Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4006
Gene name
LocationContig_363:16916..18695
Strand+
Gene length (bp)1779
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5435
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7304
Ophiocordyceps australis map64 (Brazil) OphauB2|7000
Ophiocordyceps camponoti-floridani Ophcf2|01068
Ophiocordyceps camponoti-rufipedis Ophun1|4006 (this protein)
Ophiocordyceps kimflemingae Ophio5|8545
Ophiocordyceps subramaniannii Hirsu2|597

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4006
MSSPDPAAAPSSAPPAPRRSSSSTPAASVDPVLRNALRYTVSAREYALLHRHVLSRARAVRRNVPGPASVERALA
PKQGQGIGHDYNAKAVRHALRVFATAWLGLRGKRAASKTPAARLSLSLSAVLLIYRLLYRFLLRLRAQLLHSQAE
PFRKRNPRVAAALTSTYAPAVGASLAGLALGGCPAQQLRVSIALWALFRALEFGWNACEADGLVWGSKNGKKRER
PWWFGSWLLQPFSFGQLLHACVFDRDCFPESYGSFIFKQSPVYLHQRPQDWPAHRLWPNAPQIVTSLAEMARLNW
PAYISPTLFPQKESLPPSLHTVAPLTSRAHPLLSSLSCATLHPSDPSCLRTYLTFWLDSFPPMARFFLALCSVLT
LLSRARALHDRPLATVQRIVARALGMSTFATGAISTAWASICLFQSWLPRHVLATRRFFLGGFLAGLWAWVERRH
GRSVFLYSARASVDSLWKVGVKRRWWRAMRGGDVWVFALALMLTGVVG*
Coding >Ophun1|4006
ATGTCATCACCGGATCCGGCAGCGGCCCCCTCGTCAGCGCCCCCCGCACCGCGAAGAAGCAGCTCCTCGACACCA
GCAGCCAGCGTGGACCCTGTACTGCGCAACGCACTGAGATACACCGTCTCGGCGCGAGAGTACGCTCTTCTGCAC
CGCCATGTTCTCTCGCGGGCGCGGGCGGTGCGCCGAAACGTGCCGGGCCCGGCCAGCGTCGAGCGGGCTCTGGCG
CCGAAGCAGGGCCAAGGCATCGGCCACGATTACAATGCCAAGGCTGTGCGGCATGCCTTGCGGGTCTTTGCTACC
GCTTGGTTGGGGCTGAGGGGGAAGCGCGCAGCTTCAAAGACGCCGGCGGCGCGGCTCTCGCTCTCGCTCTCGGCG
GTGCTGCTCATCTACCGACTGTTGTACCGGTTCCTGTTACGGCTGCGAGCCCAACTGCTTCACTCGCAGGCCGAG
CCCTTCCGCAAGCGCAACCCCCGCGTGGCAGCGGCGCTGACGTCGACGTATGCGCCGGCTGTTGGCGCATCCTTG
GCCGGGCTCGCCCTCGGAGGGTGTCCGGCGCAGCAGCTGCGCGTCTCCATCGCGCTGTGGGCTCTCTTCCGGGCC
CTCGAGTTCGGGTGGAACGCGTGCGAGGCTGATGGGCTCGTGTGGGGGTCGAAGAACGGGAAGAAGAGGGAGCGG
CCTTGGTGGTTTGGGAGCTGGTTGTTGCAGCCGTTTTCCTTTGGCCAGCTGCTGCATGCCTGCGTCTTTGACCGC
GATTGCTTCCCGGAGTCGTACGGCAGCTTCATCTTCAAGCAGTCGCCCGTCTACTTGCACCAACGACCCCAAGAC
TGGCCCGCTCACAGGCTGTGGCCGAACGCGCCGCAGATTGTCACCAGCCTGGCCGAGATGGCGCGGCTGAACTGG
CCAGCCTACATCTCGCCGACTCTGTTCCCGCAAAAGGAGAGCCTCCCCCCCTCGCTGCACACGGTGGCGCCCCTG
ACATCGCGCGCCCACCCGCTGTTGTCGTCGCTATCGTGCGCGACGCTACACCCGTCAGACCCGTCGTGTCTGCGG
ACGTACCTGACCTTTTGGCTCGACTCGTTCCCGCCCATGGCGCGCTTCTTCCTGGCGCTGTGCTCTGTGCTGACG
CTGCTTTCCCGAGCGCGAGCCCTTCACGACCGACCGCTGGCGACGGTGCAGCGCATCGTGGCGCGAGCGCTGGGA
ATGTCGACGTTCGCAACGGGCGCCATCTCAACGGCCTGGGCGTCCATCTGCCTGTTCCAGTCCTGGCTTCCACGC
CACGTGCTGGCAACGCGACGCTTCTTCCTCGGCGGCTTCCTCGCCGGACTGTGGGCCTGGGTCGAGCGCCGACAC
GGCCGCAGCGTCTTCCTGTACAGCGCGCGGGCCAGCGTCGACTCGCTGTGGAAGGTGGGCGTCAAGCGTCGGTGG
TGGCGGGCCATGCGCGGGGGGGACGTCTGGGTGTTTGCCCTGGCGCTGATGCTCACGGGCGTCGTGGGGTGA
Transcript >Ophun1|4006
ATGTCATCACCGGATCCGGCAGCGGCCCCCTCGTCAGCGCCCCCCGCACCGCGAAGAAGCAGCTCCTCGACACCA
GCAGCCAGCGTGGACCCTGTACTGCGCAACGCACTGAGATACACCGTCTCGGCGCGAGAGTACGCTCTTCTGCAC
CGCCATGTTCTCTCGCGGGCGCGGGCGGTGCGCCGAAACGTGCCGGGCCCGGCCAGCGTCGAGCGGGCTCTGGCG
CCGAAGCAGGGCCAAGGCATCGGCCACGATTACAATGCCAAGGCTGTGCGGCATGCCTTGCGGGTCTTTGCTACC
GCTTGGTTGGGGCTGAGGGGGAAGCGCGCAGCTTCAAAGACGCCGGCGGCGCGGCTCTCGCTCTCGCTCTCGGCG
GTGCTGCTCATCTACCGACTGTTGTACCGGTTCCTGTTACGGCTGCGAGCCCAACTGCTTCACTCGCAGGCCGAG
CCCTTCCGCAAGCGCAACCCCCGCGTGGCAGCGGCGCTGACGTCGACGTATGCGCCGGCTGTTGGCGCATCCTTG
GCCGGGCTCGCCCTCGGAGGGTGTCCGGCGCAGCAGCTGCGCGTCTCCATCGCGCTGTGGGCTCTCTTCCGGGCC
CTCGAGTTCGGGTGGAACGCGTGCGAGGCTGATGGGCTCGTGTGGGGGTCGAAGAACGGGAAGAAGAGGGAGCGG
CCTTGGTGGTTTGGGAGCTGGTTGTTGCAGCCGTTTTCCTTTGGCCAGCTGCTGCATGCCTGCGTCTTTGACCGC
GATTGCTTCCCGGAGTCGTACGGCAGCTTCATCTTCAAGCAGTCGCCCGTCTACTTGCACCAACGACCCCAAGAC
TGGCCCGCTCACAGGCTGTGGCCGAACGCGCCGCAGATTGTCACCAGCCTGGCCGAGATGGCGCGGCTGAACTGG
CCAGCCTACATCTCGCCGACTCTGTTCCCGCAAAAGGAGAGCCTCCCCCCCTCGCTGCACACGGTGGCGCCCCTG
ACATCGCGCGCCCACCCGCTGTTGTCGTCGCTATCGTGCGCGACGCTACACCCGTCAGACCCGTCGTGTCTGCGG
ACGTACCTGACCTTTTGGCTCGACTCGTTCCCGCCCATGGCGCGCTTCTTCCTGGCGCTGTGCTCTGTGCTGACG
CTGCTTTCCCGAGCGCGAGCCCTTCACGACCGACCGCTGGCGACGGTGCAGCGCATCGTGGCGCGAGCGCTGGGA
ATGTCGACGTTCGCAACGGGCGCCATCTCAACGGCCTGGGCGTCCATCTGCCTGTTCCAGTCCTGGCTTCCACGC
CACGTGCTGGCAACGCGACGCTTCTTCCTCGGCGGCTTCCTCGCCGGACTGTGGGCCTGGGTCGAGCGCCGACAC
GGCCGCAGCGTCTTCCTGTACAGCGCGCGGGCCAGCGTCGACTCGCTGTGGAAGGTGGGCGTCAAGCGTCGGTGG
TGGCGGGCCATGCGCGGGGGGGACGTCTGGGTGTTTGCCCTGGCGCTGATGCTCACGGGCGTCGTGGGGTGA
Gene >Ophun1|4006
ATGTCATCACCGGATCCGGCAGCGGCCCCCTCGTCAGCGCCCCCCGCACCGCGAAGAAGCAGCTCCTCGACACCA
GCAGCCAGCGTGGACCCTGTACTGCGCAACGCACTGAGATACACCGTCTCGGCGCGAGAGTACGCTCTTCTGCAC
CGCCATGTTCTCTCGCGGGCGCGGGCGGTGCGCCGAAACGTGCCGGGCCCGGCCAGCGTCGAGCGGGCTCTGGCG
CCGAAGCAGGGCCAAGGCATCGGCCACGATTACAATGCCAAGGCTGTGCGGCATGCCTTGCGGGTCTTTGCTACC
GCTTGGTTGGGGCTGAGGGGGTATGAAGCTGTGATGAAGAGGATTGGGGGCAAGGGGTAGGTGTTGTCTATTATT
TGTCTTTTCCTCCTCCCCGTCTTATATATATACCAAGGTGAGGATCTGGGCTTACCTTCTGTCGGGTCCAGGAAG
CGCGCAGCTTCAAAGACGCCGGCGGCGCGGCTCTCGCTCTCGCTCTCGGCGGTGCTGCTCATCTACCGACTGTTG
TACCGGTTCCTGTTACGGCTGCGAGCCCAACTGCTTCACTCGCAGGCCGAGCCCTTCCGCAAGCGCAACCCCCGC
GTGGCAGCGGCGCTGACGTCGACGTATGCGCCGGCTGTTGGCGCATCCTTGGCCGGGCTCGCCCTCGGAGGGTGT
CCGGCGCAGCAGCTGCGCGTCTCCATCGCGCTGTGGGCTCTCTTCCGGGCCCTCGAGTTCGGGTGGAACGCGTGC
GAGGCTGATGGGCTCGTGTGGGGGTCGAAGAACGGGAAGAAGAGGGAGCGGCCTTGGTGGTTTGGGAGCTGGTTG
TTGCAGCCGTTTTCCTTTGGCCAGCTGCTGCATGCCTGCGTCTTTGACCGCGATTGCTTCCCGGAGGTAGGCTTT
CTTCTTCACTTGCTTCTTATAACAACCCCCGAGACTGACTGCCCCTTAGTCGTACGGCAGCTTCATCTTCAAGCA
GTCGCCCGTCTACTTGCACCAACGACCCCAAGACTGGCCCGCTCACAGGCTGTGGCCGAACGCGCCGCAGATTGT
CACCAGCCTGGCCGAGATGGCGCGGCTGAACTGGCCGTACGTCTCCCAGCATCCATCCAAGAGACAAAGACTGAC
AGCGAACCCCAAGAGCCTACATCTCGCCGACTCTGTTCCCGCAAAAGGAGAGCCTCCCCCCCTCGCTGCACACGG
TGGCGCCCCTGACATCGCGCGCCCACCCGCTGTTGTCGTCGCTATCGTGCGCGACGCTACACCCGTCAGACCCGT
CGTGTCTGCGGACGTACCTGACCTTTTGGCTCGACTCGTTCCCGCCCATGGCGCGCTTCTTCCTGGCGCTGTGCT
CTGTGCTGACGCTGCTTTCCCGAGCGCGAGCCCTTCACGACCGACCGCTGGCGACGGTGCAGCGCATCGTGGCGC
GAGCGCTGGGAATGTCGACGTTCGCAACGGGCGCCATCTCAACGGCCTGGGCGTCCATCTGCCTGTTCCAGTCCT
GGCTTCCACGCCACGTGCTGGCAACGCGACGCTTCTTCCTCGGCGGCTTCCTCGCCGGACTGTGGGCCTGGGTCG
AGCGCCGACACGGCCGCAGCGTCTTCCTGTACAGCGCGCGGGCCAGCGTCGACTCGCTGTGGAAGGTGGGCGTCA
AGCGTCGGTGGTGGCGGGCCATGCGCGGGGGGGACGTCTGGGTGTTTGCCCTGGCGCTGATGCTCACGGGCGTCG
TGTACGAGCGGGATGCTAGGGCTGTGCGGGAGGCGAGCTGGCGGAAGGGGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail