORYSJ | Probable E3 ubiquitin-protein ligase XBOS32 OS=Oryza sativa subsp. japonica GN=XBOS32 PE=2 SV=2 | 576 | 894 | 4.0E-06 |
sp|Q8IWZ3|ANKH1_HUMAN | Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 | 70 | 508 | 5.0E-06 |
sp|P53355|DAPK1_HUMAN | Death-associated protein kinase 1 OS=Homo sapiens GN=DAPK1 PE=1 SV=6 | 116 | 484 | 5.0E-06 |
sp|O60733|PLPL9_HUMAN | 85/88 kDa calcium-independent phospholipase A2 OS=Homo sapiens GN=PLA2G6 PE=1 SV=2 | 716 | 922 | 5.0E-06 |
sp|Q07DW4|CTTB2_MUNRE | Cortactin-binding protein 2 OS=Muntiacus reevesi GN=CTTNBP2 PE=3 SV=1 | 585 | 739 | 5.0E-06 |
sp|Q9D504|ANKR7_MOUSE | Ankyrin repeat domain-containing protein 7 OS=Mus musculus GN=Ankrd7 PE=2 SV=2 | 658 | 865 | 5.0E-06 |
sp|Q8N283|ANR35_HUMAN | Ankyrin repeat domain-containing protein 35 OS=Homo sapiens GN=ANKRD35 PE=2 SV=2 | 414 | 547 | 5.0E-06 |
sp|Q2IBD4|CTTB2_RAT | Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 | 539 | 739 | 5.0E-06 |
sp|Q2IBE6|CTTB2_PONAB | Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 | 585 | 746 | 5.0E-06 |
sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 112 | 200 | 5.0E-06 |
sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 681 | 877 | 5.0E-06 |
sp|Q07E17|ASZ1_MUSPF | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Mustela putorius furo GN=ASZ1 PE=3 SV=1 | 792 | 915 | 5.0E-06 |
sp|Q4UJ75|A20A4_HUMAN | Ankyrin repeat domain-containing protein 20A4 OS=Homo sapiens GN=ANKRD20A4 PE=3 SV=1 | 480 | 682 | 5.0E-06 |
sp|Q92527|ANKR7_HUMAN | Ankyrin repeat domain-containing protein 7 OS=Homo sapiens GN=ANKRD7 PE=2 SV=3 | 418 | 569 | 5.0E-06 |
sp|P07207|NOTCH_DROME | Neurogenic locus Notch protein OS=Drosophila melanogaster GN=N PE=1 SV=3 | 435 | 602 | 5.0E-06 |
sp|Q2QLH1|ASZ1_OTOGA | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Otolemur garnettii GN=ASZ1 PE=3 SV=1 | 772 | 915 | 5.0E-06 |
sp|Q9SQK3|EM506_ARATH | Ankyrin repeat domain-containing protein EMB506, chloroplastic OS=Arabidopsis thaliana GN=EMB506 PE=1 SV=1 | 644 | 837 | 5.0E-06 |
sp|Q2QL84|ASZ1_MICMU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Microcebus murinus GN=ASZ1 PE=3 SV=1 | 772 | 915 | 5.0E-06 |
sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 707 | 913 | 5.0E-06 |
sp|P57078|RIPK4_HUMAN | Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens GN=RIPK4 PE=1 SV=1 | 78 | 171 | 6.0E-06 |
sp|Q05921|RN5A_MOUSE | 2-5A-dependent ribonuclease OS=Mus musculus GN=Rnasel PE=1 SV=2 | 827 | 915 | 6.0E-06 |
sp|Q0VGY8|TANC1_MOUSE | Protein TANC1 OS=Mus musculus GN=Tanc1 PE=1 SV=2 | 72 | 203 | 6.0E-06 |
sp|Q6F6B3|TANC1_RAT | Protein TANC1 OS=Rattus norvegicus GN=Tanc1 PE=1 SV=1 | 292 | 511 | 6.0E-06 |
sp|A6NHY2|AKD1B_HUMAN | Ankyrin repeat and death domain-containing protein 1B OS=Homo sapiens GN=ANKDD1B PE=3 SV=3 | 79 | 351 | 6.0E-06 |
sp|Q9H560|ANR19_HUMAN | Putative ankyrin repeat domain-containing protein 19 OS=Homo sapiens GN=ANKRD19P PE=5 SV=1 | 412 | 541 | 6.0E-06 |
sp|Q6P9K8|CSKI1_MOUSE | Caskin-1 OS=Mus musculus GN=Caskin1 PE=1 SV=2 | 780 | 913 | 6.0E-06 |
sp|Q2QLF8|CTTB2_CALJA | Cortactin-binding protein 2 OS=Callithrix jacchus GN=CTTNBP2 PE=3 SV=1 | 794 | 914 | 6.0E-06 |
sp|Q9WV06|ANKR2_MOUSE | Ankyrin repeat domain-containing protein 2 OS=Mus musculus GN=Ankrd2 PE=1 SV=3 | 60 | 203 | 6.0E-06 |
sp|H3BUK9|POTB2_HUMAN | POTE ankyrin domain family member B2 OS=Homo sapiens GN=POTEB2 PE=3 SV=1 | 292 | 501 | 6.0E-06 |
sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 60 | 169 | 6.0E-06 |
sp|Q09YJ5|ASZ1_MUNMU | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Muntiacus muntjak GN=ASZ1 PE=3 SV=1 | 723 | 894 | 6.0E-06 |
sp|Q90623|MYPT1_CHICK | Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus GN=PPP1R12A PE=1 SV=1 | 723 | 913 | 6.0E-06 |
sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 475 | 655 | 6.0E-06 |
sp|A6NI47|POTEM_HUMAN | Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 | 475 | 655 | 6.0E-06 |
sp|Q5JPF3|AN36C_HUMAN | Ankyrin repeat domain-containing protein 36C OS=Homo sapiens GN=ANKRD36C PE=2 SV=3 | 418 | 599 | 6.0E-06 |
sp|Q6UB99|ANR11_HUMAN | Ankyrin repeat domain-containing protein 11 OS=Homo sapiens GN=ANKRD11 PE=1 SV=3 | 490 | 639 | 6.0E-06 |
sp|Q8WXH4|ASB11_HUMAN | Ankyrin repeat and SOCS box protein 11 OS=Homo sapiens GN=ASB11 PE=1 SV=1 | 721 | 915 | 6.0E-06 |
sp|Q5RFS1|ASB11_PONAB | Ankyrin repeat and SOCS box protein 11 OS=Pongo abelii GN=ASB11 PE=2 SV=1 | 721 | 915 | 6.0E-06 |
sp|Q14678|KANK1_HUMAN | KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=KANK1 PE=1 SV=3 | 453 | 549 | 6.0E-06 |
sp|Q9NU02|ANKE1_HUMAN | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 | 630 | 795 | 6.0E-06 |
sp|Q9CR42|ANKR1_MOUSE | Ankyrin repeat domain-containing protein 1 OS=Mus musculus GN=Ankrd1 PE=1 SV=1 | 110 | 198 | 6.0E-06 |
sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 110 | 198 | 6.0E-06 |
sp|O75762|TRPA1_HUMAN | Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=1 SV=3 | 68 | 207 | 7.0E-06 |
sp|Q5REW9|ANR27_PONAB | Ankyrin repeat domain-containing protein 27 OS=Pongo abelii GN=ANKRD27 PE=2 SV=1 | 50 | 244 | 7.0E-06 |
sp|E5RJM6|ANR65_HUMAN | Ankyrin repeat domain-containing protein 65 OS=Homo sapiens GN=ANKRD65 PE=2 SV=2 | 824 | 915 | 7.0E-06 |
sp|Q6GQX6|ANKS6_MOUSE | Ankyrin repeat and SAM domain-containing protein 6 OS=Mus musculus GN=Anks6 PE=1 SV=2 | 292 | 575 | 7.0E-06 |
sp|Q3SZE4|ASB11_BOVIN | Ankyrin repeat and SOCS box protein 11 OS=Bos taurus GN=ASB11 PE=2 SV=1 | 721 | 915 | 7.0E-06 |
sp|Q2IBD4|CTTB2_RAT | Cortactin-binding protein 2 OS=Rattus norvegicus GN=Cttnbp2 PE=1 SV=1 | 577 | 759 | 7.0E-06 |
sp|Q2IBE6|CTTB2_PONAB | Cortactin-binding protein 2 OS=Pongo abelii GN=CTTNBP2 PE=3 SV=2 | 794 | 914 | 7.0E-06 |
sp|Q86YR6|POTED_HUMAN | POTE ankyrin domain family member D OS=Homo sapiens GN=POTED PE=2 SV=2 | 60 | 169 | 7.0E-06 |
sp|Q8VHS5|ASB16_MOUSE | Ankyrin repeat and SOCS box protein 16 OS=Mus musculus GN=Asb16 PE=2 SV=1 | 414 | 593 | 7.0E-06 |
sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 292 | 501 | 7.0E-06 |
sp|A1X154|ASZ1_ECHTE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 | 692 | 877 | 7.0E-06 |
sp|A5A3E0|POTEF_HUMAN | POTE ankyrin domain family member F OS=Homo sapiens GN=POTEF PE=1 SV=2 | 678 | 877 | 7.0E-06 |
sp|P17442|PHO81_YEAST | Phosphate system positive regulatory protein PHO81 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO81 PE=1 SV=2 | 288 | 508 | 7.0E-06 |
sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 678 | 877 | 7.0E-06 |
sp|A6NI47|POTEM_HUMAN | Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 | 418 | 568 | 7.0E-06 |
sp|Q2IBB4|ASZ1_RHIFE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 | 778 | 915 | 7.0E-06 |
sp|A6NC57|ANR62_HUMAN | Ankyrin repeat domain-containing protein 62 OS=Homo sapiens GN=ANKRD62 PE=2 SV=4 | 759 | 911 | 7.0E-06 |
sp|Q8IUH5|ZDH17_HUMAN | Palmitoyltransferase ZDHHC17 OS=Homo sapiens GN=ZDHHC17 PE=1 SV=2 | 456 | 653 | 7.0E-06 |
sp|P25963|IKBA_HUMAN | NF-kappa-B inhibitor alpha OS=Homo sapiens GN=NFKBIA PE=1 SV=1 | 773 | 883 | 7.0E-06 |
sp|Q6NLQ8|XB32_ARATH | E3 ubiquitin-protein ligase XBAT32 OS=Arabidopsis thaliana GN=XBAT32 PE=1 SV=1 | 53 | 170 | 7.0E-06 |
sp|Q7XUW4|KOR2_ORYSJ | Potassium channel KOR2 OS=Oryza sativa subsp. japonica GN=Os04g0445000 PE=2 SV=2 | 515 | 653 | 7.0E-06 |
sp|Q06527|ANKH_ALLVD | Ankyrin homolog OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=Alvin_1094 PE=3 SV=1 | 247 | 538 | 8.0E-06 |
sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 303 | 509 | 8.0E-06 |
sp|F1N6G5|HACE1_BOVIN | E3 ubiquitin-protein ligase HACE1 OS=Bos taurus GN=HACE1 PE=3 SV=3 | 75 | 169 | 8.0E-06 |
sp|Q29RM5|FEM1A_BOVIN | Protein fem-1 homolog A OS=Bos taurus GN=FEM1A PE=2 SV=1 | 334 | 539 | 8.0E-06 |
sp|Q7Z6G8|ANS1B_HUMAN | Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 | 556 | 862 | 8.0E-06 |
sp|Q8WZ74|CTTB2_HUMAN | Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1 | 794 | 914 | 8.0E-06 |
sp|Q2IBF7|CTTB2_GORGO | Cortactin-binding protein 2 OS=Gorilla gorilla gorilla GN=CTTNBP2 PE=3 SV=1 | 794 | 914 | 8.0E-06 |
sp|B2RU33|POTEC_HUMAN | POTE ankyrin domain family member C OS=Homo sapiens GN=POTEC PE=2 SV=2 | 773 | 911 | 8.0E-06 |
sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 678 | 877 | 8.0E-06 |
sp|P0CG39|POTEJ_HUMAN | POTE ankyrin domain family member J OS=Homo sapiens GN=POTEJ PE=3 SV=1 | 678 | 887 | 8.0E-06 |
sp|Q07DX6|ASZ1_NOMLE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Nomascus leucogenys GN=ASZ1 PE=3 SV=1 | 556 | 706 | 8.0E-06 |
sp|Q09YK4|CTTB2_ATEGE | Cortactin-binding protein 2 OS=Ateles geoffroyi GN=CTTNBP2 PE=3 SV=1 | 794 | 915 | 8.0E-06 |
sp|Q9J5H5|V026_FOWPN | Putative ankyrin repeat protein FPV026 OS=Fowlpox virus (strain NVSL) GN=FPV026 PE=3 SV=1 | 689 | 883 | 8.0E-06 |
sp|Q1RJR6|Y317_RICBR | Putative ankyrin repeat protein RBE_0317 OS=Rickettsia bellii (strain RML369-C) GN=RBE_0317 PE=3 SV=1 | 611 | 739 | 8.0E-06 |
sp|Q15327|ANKR1_HUMAN | Ankyrin repeat domain-containing protein 1 OS=Homo sapiens GN=ANKRD1 PE=1 SV=2 | 510 | 706 | 8.0E-06 |
sp|Q9QZH2|BARD1_RAT | BRCA1-associated RING domain protein 1 OS=Rattus norvegicus GN=Bard1 PE=2 SV=1 | 820 | 915 | 8.0E-06 |
sp|Q5UPG5|YL093_MIMIV | Putative ankyrin repeat protein L93 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L93 PE=3 SV=1 | 281 | 509 | 9.0E-06 |
sp|Q8BLD6|ANR55_MOUSE | Ankyrin repeat domain-containing protein 55 OS=Mus musculus GN=Ankrd55 PE=1 SV=2 | 66 | 169 | 9.0E-06 |
sp|A2A2Z9|AN18B_HUMAN | Ankyrin repeat domain-containing protein 18B OS=Homo sapiens GN=ANKRD18B PE=1 SV=1 | 759 | 915 | 9.0E-06 |
sp|Q94A76|GORK_ARATH | Potassium channel GORK OS=Arabidopsis thaliana GN=GORK PE=1 SV=2 | 515 | 653 | 9.0E-06 |
sp|Q8VHK2|CSKI1_RAT | Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 | 780 | 913 | 9.0E-06 |
sp|A1X154|ASZ1_ECHTE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Echinops telfairi GN=ASZ1 PE=3 SV=1 | 774 | 915 | 9.0E-06 |
sp|P0CG38|POTEI_HUMAN | POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 | 678 | 887 | 9.0E-06 |
sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 418 | 568 | 9.0E-06 |
sp|A6NI47|POTEM_HUMAN | Putative POTE ankyrin domain family member M OS=Homo sapiens GN=POTEM PE=3 SV=2 | 60 | 169 | 9.0E-06 |
sp|Q2IBB4|ASZ1_RHIFE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 | 719 | 877 | 9.0E-06 |
sp|Q2IBB4|ASZ1_RHIFE | Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 OS=Rhinolophus ferrumequinum GN=ASZ1 PE=3 SV=1 | 563 | 738 | 9.0E-06 |
sp|Q8R560|ANKR1_RAT | Ankyrin repeat domain-containing protein 1 OS=Rattus norvegicus GN=Ankrd1 PE=1 SV=1 | 769 | 914 | 9.0E-06 |
sp|Q3ZBX7|ANKR1_BOVIN | Ankyrin repeat domain-containing protein 1 OS=Bos taurus GN=ANKRD1 PE=2 SV=1 | 592 | 744 | 9.0E-06 |
sp|Q9NU02|ANKE1_HUMAN | Ankyrin repeat and EF-hand domain-containing protein 1 OS=Homo sapiens GN=ANKEF1 PE=2 SV=2 | 585 | 654 | 9.0E-06 |
sp|Q865U8|ANKR1_PIG | Ankyrin repeat domain-containing protein 1 OS=Sus scrofa GN=ANKRD1 PE=2 SV=1 | 769 | 913 | 9.0E-06 |
sp|Q499M5|ANR16_RAT | Ankyrin repeat domain-containing protein 16 OS=Rattus norvegicus GN=Ankrd16 PE=2 SV=1 | 774 | 911 | 1.0E-05 |
sp|Q8IVF6|AN18A_HUMAN | Ankyrin repeat domain-containing protein 18A OS=Homo sapiens GN=ANKRD18A PE=2 SV=3 | 418 | 577 | 1.0E-05 |
sp|Q6S545|POTEH_HUMAN | POTE ankyrin domain family member H OS=Homo sapiens GN=POTEH PE=2 SV=3 | 60 | 169 | 1.0E-05 |
sp|Q811D2|ANR26_MOUSE | Ankyrin repeat domain-containing protein 26 OS=Mus musculus GN=Ankrd26 PE=1 SV=2 | 789 | 915 | 1.0E-05 |
sp|Q8WVL7|ANR49_HUMAN | Ankyrin repeat domain-containing protein 49 OS=Homo sapiens GN=ANKRD49 PE=1 SV=1 | 553 | 680 | 1.0E-05 |
GO Term | Description | Terminal node |
---|---|---|
GO:0005515 | protein binding | Yes |
GO:0003674 | molecular_function | No |
GO:0005488 | binding | No |
SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
---|---|---|
No | 1 - 11 | 0.45 |
Type of sequence | Sequence |
---|---|
Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
Protein | >Ophun1|4011 MNLLRRRQQRTADEELALGAVHHEPESNPRKEKQQEQEQEQKLADLFNEPRGDAQKQRIKKLIDGKNNLDASTVD KTGRTLLHYAARHGDRSLVELLLQRTKTGRPELGIQDKEERTALHEAADEDHHELIELLVSSSDDVVSKRDLHGR TALHWAANNGHDLTVKALLQHMTVDQVDFLDKFNQTALHRAARSGFYDIVTMIQVKNPGDSRPDGSIMDVLGLKE TSMAETKDYLRKLKSHKKWTEMSQGFVEHPNMLKPVLFWLTQNGLKHVVALMLEKLKNDGSGLHSLINSTDCLKR TPLHIASIRGHTAIVESLLSHKADTARRDFEDKTPLCLAAQYGQEDTFRCLQEKEEAQNRMQSNNLMPTPLSSAI EGEKLNIVKIMFEKLSEEAVKEVQYERHRKILTEQKYGQDEVTPLLMATQRRQRDIVDILLKNGASMDCADKNRV KPFFLAVDHGSEDVVECFLKNGAAVNSKNESGLTPLLMACQKGNMGIVKLLLGKDVNVNIARPGDSSTPLLLAVE SGNKSMVRALLKKKANCNIANAESLTPLWIAARAGNYTIADLLLSHDAYVNSTNASADSTPLHVAAKAGNENIVK LFLTGRVNKEAQDTQLMTPLFHAVEKNKQAIVKLLLEEGANVNTTRRNAETPLHFCCGAKMEEEEGMIQLLLSHS AGVKNQDGNRWTPVMHAAKAGKESIINLLLEKEPDLDLNYNSNGTTPFYLAVKHNRTSVVKFLLQRGVDYRTCPR GTTIFHSSVHVESIADDEEAAVEITELLFQMDMDFDSPDIDGSTPLSIAASCGSKALTGLLLDKKAEIDKPNEEG LTPLAVAIANGKLEVAEELISKGAKIETRDEKGWTPLRYAVDRQHKDITAMLLQKGADQDSRADDESTPLGAAAS HGDKKIVHSLLNNGAPSELNKPLWNALRAIGTRTSSRF* |
Coding | >Ophun1|4011 ATGAATCTACTTCGGCGTCGACAGCAGAGAACGGCGGACGAAGAGCTCGCTCTTGGCGCGGTACACCATGAGCCT GAGTCGAACCCTCGGAAGGAAAAGCAGCAGGAGCAGGAGCAGGAGCAGAAGCTTGCGGACTTGTTCAATGAACCA CGTGGGGACGCGCAGAAGCAGCGGATAAAGAAGCTCATCGACGGCAAGAATAACCTCGACGCGAGCACGGTGGAC AAAACAGGTAGAACATTGCTGCATTATGCAGCGCGACATGGTGATCGTTCGCTTGTGGAACTATTGCTACAGAGA ACGAAGACAGGGAGGCCTGAGCTGGGAATCCAAGATAAAGAAGAGCGAACGGCTTTACATGAAGCGGCAGACGAG GACCATCACGAGCTGATAGAATTGCTGGTCTCCTCTTCCGACGATGTCGTCTCCAAGCGGGATCTTCATGGCCGA ACCGCACTACACTGGGCGGCGAACAATGGCCACGATCTTACGGTGAAAGCGCTTCTTCAGCACATGACGGTGGAT CAGGTCGACTTTTTGGATAAATTCAACCAGACGGCTTTGCACAGAGCTGCTCGATCCGGGTTCTACGACATAGTC ACCATGATTCAGGTCAAGAACCCGGGCGACTCACGACCAGACGGGTCGATAATGGACGTCTTGGGTTTGAAGGAG ACAAGTATGGCCGAGACAAAAGACTATCTCCGAAAGCTTAAGTCTCACAAGAAATGGACCGAGATGAGCCAGGGG TTTGTTGAGCATCCAAATATGCTCAAACCAGTACTGTTTTGGCTCACCCAGAACGGCTTGAAGCACGTAGTGGCC CTGATGCTGGAGAAGCTGAAAAATGATGGGAGCGGATTGCATAGCCTGATAAACAGCACGGATTGTCTGAAGAGA ACGCCGCTGCACATAGCTTCCATTCGTGGCCATACGGCCATCGTTGAGTCGCTCCTCAGTCACAAAGCCGACACC GCAAGGCGAGATTTCGAGGACAAGACACCATTGTGTTTGGCCGCTCAGTACGGTCAGGAAGACACTTTTCGCTGC CTACAAGAGAAAGAAGAGGCGCAAAACCGCATGCAGTCAAATAATCTGATGCCAACACCGCTATCTTCCGCCATC GAAGGTGAAAAACTGAACATTGTCAAGATCATGTTTGAGAAGCTTTCCGAGGAAGCGGTCAAGGAAGTTCAGTAC GAAAGGCATCGCAAGATCTTGACAGAGCAGAAATATGGCCAAGACGAAGTGACGCCGCTCTTGATGGCCACGCAA CGCAGGCAGAGAGATATTGTCGACATACTTCTCAAAAACGGTGCCAGCATGGACTGCGCCGATAAAAATCGTGTC AAGCCGTTTTTCCTTGCTGTCGACCATGGCTCAGAGGATGTGGTTGAATGCTTCCTCAAAAACGGCGCAGCCGTC AACAGCAAGAATGAGTCTGGCTTGACGCCGCTTTTGATGGCTTGTCAGAAAGGGAATATGGGCATTGTGAAGCTC CTCCTCGGGAAAGATGTCAACGTGAACATTGCGCGTCCAGGTGATAGCTCGACACCGCTTTTGCTCGCCGTTGAA AGCGGCAACAAGTCTATGGTCAGAGCTCTTCTTAAGAAAAAGGCCAACTGCAACATTGCCAATGCAGAGAGCTTG ACGCCGCTTTGGATTGCCGCCCGAGCCGGCAACTATACAATTGCCGACCTTCTTCTCAGTCACGATGCCTATGTC AACAGTACGAACGCATCAGCAGACTCAACGCCGCTGCATGTGGCTGCTAAGGCTGGCAACGAAAATATTGTCAAA TTGTTTCTTACAGGACGAGTCAACAAGGAGGCACAGGACACACAACTCATGACGCCTCTCTTCCATGCGGTCGAG AAGAACAAGCAAGCCATAGTCAAATTACTTCTCGAAGAAGGTGCAAACGTCAACACTACGCGTCGAAATGCCGAA ACGCCTCTTCACTTTTGCTGTGGCGCAAAAATGGAAGAAGAGGAGGGCATGATACAGCTGCTGCTTTCGCATTCG GCTGGCGTGAAAAATCAGGATGGAAACCGCTGGACACCAGTCATGCACGCAGCCAAGGCTGGCAAGGAATCCATC ATCAACCTGCTACTCGAAAAGGAGCCCGACCTTGATTTAAACTACAACAGCAACGGTACGACGCCGTTCTATTTG GCCGTTAAACATAATAGAACGTCGGTCGTCAAATTTCTGCTTCAGCGTGGAGTCGACTACCGAACTTGCCCAAGG GGCACGACGATTTTCCACTCTTCTGTTCATGTTGAGAGCATAGCAGACGACGAAGAAGCGGCAGTCGAGATCACG GAGCTTCTGTTCCAGATGGACATGGACTTTGATAGTCCGGATATAGATGGGTCGACGCCGCTCTCGATAGCTGCC AGCTGCGGCAGCAAGGCTCTCACAGGATTACTCCTCGACAAGAAAGCAGAAATCGATAAACCCAATGAGGAGGGC CTGACTCCTCTGGCGGTCGCCATCGCCAACGGGAAACTGGAAGTTGCCGAAGAACTAATCAGCAAGGGCGCCAAG ATTGAGACACGCGATGAAAAAGGCTGGACGCCACTGAGATACGCTGTCGATCGTCAGCACAAGGATATCACCGCT ATGCTTCTTCAGAAAGGCGCCGATCAAGATAGTCGTGCTGATGATGAGTCGACGCCTCTGGGGGCCGCGGCCTCG CACGGAGACAAGAAAATCGTCCACTCGCTCCTCAACAACGGCGCCCCATCCGAGTTAAACAAGCCGCTATGGAAC GCCCTCAGGGCTATAGGAACAAGGACCTCGTCTCGCTTTTGA |
Transcript | >Ophun1|4011 ATGAATCTACTTCGGCGTCGACAGCAGAGAACGGCGGACGAAGAGCTCGCTCTTGGCGCGGTACACCATGAGCCT GAGTCGAACCCTCGGAAGGAAAAGCAGCAGGAGCAGGAGCAGGAGCAGAAGCTTGCGGACTTGTTCAATGAACCA CGTGGGGACGCGCAGAAGCAGCGGATAAAGAAGCTCATCGACGGCAAGAATAACCTCGACGCGAGCACGGTGGAC AAAACAGGTAGAACATTGCTGCATTATGCAGCGCGACATGGTGATCGTTCGCTTGTGGAACTATTGCTACAGAGA ACGAAGACAGGGAGGCCTGAGCTGGGAATCCAAGATAAAGAAGAGCGAACGGCTTTACATGAAGCGGCAGACGAG GACCATCACGAGCTGATAGAATTGCTGGTCTCCTCTTCCGACGATGTCGTCTCCAAGCGGGATCTTCATGGCCGA ACCGCACTACACTGGGCGGCGAACAATGGCCACGATCTTACGGTGAAAGCGCTTCTTCAGCACATGACGGTGGAT CAGGTCGACTTTTTGGATAAATTCAACCAGACGGCTTTGCACAGAGCTGCTCGATCCGGGTTCTACGACATAGTC ACCATGATTCAGGTCAAGAACCCGGGCGACTCACGACCAGACGGGTCGATAATGGACGTCTTGGGTTTGAAGGAG ACAAGTATGGCCGAGACAAAAGACTATCTCCGAAAGCTTAAGTCTCACAAGAAATGGACCGAGATGAGCCAGGGG TTTGTTGAGCATCCAAATATGCTCAAACCAGTACTGTTTTGGCTCACCCAGAACGGCTTGAAGCACGTAGTGGCC CTGATGCTGGAGAAGCTGAAAAATGATGGGAGCGGATTGCATAGCCTGATAAACAGCACGGATTGTCTGAAGAGA ACGCCGCTGCACATAGCTTCCATTCGTGGCCATACGGCCATCGTTGAGTCGCTCCTCAGTCACAAAGCCGACACC GCAAGGCGAGATTTCGAGGACAAGACACCATTGTGTTTGGCCGCTCAGTACGGTCAGGAAGACACTTTTCGCTGC CTACAAGAGAAAGAAGAGGCGCAAAACCGCATGCAGTCAAATAATCTGATGCCAACACCGCTATCTTCCGCCATC GAAGGTGAAAAACTGAACATTGTCAAGATCATGTTTGAGAAGCTTTCCGAGGAAGCGGTCAAGGAAGTTCAGTAC GAAAGGCATCGCAAGATCTTGACAGAGCAGAAATATGGCCAAGACGAAGTGACGCCGCTCTTGATGGCCACGCAA CGCAGGCAGAGAGATATTGTCGACATACTTCTCAAAAACGGTGCCAGCATGGACTGCGCCGATAAAAATCGTGTC AAGCCGTTTTTCCTTGCTGTCGACCATGGCTCAGAGGATGTGGTTGAATGCTTCCTCAAAAACGGCGCAGCCGTC AACAGCAAGAATGAGTCTGGCTTGACGCCGCTTTTGATGGCTTGTCAGAAAGGGAATATGGGCATTGTGAAGCTC CTCCTCGGGAAAGATGTCAACGTGAACATTGCGCGTCCAGGTGATAGCTCGACACCGCTTTTGCTCGCCGTTGAA AGCGGCAACAAGTCTATGGTCAGAGCTCTTCTTAAGAAAAAGGCCAACTGCAACATTGCCAATGCAGAGAGCTTG ACGCCGCTTTGGATTGCCGCCCGAGCCGGCAACTATACAATTGCCGACCTTCTTCTCAGTCACGATGCCTATGTC AACAGTACGAACGCATCAGCAGACTCAACGCCGCTGCATGTGGCTGCTAAGGCTGGCAACGAAAATATTGTCAAA TTGTTTCTTACAGGACGAGTCAACAAGGAGGCACAGGACACACAACTCATGACGCCTCTCTTCCATGCGGTCGAG AAGAACAAGCAAGCCATAGTCAAATTACTTCTCGAAGAAGGTGCAAACGTCAACACTACGCGTCGAAATGCCGAA ACGCCTCTTCACTTTTGCTGTGGCGCAAAAATGGAAGAAGAGGAGGGCATGATACAGCTGCTGCTTTCGCATTCG GCTGGCGTGAAAAATCAGGATGGAAACCGCTGGACACCAGTCATGCACGCAGCCAAGGCTGGCAAGGAATCCATC ATCAACCTGCTACTCGAAAAGGAGCCCGACCTTGATTTAAACTACAACAGCAACGGTACGACGCCGTTCTATTTG GCCGTTAAACATAATAGAACGTCGGTCGTCAAATTTCTGCTTCAGCGTGGAGTCGACTACCGAACTTGCCCAAGG GGCACGACGATTTTCCACTCTTCTGTTCATGTTGAGAGCATAGCAGACGACGAAGAAGCGGCAGTCGAGATCACG GAGCTTCTGTTCCAGATGGACATGGACTTTGATAGTCCGGATATAGATGGGTCGACGCCGCTCTCGATAGCTGCC AGCTGCGGCAGCAAGGCTCTCACAGGATTACTCCTCGACAAGAAAGCAGAAATCGATAAACCCAATGAGGAGGGC CTGACTCCTCTGGCGGTCGCCATCGCCAACGGGAAACTGGAAGTTGCCGAAGAACTAATCAGCAAGGGCGCCAAG ATTGAGACACGCGATGAAAAAGGCTGGACGCCACTGAGATACGCTGTCGATCGTCAGCACAAGGATATCACCGCT ATGCTTCTTCAGAAAGGCGCCGATCAAGATAGTCGTGCTGATGATGAGTCGACGCCTCTGGGGGCCGCGGCCTCG CACGGAGACAAGAAAATCGTCCACTCGCTCCTCAACAACGGCGCCCCATCCGAGTTAAACAAGCCGCTATGGAAC GCCCTCAGGGCTATAGGAACAAGGACCTCGTCTCGCTTTTGA |
Gene | >Ophun1|4011 ATGAATCTACTTCGGCGTCGACAGCAGAGAACGGCGGACGAAGAGCTCGCTCTTGGCGCGGTACACCATGAGCCT GAGTCGAACCCTCGGAAGGAAAAGCAGCAGGAGCAGGAGCAGGAGCAGAAGCTTGCGGACTTGTTCAATGAACCA CGTGGGGACGCGCAGAAGCAGCGGATAAAGAAGCTCATCGACGGCAAGAATAACCTCGACGCGAGCACGGTGGAC AAAACAGGTAGAACATTGCTGCATTATGCAGCGCGACATGGTGATCGTTCGCTTGTGGAACTATTGCTACAGAGA ACGAAGACAGGGAGGCCTGAGCTGGGAATCCAAGATAAAGAAGAGCGAACGGCTTTACATGAAGCGGCAGACGAG GACCATCACGAGCTGATAGAATTGCTGGTCTCCTCTTCCGACGATGTCGTCTCCAAGCGGGATCTTCATGGCCGA ACCGCACTACACTGGGCGGCGAACAATGGCCACGATCTTACGGTGAAAGCGCTTCTTCAGCACATGACGGTGGAT CAGGTCGACTTTTTGGATAAATTCAACCAGACGGCTTTGCACAGAGCTGCTCGATCCGGGTTCTACGACATAGTC ACCATGATTCAGGTCAAGAACCCGGGCGACTCACGACCAGACGGGTCGATAATGGACGTCTTGGGTTTGAAGGAG ACAAGTATGGCCGAGACAAAAGACTATCTCCGAAAGCTTAAGTCTCACAAGAAATGGACCGAGATGAGCCAGGGG TTTGTTGAGCATCCAAATATGCTCAAACCAGTACTGTTTTGGCTCACCCAGAACGGCTTGAAGCACGTAGTGGCC CTGATGCTGGAGAAGCTGAAAAATGATGGGAGCGGATTGCATAGCCTGATAAACAGCACGGATTGTCTGAAGAGA ACGCCGCTGCACATAGCTTCCATTCGTGGCCATACGGCCATCGTTGAGTCGCTCCTCAGTCACAAAGCCGACACC GCAAGGCGAGATTTCGAGGACAAGACACCATTGTGTTTGGCCGCTCAGTACGGTCAGGAAGACACTTTTCGCTGC CTACAAGAGAAAGAAGAGGCGCAAAACCGCATGCAGTCAAATAATCTGATGCCAACACCGCTATCTTCCGCCATC GAAGGTGAAAAACTGAACATTGTCAAGATCATGTTTGAGAAGCTTTCCGAGGAAGCGGTCAAGGAAGTTCAGTAC GAAAGGCATCGCAAGATCTTGACAGAGCAGAAATATGGCCAAGACGAAGTGACGCCGCTCTTGATGGCCACGCAA CGCAGGCAGAGAGATATTGTCGACATACTTCTCAAAAACGGTGCCAGCATGGACTGCGCCGATAAAAATCGTGTC AAGCCGTTTTTCCTTGCTGTCGACCATGGCTCAGAGGATGTGGTTGAATGCTTCCTCAAAAACGGCGCAGCCGTC AACAGCAAGAATGAGTCTGGCTTGACGCCGCTTTTGATGGCTTGTCAGAAAGGGAATATGGGCATTGTGAAGCTC CTCCTCGGGAAAGATGTCAACGTGAACATTGCGCGTCCAGGTGATAGCTCGACACCGCTTTTGCTCGCCGTTGAA AGCGGCAACAAGTCTATGGTCAGAGCTCTTCTTAAGAAAAAGGCCAACTGCAACATTGCCAATGCAGAGAGCTTG ACGCCGCTTTGGATTGCCGCCCGAGCCGGCAACTATACAATTGCCGACCTTCTTCTCAGTCACGATGCCTATGTC AACAGTACGAACGCATCAGCAGACTCAACGCCGCTGCATGTGGCTGCTAAGGCTGGCAACGAAAATATTGTCAAA TTGTTTCTTACAGGACGAGTCAACAAGGAGGCACAGGACACACAACTCATGACGCCTCTCTTCCATGCGGTCGAG AAGAACAAGCAAGCCATAGTCAAATTACTTCTCGAAGAAGGTGCAAACGTCAACACTACGCGTCGAAATGCCGAA ACGCCTCTTCACTTTTGCTGTGGCGCAAAAATGGAAGAAGAGGAGGGCATGATACAGCTGCTGCTTTCGCATTCG GCTGGCGTGAAAAATCAGGATGGAAACCGCTGGACACCAGTCATGCACGCAGCCAAGGCTGGCAAGGAATCCATC ATCAACCTGCTACTCGAAAAGGAGCCCGACCTTGATTTAAACTACAACAGCAACGGTACGACGCCGTTCTATTTG GCCGTTAAACATAATAGAACGTCGGTCGTCAAATTTCTGCTTCAGCGTGGAGTCGACTACCGAACTTGCCCAAGG GGCACGACGATTTTCCACTCTTCTGTTCATGTTGAGAGCATAGCAGACGACGAAGAAGCGGCAGTCGAGATCACG GAGCTTCTGTTCCAGATGGACATGGACTTTGATAGTCCGGATATAGATGGGTCGACGCCGCTCTCGATAGCTGCC AGCTGCGGCAGCAAGGCTCTCACAGGATTACTCCTCGACAAGAAAGCAGAAATCGATAAACCCAATGAGGAGGGC CTGACTCCTCTGGCGGTCGCCATCGCCAACGGGAAACTGGAAGTTGCCGAAGAACTAATCAGCAAGGGCGCCAAG ATTGAGACACGCGATGAAAAAGGCTGGACGCCACTGAGATACGCTGTCGATCGTCAGCACAAGGATATCACCGCT ATGCTTCTTCAGAAAGGCGCCGATCAAGATAGTCGTGCTGATGATGAGTCGACGCCTCTGGGGGCCGCGGCCTCG CACGGAGACAAGAAAATCGTCCACTCGCTCCTCAACAACGGCGCCCCATCCGAGTTAAACAAGCCGCTATGGAAC GCCCTCAGGGCTATAGGAACAAGGACCTCGTCTCGCTTTTGA |