Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3994
Gene name
LocationContig_362:4633..6284
Strand-
Gene length (bp)1651
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.3E-25 60 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 37 480 7.0E-42
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 26 508 1.0E-38
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 42 453 9.0E-36
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 23 509 3.0E-35
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 21 485 5.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6J0|YHDC_SCHPO Uncharacterized transporter C1683.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1683.12 PE=3 SV=1 37 480 7.0E-42
sp|P53322|TNA1_YEAST High-affinity nicotinic acid transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TNA1 PE=1 SV=1 26 508 1.0E-38
sp|Q10097|YAOI_SCHPO Uncharacterized transporter C11D3.18C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.18c PE=3 SV=1 42 453 9.0E-36
sp|Q9US44|YIZG_SCHPO Uncharacterized transporter C1002.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1002.16c PE=3 SV=1 23 509 3.0E-35
sp|Q9US37|YFZ4_SCHPO Uncharacterized transporter C1039.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1039.04 PE=3 SV=1 21 485 5.0E-34
sp|P70786|TUB3_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 36 342 3.0E-28
sp|Q44470|TUB4_AGRVI Putative tartrate transporter OS=Agrobacterium vitis GN=ttuB PE=2 SV=1 45 362 3.0E-27
sp|O94491|YC7A_SCHPO Uncharacterized transporter C417.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC417.10 PE=3 SV=1 2 436 9.0E-26
sp|O94572|YGDF_SCHPO Uncharacterized transporter C1773.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.15 PE=3 SV=1 24 481 3.0E-24
sp|Q07904|THI73_YEAST Thiamine pathway transporter THI73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=THI73 PE=1 SV=1 2 480 9.0E-23
sp|P15365|DAL5_YEAST Allantoate permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAL5 PE=1 SV=1 29 481 8.0E-19
sp|P76470|RHMT_ECOLI Inner membrane transport protein RhmT OS=Escherichia coli (strain K12) GN=rhmT PE=1 SV=2 55 386 1.0E-18
sp|P40445|YIQ6_YEAST Uncharacterized transporter YIL166C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YIL166C PE=1 SV=1 37 478 3.0E-17
sp|Q9C0U9|YQD3_SCHPO Uncharacterized transporter PB1C11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCPB1C11.03 PE=1 SV=1 41 476 1.0E-16
sp|Q05181|PHT1_PSEPU Phthalate transporter OS=Pseudomonas putida GN=pht1 PE=3 SV=1 34 359 2.0E-16
sp|Q88FY6|NICT_PSEPK Putative metabolite transport protein NicT OS=Pseudomonas putida (strain KT2440) GN=nicT PE=2 SV=1 43 353 5.0E-16
sp|O43000|LIZ1_SCHPO Pantothenate transporter liz1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=liz1 PE=2 SV=2 45 266 4.0E-15
sp|O74923|YJ7D_SCHPO Uncharacterized transporter C757.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC757.13 PE=3 SV=1 33 332 6.0E-14
sp|B5BP49|YP55_SCHPO Uncharacterized transporter C460.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC460.05 PE=3 SV=1 22 508 1.0E-12
sp|P39709|SEO1_YEAST Probable transporter SEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEO1 PE=1 SV=1 41 479 9.0E-10
sp|Q9C0V8|YHJ1_SCHPO Uncharacterized transporter PB10D8.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPB10D8.01 PE=3 SV=1 41 463 1.0E-09
sp|P25621|FEN2_YEAST Pantothenate transporter FEN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FEN2 PE=1 SV=1 24 338 7.0E-08
sp|P0CF20|YO163_YEAST Putative uncharacterized transporter YOL163W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL163W PE=5 SV=1 130 235 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.5

Transmembrane Domains

Domain # Start End Length
1 114 136 22
2 151 173 22
3 186 208 22
4 213 235 22
5 278 300 22
6 310 332 22
7 345 367 22
8 371 393 22
9 406 428 22
10 433 455 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3994
MAVVVNSRTASPSFAQTGGELDFDSASESEIEIAGHDAVYTPQQEKQVVDLLDRKLVLFIALLYMLSFLDRSNIG
NARIAGMEPDLQTSPPLSTWYDWCLTSFYATYMASAWLALIWRLVPAHVLVTVVVLVWGVAASVQAVVPSYPYLV
ALRAVLAVGEAGFTGVPLYLSWFYPREELALRTGYFISAAPLASSFASALAWLILRFASLSPIAPWRLLFLAEGL
PSVLASVTAWTRIPDSPQKAPFLTPRQRLIAHLRLPPDAPPSQQTHVLADPIAWTAAIILLLANMAYASLPVFLP
LLVRDMGHGPVAAQALSAPPFLVSFVAVLVTARFSDRLRDRTAPLVAHAVASAMGYALLAAAPLLHLPPLLRYLA
LFPAAAGFFCVVTLIITWNINNQPGRHRQGLAFALMQFVGQCGPLIGTRLYPARHAPFYTPGMLVCACAMSVVAV
LGLVLRRLLRRHNLDMDRADDEMLTEERERLVGEGESMASTASKSMRITEKTARFRYIL*
Coding >Ophun1|3994
ATGGCGGTGGTGGTGAACTCGCGGACGGCGAGCCCTTCGTTTGCGCAGACGGGTGGTGAGCTGGACTTTGACTCG
GCGTCTGAGTCGGAGATTGAGATTGCTGGCCATGACGCTGTCTATACGCCGCAGCAGGAGAAGCAGGTCGTCGAC
CTCCTCGACCGCAAACTCGTCCTCTTCATCGCCCTGCTCTACATGCTCAGCTTCCTCGACCGCTCCAACATAGGC
AACGCCCGCATAGCCGGCATGGAACCCGATCTCCAAACCTCCCCCCCGCTCTCAACCTGGTACGACTGGTGTCTG
ACCTCGTTCTACGCAACCTACATGGCCAGCGCCTGGCTCGCCCTCATCTGGCGCCTCGTCCCCGCCCACGTGCTC
GTCACCGTCGTCGTCTTGGTCTGGGGGGTTGCTGCCTCGGTGCAGGCTGTTGTGCCGTCGTACCCGTATCTCGTT
GCCTTGCGGGCTGTGCTGGCTGTTGGAGAGGCGGGCTTCACGGGCGTGCCCTTGTATCTCTCGTGGTTTTACCCG
AGGGAGGAATTGGCCTTGCGGACGGGATACTTCATCTCTGCCGCGCCTCTCGCCTCAAGCTTCGCCTCAGCCCTC
GCCTGGCTCATCCTCCGCTTCGCATCCCTCAGCCCCATCGCCCCCTGGCGCCTCCTCTTCCTAGCAGAAGGCCTC
CCCTCCGTCCTCGCCTCCGTCACCGCCTGGACCCGAATCCCAGACTCCCCCCAAAAAGCCCCCTTCCTCACCCCC
CGCCAACGCCTCATCGCCCACCTCCGTCTCCCCCCCGACGCGCCTCCATCACAGCAGACACACGTGCTGGCAGAT
CCCATCGCCTGGACGGCAGCCATCATCCTCCTGCTGGCCAACATGGCCTACGCTTCTCTGCCCGTCTTCCTCCCT
CTTCTTGTGAGGGATATGGGTCATGGCCCTGTTGCCGCTCAAGCGCTTTCGGCGCCGCCTTTTCTCGTTTCCTTT
GTTGCTGTTCTCGTTACTGCTCGTTTCTCGGACAGGCTTCGGGATCGGACGGCTCCGCTTGTTGCTCATGCTGTG
GCTTCGGCCATGGGATATGCTCTTCTCGCTGCTGCGCCGCTGCTTCATCTCCCGCCGTTGCTGCGGTATCTCGCC
CTCTTTCCTGCGGCTGCTGGCTTCTTCTGCGTCGTCACCCTCATCATCACCTGGAATATCAATAACCAGCCCGGA
CGACATCGTCAGGGACTCGCCTTTGCCCTCATGCAGTTCGTCGGTCAGTGCGGGCCTCTGATAGGCACTCGTCTC
TATCCCGCCCGTCACGCCCCCTTTTACACGCCCGGTATGTTGGTCTGTGCCTGTGCCATGAGCGTCGTCGCCGTC
TTGGGCCTGGTCCTACGTCGTTTGCTGCGCCGTCATAATCTGGACATGGATAGGGCCGACGACGAGATGCTCACC
GAGGAACGGGAGCGGCTGGTCGGCGAGGGGGAGTCCATGGCGTCTACGGCGTCCAAGTCGATGAGGATCACCGAG
AAGACAGCCAGGTTCAGATACATACTGTAG
Transcript >Ophun1|3994
ATGGCGGTGGTGGTGAACTCGCGGACGGCGAGCCCTTCGTTTGCGCAGACGGGTGGTGAGCTGGACTTTGACTCG
GCGTCTGAGTCGGAGATTGAGATTGCTGGCCATGACGCTGTCTATACGCCGCAGCAGGAGAAGCAGGTCGTCGAC
CTCCTCGACCGCAAACTCGTCCTCTTCATCGCCCTGCTCTACATGCTCAGCTTCCTCGACCGCTCCAACATAGGC
AACGCCCGCATAGCCGGCATGGAACCCGATCTCCAAACCTCCCCCCCGCTCTCAACCTGGTACGACTGGTGTCTG
ACCTCGTTCTACGCAACCTACATGGCCAGCGCCTGGCTCGCCCTCATCTGGCGCCTCGTCCCCGCCCACGTGCTC
GTCACCGTCGTCGTCTTGGTCTGGGGGGTTGCTGCCTCGGTGCAGGCTGTTGTGCCGTCGTACCCGTATCTCGTT
GCCTTGCGGGCTGTGCTGGCTGTTGGAGAGGCGGGCTTCACGGGCGTGCCCTTGTATCTCTCGTGGTTTTACCCG
AGGGAGGAATTGGCCTTGCGGACGGGATACTTCATCTCTGCCGCGCCTCTCGCCTCAAGCTTCGCCTCAGCCCTC
GCCTGGCTCATCCTCCGCTTCGCATCCCTCAGCCCCATCGCCCCCTGGCGCCTCCTCTTCCTAGCAGAAGGCCTC
CCCTCCGTCCTCGCCTCCGTCACCGCCTGGACCCGAATCCCAGACTCCCCCCAAAAAGCCCCCTTCCTCACCCCC
CGCCAACGCCTCATCGCCCACCTCCGTCTCCCCCCCGACGCGCCTCCATCACAGCAGACACACGTGCTGGCAGAT
CCCATCGCCTGGACGGCAGCCATCATCCTCCTGCTGGCCAACATGGCCTACGCTTCTCTGCCCGTCTTCCTCCCT
CTTCTTGTGAGGGATATGGGTCATGGCCCTGTTGCCGCTCAAGCGCTTTCGGCGCCGCCTTTTCTCGTTTCCTTT
GTTGCTGTTCTCGTTACTGCTCGTTTCTCGGACAGGCTTCGGGATCGGACGGCTCCGCTTGTTGCTCATGCTGTG
GCTTCGGCCATGGGATATGCTCTTCTCGCTGCTGCGCCGCTGCTTCATCTCCCGCCGTTGCTGCGGTATCTCGCC
CTCTTTCCTGCGGCTGCTGGCTTCTTCTGCGTCGTCACCCTCATCATCACCTGGAATATCAATAACCAGCCCGGA
CGACATCGTCAGGGACTCGCCTTTGCCCTCATGCAGTTCGTCGGTCAGTGCGGGCCTCTGATAGGCACTCGTCTC
TATCCCGCCCGTCACGCCCCCTTTTACACGCCCGGTATGTTGGTCTGTGCCTGTGCCATGAGCGTCGTCGCCGTC
TTGGGCCTGGTCCTACGTCGTTTGCTGCGCCGTCATAATCTGGACATGGATAGGGCCGACGACGAGATGCTCACC
GAGGAACGGGAGCGGCTGGTCGGCGAGGGGGAGTCCATGGCGTCTACGGCGTCCAAGTCGATGAGGATCACCGAG
AAGACAGCCAGGTTCAGATACATACTGTAG
Gene >Ophun1|3994
ATGGCGGTGGTGGTGAACTCGCGGACGGCGAGCCCTTCGTTTGCGCAGACGGGTGGTGAGCTGGACTTTGACTCG
GCGTCTGAGTCGGAGATTGAGATTGCTGGCCATGACGCTGTCTATACGCCGCAGCAGGAGAAGCAGGTCGTCGAC
CTCCTCGACCGCAAACTCGTCCTCTTCATCGCCCTGCTCTACATGCTCAGCTTCCTCGACCGCTCCAGTAAGCAA
TCAATCCATCCATCCCCCTTATCAATCCCCCATCTAACACGCCCACCCAAGACATAGGCAACGCCCGCATAGCCG
GCATGGAACCCGATCTCCAAACCTCCCCCCCGCTCTCAACCTGGTACGACTGGTGTCTGACCTCGTTCTACGCAA
CCTACATGGCCAGCGCCTGGCTCGCCCTCATCTGGCGCCTCGTCCCCGCCCACGTGCTCGTCACCGTCGTCGTCT
TGGTCTGGGGGGTTGCTGCCTCGGTGCAGGCTGTTGTGCCGTCGTACCCGTATCTCGTTGCCTTGCGGGCTGTGC
TGGCTGTTGGAGAGGCGGGCTTCACGGGCGTGCCCTTGTATCTCTCGTGGTTTTACCCGAGGGAGGAATTGGCCT
TGCGGACGGGATACTTCATCTCTGGTGAGCCTCATCAACGAGTATGAATACTAGGTATAGGGAGGGAGTCAACTG
ACGATATCCAGCCGCGCCTCTCGCCTCAAGCTTCGCCTCAGCCCTCGCCTGGCTCATCCTCCGCTTCGCATCCCT
CAGCCCCATCGCCCCCTGGCGCCTCCTCTTCCTAGCAGAAGGCCTCCCCTCCGTCCTCGCCTCCGTCACCGCCTG
GACCCGAATCCCAGACTCCCCCCAAAAAGCCCCCTTCCTCACCCCCCGCCAACGCCTCATCGCCCACCTCCGTCT
CCCCCCCGACGCGCCTCCATCACAGCAGACACACGTGCTGGCAGATCCCATCGCCTGGACGGCAGCCATCATCCT
CCTGCTGGCCAACATGGCCTACGCTTCTCTGCCCGTCTTCCTCCCTCTTCTTGTGAGGGATATGGGTCATGGCCC
TGTTGCCGCTCAAGCGCTTTCGGCGCCGCCTTTTCTCGTTTCCTTTGTTGCTGTTCTCGTTACTGCTCGTTTCTC
GGACAGGCTTCGGGATCGGACGGCTCCGCTTGTTGCTCATGCTGTGGCTTCGGCCATGGGATATGCTCTTCTCGC
TGCTGCGCCGCTGCTTCATCTCCCGCCGTTGCTGCGGTATCTCGCCCTCTTTCCTGCGGCTGCTGGCTTCTTCTG
CGTCGTCACCCTCATCATCACCTGGAATATCAATAACCAGCCCGGACGACATCGTCAGGGACTCGCCTTTGCCCT
CATGCAGTTCGTCGGTCAGTGCGGGCCTCTGATAGGCACTCGTCTCTATCCCGCCCGTCACGCCCCCTTTTACAC
GCCCGGTATGTTGGTCTGTGCCTGTGCCATGAGCGTCGTCGCCGTCTTGGGCCTGGTCCTACGTCGTTTGCTGCG
CCGTCATAATCTGGACATGGATAGGGCCGACGACGAGATGCTCACCGAGGAACGGGAGCGGCTGGTCGGCGAGGG
GGAGTCCATGGCGTCTACGGCGTCCAAGTCGATGAGGATCACCGAGAAGACAGCCAGGTTCAGATACATACTGTA
G

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail