Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3992
Gene name
LocationContig_362:1381..2486
Strand-
Gene length (bp)1105
Transcript length (bp)1002
Coding sequence length (bp)1002
Protein length (aa) 334

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05368 NmrA NmrA-like family 6.1E-41 8 256
PF13460 NAD_binding_10 NAD(P)H-binding 4.5E-16 12 146
PF01370 Epimerase NAD dependent epimerase/dehydratase family 1.8E-04 8 119

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZID0|NMRL1_CHICK NmrA-like family domain-containing protein 1 OS=Gallus gallus GN=NMRAL1 PE=2 SV=1 3 282 2.0E-28
sp|Q54LJ8|NMRL1_DICDI NmrA-like family domain-containing protein DDB_G0286605 OS=Dictyostelium discoideum GN=DDB_G0286605 PE=2 SV=1 5 308 3.0E-28
sp|Q0VCN1|NMRL1_BOVIN NmrA-like family domain-containing protein 1 OS=Bos taurus GN=NMRAL1 PE=2 SV=1 6 282 2.0E-26
sp|Q9HBL8|NMRL1_HUMAN NmrA-like family domain-containing protein 1 OS=Homo sapiens GN=NMRAL1 PE=1 SV=1 6 282 3.0E-25
sp|Q8K2T1|NMRL1_MOUSE NmrA-like family domain-containing protein 1 OS=Mus musculus GN=Nmral1 PE=1 SV=1 6 282 2.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5ZID0|NMRL1_CHICK NmrA-like family domain-containing protein 1 OS=Gallus gallus GN=NMRAL1 PE=2 SV=1 3 282 2.0E-28
sp|Q54LJ8|NMRL1_DICDI NmrA-like family domain-containing protein DDB_G0286605 OS=Dictyostelium discoideum GN=DDB_G0286605 PE=2 SV=1 5 308 3.0E-28
sp|Q0VCN1|NMRL1_BOVIN NmrA-like family domain-containing protein 1 OS=Bos taurus GN=NMRAL1 PE=2 SV=1 6 282 2.0E-26
sp|Q9HBL8|NMRL1_HUMAN NmrA-like family domain-containing protein 1 OS=Homo sapiens GN=NMRAL1 PE=1 SV=1 6 282 3.0E-25
sp|Q8K2T1|NMRL1_MOUSE NmrA-like family domain-containing protein 1 OS=Mus musculus GN=Nmral1 PE=1 SV=1 6 282 2.0E-24
sp|Q5AU62|NMRA_EMENI Nitrogen metabolite repression protein nmrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nmrA PE=1 SV=1 1 255 3.0E-09
sp|P86172|NMRL1_RAT NmrA-like family domain-containing protein 1 (Fragments) OS=Rattus norvegicus GN=Nmral1 PE=1 SV=1 6 90 1.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7369
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03987
Ophiocordyceps camponoti-rufipedis Ophun1|3992 (this protein)
Ophiocordyceps kimflemingae Ophio5|4240

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3992
MASQAKTIAVFGATGKQGGAVARSLLANKAFVVRAITRNPASDASRALAEAGAHVVQADGFDGEQMRRAFDGCWG
AFVNLNSDDPLFRKPGAPTEVDLGKTIVDAAVAAGVEHFVFSSGPPCVEMTDGKVNMKAMESKYKIETYARQLGR
FKTLTAINAAWYLENFLDDQAAPIFGGFPFFPDDDGYLTMRAPHWGGSNEVPFVSMGDDYGDIVQGIFLEPERYD
GRVIHGASFMVPFEKLVAAFEEATGKKARYEPLLPDWEAFDTKGIPELDDVKLMFAFTQTTGGLYFDKVPSETAT
ATELKRISGKATSRSEELVRPKEWFAKHFATSS*
Coding >Ophun1|3992
ATGGCGTCCCAGGCAAAGACCATTGCCGTCTTCGGCGCCACCGGCAAGCAGGGCGGTGCCGTTGCCCGCTCTCTT
CTCGCCAATAAGGCCTTTGTCGTCCGGGCCATCACCCGCAATCCGGCTTCCGATGCCAGCCGGGCACTGGCCGAG
GCGGGCGCTCACGTCGTTCAGGCTGATGGCTTCGATGGAGAGCAGATGCGTCGTGCTTTTGACGGCTGCTGGGGT
GCTTTTGTCAACCTCAACTCGGATGATCCGCTGTTCAGGAAGCCGGGGGCTCCTACAGAGGTCGACCTCGGCAAG
ACGATTGTCGATGCTGCCGTGGCAGCTGGTGTTGAGCACTTTGTCTTCAGCTCCGGTCCGCCGTGCGTTGAGATG
ACTGATGGCAAGGTGAACATGAAGGCCATGGAGTCGAAATACAAGATCGAGACGTACGCCCGACAGCTGGGCCGC
TTCAAGACGTTGACGGCCATCAACGCCGCCTGGTATCTGGAAAACTTCCTCGACGACCAGGCGGCTCCCATCTTT
GGCGGCTTCCCCTTCTTCCCCGACGATGATGGCTACCTGACGATGCGCGCGCCTCACTGGGGTGGCTCCAATGAG
GTTCCCTTCGTCAGCATGGGCGACGACTACGGCGACATTGTGCAGGGCATCTTTCTCGAGCCTGAACGGTATGAT
GGCCGCGTCATTCACGGGGCCAGCTTCATGGTGCCGTTTGAGAAGCTCGTCGCCGCCTTTGAAGAGGCAACCGGC
AAAAAAGCCCGTTACGAGCCTCTGCTGCCCGACTGGGAAGCCTTTGACACAAAGGGCATTCCCGAGCTGGACGAC
GTCAAGCTCATGTTTGCCTTTACGCAGACGACGGGCGGTCTGTACTTTGACAAGGTCCCGAGCGAGACGGCGACG
GCGACGGAGTTGAAGCGGATCTCTGGCAAGGCAACGTCTCGGTCTGAGGAGTTGGTGAGGCCCAAGGAGTGGTTT
GCGAAGCACTTTGCGACATCGAGCTAG
Transcript >Ophun1|3992
ATGGCGTCCCAGGCAAAGACCATTGCCGTCTTCGGCGCCACCGGCAAGCAGGGCGGTGCCGTTGCCCGCTCTCTT
CTCGCCAATAAGGCCTTTGTCGTCCGGGCCATCACCCGCAATCCGGCTTCCGATGCCAGCCGGGCACTGGCCGAG
GCGGGCGCTCACGTCGTTCAGGCTGATGGCTTCGATGGAGAGCAGATGCGTCGTGCTTTTGACGGCTGCTGGGGT
GCTTTTGTCAACCTCAACTCGGATGATCCGCTGTTCAGGAAGCCGGGGGCTCCTACAGAGGTCGACCTCGGCAAG
ACGATTGTCGATGCTGCCGTGGCAGCTGGTGTTGAGCACTTTGTCTTCAGCTCCGGTCCGCCGTGCGTTGAGATG
ACTGATGGCAAGGTGAACATGAAGGCCATGGAGTCGAAATACAAGATCGAGACGTACGCCCGACAGCTGGGCCGC
TTCAAGACGTTGACGGCCATCAACGCCGCCTGGTATCTGGAAAACTTCCTCGACGACCAGGCGGCTCCCATCTTT
GGCGGCTTCCCCTTCTTCCCCGACGATGATGGCTACCTGACGATGCGCGCGCCTCACTGGGGTGGCTCCAATGAG
GTTCCCTTCGTCAGCATGGGCGACGACTACGGCGACATTGTGCAGGGCATCTTTCTCGAGCCTGAACGGTATGAT
GGCCGCGTCATTCACGGGGCCAGCTTCATGGTGCCGTTTGAGAAGCTCGTCGCCGCCTTTGAAGAGGCAACCGGC
AAAAAAGCCCGTTACGAGCCTCTGCTGCCCGACTGGGAAGCCTTTGACACAAAGGGCATTCCCGAGCTGGACGAC
GTCAAGCTCATGTTTGCCTTTACGCAGACGACGGGCGGTCTGTACTTTGACAAGGTCCCGAGCGAGACGGCGACG
GCGACGGAGTTGAAGCGGATCTCTGGCAAGGCAACGTCTCGGTCTGAGGAGTTGGTGAGGCCCAAGGAGTGGTTT
GCGAAGCACTTTGCGACATCGAGCTAG
Gene >Ophun1|3992
ATGGCGTCCCAGGCAAAGACCATTGCCGTCTTCGGCGCCACCGGCAAGCAGGGCGGTGCCGTTGCCCGCTCTCTT
CTCGCCAATAAGGCCTTTGTCGTCCGGGCCATCACCCGCAATCCGGCTTCCGATGCCAGCCGGGCACTGGCCGAG
GCGGGCGCTCACGTCGTTCAGGCTGATGGCTTCGATGGAGAGCAGATGCGTCGTGCTTTTGACGGCTGCTGGGGT
GCTTTTGTCAACCTCAACTCGGATGATCCGCTGTTCAGGAAGCCGGGGGCTCCTACAGAGGTCGACCTCGGCAAG
ACGATTGTCGATGCTGCCGTGGCAGCTGGTGTTGAGCACTTTGTCTTCAGCTCCGGTCCGCCGTGCGTTGAGATG
ACTGATGGCAAGGTGAACATGAAGGCCATGGAGTGTAAGTTGACCCCCGTTGAAGCCGCCAAGACACTGACAGCC
CCGGCAGCGAAATACAAGATCGAGACGTACGCCCGACAGCTGGGCCGCTTCAAGACGTTGACGGCCATCAACGCC
GCCTGGTATCTGGAAAACTTCCTCGACGACCAGGCGGCTCCCATCTTTGGCGGCTTCCCCTTCTTCCCCGACGAT
GATGGCTACCTGACGATGCGCGCGCCTCACTGGGGTGGCTCCAATGAGGTTCCCTTCGTCAGCATGGGCGACGAC
TACGGCGACATTGTGCAGGGCATCTTTCTCGAGCCTGAACGGTATGATGGCCGCGTCATTCACGGGGCCAGCTTC
ATGGTGCCGTTTGAGAAGCTCGTCGCCGCCTTTGAAGAGGGTATGTGTACTGCTGTTTCGATATACTTCATGCGC
ATCTGCTGATCCTCTTACAGCAACCGGCAAAAAAGCCCGTTACGAGCCTCTGCTGCCCGACTGGGAAGCCTTTGA
CACAAAGGGCATTCCCGAGCTGGACGACGTCAAGCTCATGTTTGCCTTTACGCAGACGACGGGCGGTCTGTACTT
TGACAAGGTCCCGAGCGAGACGGCGACGGCGACGGAGTTGAAGCGGATCTCTGGCAAGGCAACGTCTCGGTCTGA
GGAGTTGGTGAGGCCCAAGGAGTGGTTTGCGAAGCACTTTGCGACATCGAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail