Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|4
Gene name
LocationContig_1:9114..10041
Strand+
Gene length (bp)927
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15159 PIG-Y Phosphatidylinositol N-acetylglucosaminyltransferase subunit Y 2.7E-21 225 302

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|C6Y4B7|YIDS_SCHPO Uncharacterized protein C227.19c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.19c PE=2 SV=1 225 303 9.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 229 251 22
2 271 293 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|4
MNVPKSSGDEPPHRRPSSIFRLPFMRNSTESKVRADDEDGSAPAVSIAVQHYRTRRRRGSLRKVALLGRGAQRDK
REDRSSAIHSAAATEVDSDAGLVEHDALGLKIPKLPPPVHDDSVIFPTGSSHATLSASATIGDRDTERSNLYAST
TDEEDLLHMPSVSSPPRASLSMSSGSESYFATQAIADRRASFQQAKSPLSYSGISTNALPPPAADWDYSETEWWG
WVVVTVTWFVFVMGMGSCLDIWSWAWDVGKTPYAPPELEDDPTLPIVGYYPALIILTVVMAWVWVVVAWVGMKYF
RHAKISGD*
Coding >Ophun1|4
ATGAATGTCCCCAAGAGCAGTGGCGACGAACCCCCGCACCGACGACCGTCATCTATCTTCCGCCTACCGTTTATG
CGCAACTCCACCGAGTCCAAAGTGCGAGCCGACGATGAGGATGGCTCTGCCCCCGCCGTCTCCATCGCCGTCCAG
CACTACAGGACGCGCCGGCGAAGAGGCTCCCTGAGGAAGGTAGCTCTCCTCGGCAGGGGCGCGCAGCGCGACAAG
CGAGAGGATCGATCGTCGGCTATCCACTCGGCAGCTGCGACCGAGGTCGATTCAGACGCGGGCCTCGTGGAGCAT
GACGCGCTGGGGCTCAAGATTCCTAAGCTTCCGCCTCCGGTTCACGATGATTCTGTGATTTTTCCGACGGGCTCG
TCGCATGCTACGTTGAGTGCTTCGGCGACGATTGGTGATAGGGATACTGAGCGGTCCAACTTGTATGCTTCCACC
ACGGATGAGGAGGACTTGCTTCACATGCCTTCTGTCTCGTCACCGCCTCGGGCATCATTGTCCATGTCATCGGGA
TCCGAGTCCTACTTCGCAACGCAAGCAATCGCAGACCGTCGGGCGTCATTCCAACAAGCCAAGTCGCCGTTGTCA
TATAGCGGCATCTCTACAAACGCCCTGCCTCCGCCGGCCGCCGACTGGGATTACTCGGAGACGGAGTGGTGGGGA
TGGGTTGTCGTCACCGTTACCTGGTTCGTCTTCGTTATGGGCATGGGCTCTTGTCTTGATATCTGGAGTTGGGCC
TGGGACGTGGGAAAGACGCCGTACGCGCCGCCGGAACTTGAAGATGACCCGACCCTGCCCATCGTCGGTTATTAT
CCCGCTCTCATTATTCTGACCGTCGTTATGGCCTGGGTATGGGTAGTTGTAGCCTGGGTTGGCATGAAGTATTTC
CGACATGCGAAAATAAGCGGTGATTGA
Transcript >Ophun1|4
ATGAATGTCCCCAAGAGCAGTGGCGACGAACCCCCGCACCGACGACCGTCATCTATCTTCCGCCTACCGTTTATG
CGCAACTCCACCGAGTCCAAAGTGCGAGCCGACGATGAGGATGGCTCTGCCCCCGCCGTCTCCATCGCCGTCCAG
CACTACAGGACGCGCCGGCGAAGAGGCTCCCTGAGGAAGGTAGCTCTCCTCGGCAGGGGCGCGCAGCGCGACAAG
CGAGAGGATCGATCGTCGGCTATCCACTCGGCAGCTGCGACCGAGGTCGATTCAGACGCGGGCCTCGTGGAGCAT
GACGCGCTGGGGCTCAAGATTCCTAAGCTTCCGCCTCCGGTTCACGATGATTCTGTGATTTTTCCGACGGGCTCG
TCGCATGCTACGTTGAGTGCTTCGGCGACGATTGGTGATAGGGATACTGAGCGGTCCAACTTGTATGCTTCCACC
ACGGATGAGGAGGACTTGCTTCACATGCCTTCTGTCTCGTCACCGCCTCGGGCATCATTGTCCATGTCATCGGGA
TCCGAGTCCTACTTCGCAACGCAAGCAATCGCAGACCGTCGGGCGTCATTCCAACAAGCCAAGTCGCCGTTGTCA
TATAGCGGCATCTCTACAAACGCCCTGCCTCCGCCGGCCGCCGACTGGGATTACTCGGAGACGGAGTGGTGGGGA
TGGGTTGTCGTCACCGTTACCTGGTTCGTCTTCGTTATGGGCATGGGCTCTTGTCTTGATATCTGGAGTTGGGCC
TGGGACGTGGGAAAGACGCCGTACGCGCCGCCGGAACTTGAAGATGACCCGACCCTGCCCATCGTCGGTTATTAT
CCCGCTCTCATTATTCTGACCGTCGTTATGGCCTGGGTATGGGTAGTTGTAGCCTGGGTTGGCATGAAGTATTTC
CGACATGCGAAAATAAGCGGTGATTGA
Gene >Ophun1|4
ATGAATGTCCCCAAGAGCAGTGGCGACGAACCCCCGCACCGACGACCGTCATCTATCTTCCGCCTACCGTTTATG
CGCAACTCCACCGAGTCCAAAGTGCGAGCCGACGATGAGGATGGCTCTGCCCCCGCCGTCTCCATCGCCGTCCAG
CACTACAGGACGCGCCGGCGAAGAGGCTCCCTGAGGAAGGTAGCTCTCCTCGGCAGGGGCGCGCAGCGCGACAAG
CGAGAGGATCGATCGTCGGCTATCCACTCGGCAGCTGCGACCGAGGTCGATTCAGACGCGGGCCTCGTGGAGCAT
GACGCGCTGGGGCTCAAGATTCCTAAGCTTCCGCCTCCGGTTCACGATGATTCTGTGATTTTTCCGACGGGCTCG
TCGCATGCTACGTTGAGTGCTTCGGCGACGATTGGTGATAGGGATACTGAGCGGTCCAACTTGTATGCTTCCACC
ACGGATGAGGAGGACTTGCTTCACATGCCTTCTGTCTCGTCACCGCCTCGGGCATCATTGTCCATGTCATCGGGA
TCCGAGTCCTACTTCGCAACGCAAGCAATCGCAGACCGTCGGGCGTCATTCCAACAAGCCAAGTCGCCGTTGTCA
TATAGCGGCATCTCTACAAACGCCCTGCCTCCGCCGGCCGCCGACTGGGATTACTCGGAGACGGAGTGGTGGGGA
TGGGTTGTCGTCACCGTTACCTGGTTCGTCTTCGTTATGGGCATGGGCTCTTGTCTTGATATCTGGAGTTGGGCC
TGGGACGTGGGAAAGACGCCGTACGCGCCGCCGGAACTTGAAGATGACCCGACCCTGCCCATCGTCGGTTATTAT
CCCGCTCTCATTATTCTGACCGTCGTTATGGCCTGGGTATGGGTAGTTGTAGCCTGGGTTGGCATGAAGTATTTC
CGACATGCGAAAATAAGCGGTGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail