Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3979
Gene name
LocationContig_360:5776..7392
Strand-
Gene length (bp)1616
Transcript length (bp)1464
Coding sequence length (bp)1464
Protein length (aa) 488

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01554 MatE MatE 3.1E-32 56 216
PF01554 MatE MatE 7.3E-23 276 435

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05497|YD338_YEAST Uncharacterized transporter YDR338C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR338C PE=1 SV=1 20 475 3.0E-104
sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.13 PE=3 SV=1 5 483 4.0E-98
sp|Q9UT92|YL47_SCHPO Uncharacterized transporter C323.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC323.07c PE=1 SV=1 1 483 2.0E-89
sp|P38767|ERC1_YEAST Ethionine resistance-conferring protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERC1 PE=1 SV=1 3 416 2.0E-84
sp|Q10085|YAO6_SCHPO Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.06 PE=3 SV=1 44 483 7.0E-73
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05497|YD338_YEAST Uncharacterized transporter YDR338C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDR338C PE=1 SV=1 20 475 3.0E-104
sp|Q9USK3|YJ2D_SCHPO Uncharacterized transporter C4B3.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC4B3.13 PE=3 SV=1 5 483 4.0E-98
sp|Q9UT92|YL47_SCHPO Uncharacterized transporter C323.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC323.07c PE=1 SV=1 1 483 2.0E-89
sp|P38767|ERC1_YEAST Ethionine resistance-conferring protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERC1 PE=1 SV=1 3 416 2.0E-84
sp|Q10085|YAO6_SCHPO Uncharacterized transporter C11D3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.06 PE=3 SV=1 44 483 7.0E-73
sp|Q3V050|S47A2_MOUSE Multidrug and toxin extrusion protein 2 OS=Mus musculus GN=Slc47a2 PE=1 SV=1 45 483 1.0E-67
sp|Q8K0H1|S47A1_MOUSE Multidrug and toxin extrusion protein 1 OS=Mus musculus GN=Slc47a1 PE=1 SV=2 18 480 1.0E-65
sp|Q5RFD2|S47A1_PONAB Multidrug and toxin extrusion protein 1 OS=Pongo abelii GN=SLC47A1 PE=2 SV=1 45 480 3.0E-62
sp|Q5I0E9|S47A1_RAT Multidrug and toxin extrusion protein 1 OS=Rattus norvegicus GN=Slc47a1 PE=1 SV=1 19 480 7.0E-61
sp|A4IIS8|S47A1_XENTR Multidrug and toxin extrusion protein 1 OS=Xenopus tropicalis GN=slc47a1 PE=2 SV=1 69 483 7.0E-60
sp|Q96FL8|S47A1_HUMAN Multidrug and toxin extrusion protein 1 OS=Homo sapiens GN=SLC47A1 PE=1 SV=1 45 480 2.0E-58
sp|Q9FHB6|DTX16_ARATH Protein DETOXIFICATION 16 OS=Arabidopsis thaliana GN=DTX16 PE=2 SV=1 41 483 5.0E-58
sp|A7KAU2|S47A1_RABIT Multidrug and toxin extrusion protein 1 OS=Oryctolagus cuniculus GN=SLC47A1 PE=2 SV=1 45 480 1.0E-56
sp|A1L1P9|S47A1_DANRE Multidrug and toxin extrusion protein 1 OS=Danio rerio GN=slc47a1 PE=2 SV=1 50 483 2.0E-55
sp|Q9C9U1|DTX17_ARATH Protein DETOXIFICATION 17 OS=Arabidopsis thaliana GN=DTX17 PE=2 SV=1 45 483 6.0E-53
sp|F4IHU9|DTX15_ARATH Protein DETOXIFICATION 15 OS=Arabidopsis thaliana GN=DTX15 PE=3 SV=1 46 486 2.0E-52
sp|Q9C9M8|DTX9_ARATH Protein DETOXIFICATION 9 OS=Arabidopsis thaliana GN=DTX9 PE=2 SV=1 29 483 1.0E-50
sp|Q9C994|DTX14_ARATH Protein DETOXIFICATION 14 OS=Arabidopsis thaliana GN=DTX14 PE=3 SV=1 32 483 1.0E-49
sp|Q5R7E4|S47A2_PONAB Multidrug and toxin extrusion protein 2 OS=Pongo abelii GN=SLC47A2 PE=2 SV=1 33 484 2.0E-49
sp|Q86VL8|S47A2_HUMAN Multidrug and toxin extrusion protein 2 OS=Homo sapiens GN=SLC47A2 PE=1 SV=1 31 484 1.0E-48
sp|A7KAU3|S47A2_RABIT Multidrug and toxin extrusion protein 2 OS=Oryctolagus cuniculus GN=SLC47A2 PE=1 SV=1 46 483 6.0E-48
sp|Q9SZE2|DTX51_ARATH Protein DETOXIFICATION 51 OS=Arabidopsis thaliana GN=DTX51 PE=2 SV=1 33 480 2.0E-47
sp|Q9ZVH5|DTX53_ARATH Protein DETOXIFICATION 53 OS=Arabidopsis thaliana GN=DTX53 PE=2 SV=1 45 486 3.0E-47
sp|Q9SLV0|DTX48_ARATH Protein DETOXIFICATION 48 OS=Arabidopsis thaliana GN=DTX48 PE=2 SV=1 44 482 1.0E-44
sp|Q38956|DTX29_ARATH Protein DETOXIFICATION 29 OS=Arabidopsis thaliana GN=DTX29 PE=1 SV=1 46 487 4.0E-43
sp|F4I4Q3|DTX32_ARATH Protein DETOXIFICATION 32 OS=Arabidopsis thaliana GN=DTX32 PE=3 SV=1 4 487 8.0E-43
sp|Q4PSF4|DTX52_ARATH Protein DETOXIFICATION 52 OS=Arabidopsis thaliana GN=DTX52 PE=2 SV=1 12 482 4.0E-42
sp|Q9LS19|DTX30_ARATH Protein DETOXIFICATION 30 OS=Arabidopsis thaliana GN=DTX30 PE=2 SV=1 46 487 4.0E-41
sp|Q9SX83|DTX33_ARATH Protein DETOXIFICATION 33 OS=Arabidopsis thaliana GN=DTX33 PE=2 SV=1 45 487 5.0E-41
sp|Q9LE20|DTX54_ARATH Protein DETOXIFICATION 54 OS=Arabidopsis thaliana GN=DTX54 PE=2 SV=1 28 482 6.0E-41
sp|Q9LUH2|DTX19_ARATH Protein DETOXIFICATION 19 OS=Arabidopsis thaliana GN=DTX19 PE=2 SV=1 44 457 1.0E-40
sp|Q8GXM8|DTX2_ARATH Protein DETOXIFICATION 2 OS=Arabidopsis thaliana GN=DTX2 PE=2 SV=1 56 483 2.0E-40
sp|Q9SAB0|DTX36_ARATH Protein DETOXIFICATION 36 OS=Arabidopsis thaliana GN=DTX36 PE=2 SV=1 44 483 1.0E-39
sp|O80695|DTX37_ARATH Protein DETOXIFICATION 37 OS=Arabidopsis thaliana GN=DTX37 PE=2 SV=1 9 483 3.0E-39
sp|Q9FH21|DTX55_ARATH Protein DETOXIFICATION 55 OS=Arabidopsis thaliana GN=DTX55 PE=2 SV=1 33 480 5.0E-39
sp|F4JH46|DTX34_ARATH Protein DETOXIFICATION 34 OS=Arabidopsis thaliana GN=DTX34 PE=2 SV=1 22 487 6.0E-39
sp|Q8VYL8|DTX10_ARATH Protein DETOXIFICATION 10 OS=Arabidopsis thaliana GN=DTX10 PE=2 SV=1 46 483 1.0E-38
sp|Q9LVD9|DTX40_ARATH Protein DETOXIFICATION 40 OS=Arabidopsis thaliana GN=DTX40 PE=1 SV=1 5 483 2.0E-38
sp|F4HZH9|DTX11_ARATH Protein DETOXIFICATION 11 OS=Arabidopsis thaliana GN=DTX11 PE=3 SV=1 46 483 4.0E-38
sp|Q9LPV4|DTX31_ARATH Protein DETOXIFICATION 31 OS=Arabidopsis thaliana GN=DTX31 PE=2 SV=1 20 487 6.0E-38
sp|Q9LUH3|DTX18_ARATH Protein DETOXIFICATION 18 OS=Arabidopsis thaliana GN=DTX18 PE=2 SV=1 30 457 9.0E-38
sp|Q9SIA3|DTX4_ARATH Protein DETOXIFICATION 4 OS=Arabidopsis thaliana GN=DTX4 PE=3 SV=2 54 483 1.0E-37
sp|Q940N9|DTX39_ARATH Protein DETOXIFICATION 39 OS=Arabidopsis thaliana GN=DTX39 PE=2 SV=1 46 483 1.0E-37
sp|Q9FJ87|DTX50_ARATH Protein DETOXIFICATION 50 OS=Arabidopsis thaliana GN=DTX50 PE=2 SV=1 41 480 2.0E-37
sp|F4HQ05|DTX8_ARATH Protein DETOXIFICATION 8 OS=Arabidopsis thaliana GN=DTX8 PE=3 SV=1 64 483 2.0E-37
sp|Q9SIA4|DTX3_ARATH Protein DETOXIFICATION 3 OS=Arabidopsis thaliana GN=DTX3 PE=3 SV=1 46 483 2.0E-37
sp|Q8L731|DTX12_ARATH Protein DETOXIFICATION 12 OS=Arabidopsis thaliana GN=DTX12 PE=2 SV=1 46 483 2.0E-37
sp|Q8RXK1|DTX23_ARATH Protein DETOXIFICATION 23 OS=Arabidopsis thaliana GN=DTX23 PE=2 SV=1 29 483 7.0E-37
sp|Q1PFG9|DTX7_ARATH Protein DETOXIFICATION 7 OS=Arabidopsis thaliana GN=DTX7 PE=2 SV=1 52 483 2.0E-36
sp|Q8W488|DTX21_ARATH Protein DETOXIFICATION 21 OS=Arabidopsis thaliana GN=DTX21 PE=1 SV=1 46 483 2.0E-36
sp|Q9SIA5|DTX1_ARATH Protein DETOXIFICATION 1 OS=Arabidopsis thaliana GN=DTX1 PE=2 SV=1 56 483 4.0E-36
sp|Q94AL1|DTX13_ARATH Protein DETOXIFICATION 13 OS=Arabidopsis thaliana GN=DTX13 PE=2 SV=1 46 483 5.0E-36
sp|Q9LYT3|DTX41_ARATH Protein DETOXIFICATION 41 OS=Arabidopsis thaliana GN=DTX41 PE=2 SV=1 46 485 9.0E-36
sp|F4JKB9|DTX38_ARATH Protein DETOXIFICATION 38 OS=Arabidopsis thaliana GN=DTX38 PE=2 SV=1 76 483 1.0E-35
sp|Q8RWF5|DTX6_ARATH Protein DETOXIFICATION 6 OS=Arabidopsis thaliana GN=DTX6 PE=2 SV=1 46 483 2.0E-35
sp|F4HPH1|DTX22_ARATH Protein DETOXIFICATION 22 OS=Arabidopsis thaliana GN=DTX22 PE=2 SV=1 29 483 3.0E-35
sp|Q9FKQ1|DTX27_ARATH Protein DETOXIFICATION 27 OS=Arabidopsis thaliana GN=DTX27 PE=2 SV=1 33 485 1.0E-34
sp|F4HPH2|DTX20_ARATH Protein DETOXIFICATION 20 OS=Arabidopsis thaliana GN=DTX20 PE=3 SV=1 46 483 1.0E-34
sp|O82752|DTX49_ARATH Protein DETOXIFICATION 49 OS=Arabidopsis thaliana GN=DTX49 PE=2 SV=1 22 482 2.0E-34
sp|F4JTB3|DTX35_ARATH Protein DETOXIFICATION 35 OS=Arabidopsis thaliana GN=DTX35 PE=2 SV=1 46 487 4.0E-33
sp|Q9FNC1|DTX28_ARATH Protein DETOXIFICATION 28 OS=Arabidopsis thaliana GN=DTX28 PE=3 SV=1 10 485 5.0E-33
sp|Q9SIA1|DTX5_ARATH Protein DETOXIFICATION 5 OS=Arabidopsis thaliana GN=DTX5 PE=3 SV=2 46 483 1.0E-32
sp|Q1PDX9|DTX26_ARATH Protein DETOXIFICATION 26 OS=Arabidopsis thaliana GN=DTX26 PE=2 SV=1 56 487 7.0E-29
sp|Q8L616|DTX25_ARATH Protein DETOXIFICATION 25 OS=Arabidopsis thaliana GN=DTX25 PE=2 SV=1 46 487 7.0E-29
sp|Q9KRU4|NORM_VIBCH Multidrug resistance protein NorM OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=norM PE=3 SV=2 46 458 1.0E-26
sp|Q6LQ49|NORM_PHOPR Multidrug resistance protein NorM OS=Photobacterium profundum GN=norM PE=3 SV=1 45 479 2.0E-26
sp|F4J158|DTX24_ARATH Protein DETOXIFICATION 24 OS=Arabidopsis thaliana GN=DTX24 PE=2 SV=1 75 487 9.0E-26
sp|O49660|DTX56_ARATH Protein DETOXIFICATION 56 OS=Arabidopsis thaliana GN=DTX56 PE=1 SV=1 44 480 9.0E-26
sp|Q7MKP8|NORM_VIBVY Multidrug resistance protein NorM OS=Vibrio vulnificus (strain YJ016) GN=norM PE=3 SV=2 45 458 1.0E-25
sp|Q8D9N8|NORM_VIBVU Multidrug resistance protein NorM OS=Vibrio vulnificus (strain CMCP6) GN=norM PE=3 SV=2 46 458 4.0E-25
sp|Q5KZL2|NORM_GEOKA Probable multidrug resistance protein NorM OS=Geobacillus kaustophilus (strain HTA426) GN=norM PE=3 SV=1 36 481 6.0E-24
sp|Q9I3Y3|PMPM_PSEAE Multidrug resistance protein PmpM OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pmpM PE=3 SV=1 46 458 1.0E-23
sp|Q5E4Y6|NORM_VIBF1 Multidrug resistance protein NorM OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=norM PE=3 SV=1 50 458 5.0E-23
sp|Q9KEJ2|NORM_BACHD Probable multidrug resistance protein NorM OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=norM PE=3 SV=1 39 458 6.0E-23
sp|O82855|NORM_VIBPA Multidrug resistance protein NorM OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=norM PE=1 SV=2 45 458 2.0E-22
sp|A7FHJ7|MDTK_YERP3 Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mdtK PE=3 SV=1 46 486 2.0E-21
sp|B1JJ53|MDTK_YERPY Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mdtK PE=3 SV=1 46 473 2.0E-21
sp|Q66A27|MDTK_YERPS Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mdtK PE=3 SV=1 46 473 2.0E-21
sp|A4TIP9|MDTK_YERPP Multidrug resistance protein MdtK OS=Yersinia pestis (strain Pestoides F) GN=mdtK PE=3 SV=1 46 473 2.0E-21
sp|Q1CIK5|MDTK_YERPN Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=mdtK PE=3 SV=1 46 473 2.0E-21
sp|A9QZC0|MDTK_YERPG Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Angola) GN=mdtK PE=3 SV=1 46 473 2.0E-21
sp|Q8ZDZ8|MDTK_YERPE Multidrug resistance protein MdtK OS=Yersinia pestis GN=mdtK PE=3 SV=1 46 473 2.0E-21
sp|B2K5I9|MDTK_YERPB Multidrug resistance protein MdtK OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mdtK PE=3 SV=1 46 473 2.0E-21
sp|Q1C769|MDTK_YERPA Multidrug resistance protein MdtK OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=mdtK PE=3 SV=1 46 473 2.0E-21
sp|Q7WAK9|NORM_BORPA Probable multidrug resistance protein NorM OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=norM PE=3 SV=1 45 472 4.0E-21
sp|Q7WJR0|NORM_BORBR Probable multidrug resistance protein NorM OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=norM PE=3 SV=1 45 472 4.0E-21
sp|A1JPA1|MDTK_YERE8 Multidrug resistance protein MdtK OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=mdtK PE=3 SV=1 46 486 8.0E-21
sp|Q81T85|NORM_BACAN Probable multidrug resistance protein NorM OS=Bacillus anthracis GN=norM PE=3 SV=1 55 458 1.0E-20
sp|Q6HLG9|NORM_BACHK Probable multidrug resistance protein NorM OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=norM PE=3 SV=1 55 458 2.0E-20
sp|Q73BB8|NORM_BACC1 Probable multidrug resistance protein NorM OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=norM PE=3 SV=1 55 458 4.0E-20
sp|B7LQA4|MDTK_ESCF3 Multidrug resistance protein MdtK OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=mdtK PE=3 SV=1 44 482 8.0E-20
sp|A7MFC3|MDTK_CROS8 Multidrug resistance protein MdtK OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mdtK PE=3 SV=1 46 482 8.0E-20
sp|Q8Y654|NORM_LISMO Probable multidrug resistance protein NorM OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=norM PE=3 SV=1 48 463 9.0E-20
sp|A9MEJ6|MDTK_SALAR Multidrug resistance protein MdtK OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mdtK PE=3 SV=1 46 482 1.0E-19
sp|Q8CUL5|NORM_OCEIH Probable multidrug resistance protein NorM OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=norM PE=3 SV=2 64 458 1.0E-19
sp|Q8UDF5|NORM_AGRFC Probable multidrug resistance protein NorM OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=norM PE=3 SV=1 35 463 1.0E-19
sp|Q71YH0|NORM_LISMF Probable multidrug resistance protein NorM OS=Listeria monocytogenes serotype 4b (strain F2365) GN=norM PE=3 SV=1 48 463 3.0E-19
sp|Q92AG2|NORM_LISIN Probable multidrug resistance protein NorM OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=norM PE=3 SV=1 48 463 3.0E-19
sp|A4W9T2|MDTK_ENT38 Multidrug resistance protein MdtK OS=Enterobacter sp. (strain 638) GN=mdtK PE=3 SV=1 46 482 3.0E-19
sp|Q7N3V2|MDTK_PHOLL Multidrug resistance protein MdtK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mdtK PE=3 SV=1 44 479 4.0E-19
sp|Q63DZ4|NORM_BACCZ Probable multidrug resistance protein NorM OS=Bacillus cereus (strain ZK / E33L) GN=norM PE=3 SV=1 55 458 4.0E-19
sp|Q6NB79|NORM_RHOPA Probable multidrug resistance protein NorM OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=norM PE=3 SV=1 56 459 9.0E-19
sp|Q81G28|NORM_BACCR Probable multidrug resistance protein NorM OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=norM PE=3 SV=1 55 458 1.0E-18
sp|B4TUY3|MDTK_SALSV Multidrug resistance protein MdtK OS=Salmonella schwarzengrund (strain CVM19633) GN=mdtK PE=3 SV=1 46 482 1.0E-18
sp|A9N0Y8|MDTK_SALPB Multidrug resistance protein MdtK OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mdtK PE=3 SV=1 46 482 1.0E-18
sp|B5F6M2|MDTK_SALA4 Multidrug resistance protein MdtK OS=Salmonella agona (strain SL483) GN=mdtK PE=3 SV=1 46 482 1.0E-18
sp|P45272|HMRM_HAEIN Multidrug resistance protein HmrM OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hmrM PE=3 SV=1 46 458 2.0E-18
sp|B4TH65|MDTK_SALHS Multidrug resistance protein MdtK OS=Salmonella heidelberg (strain SL476) GN=mdtK PE=3 SV=1 46 482 2.0E-18
sp|B5Z497|MDTK_ECO5E Multidrug resistance protein MdtK OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtK PE=3 SV=1 44 470 2.0E-18
sp|P58164|MDTK_ECO57 Multidrug resistance protein MdtK OS=Escherichia coli O157:H7 GN=mdtK PE=3 SV=1 44 470 2.0E-18
sp|B4T562|MDTK_SALNS Multidrug resistance protein MdtK OS=Salmonella newport (strain SL254) GN=mdtK PE=3 SV=1 46 482 4.0E-18
sp|B1IQ91|MDTK_ECOLC Multidrug resistance protein MdtK OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=mdtK PE=3 SV=1 44 470 6.0E-18
sp|A8A0L0|MDTK_ECOHS Multidrug resistance protein MdtK OS=Escherichia coli O9:H4 (strain HS) GN=mdtK PE=3 SV=1 44 470 6.0E-18
sp|Q8Z6N7|MDTK_SALTI Multidrug resistance protein MdtK OS=Salmonella typhi GN=mdtK PE=3 SV=1 46 482 6.0E-18
sp|C0Q5V7|MDTK_SALPC Multidrug resistance protein MdtK OS=Salmonella paratyphi C (strain RKS4594) GN=mdtK PE=3 SV=1 46 482 6.0E-18
sp|B5FIH8|MDTK_SALDC Multidrug resistance protein MdtK OS=Salmonella dublin (strain CT_02021853) GN=mdtK PE=3 SV=1 46 482 6.0E-18
sp|B5RAN4|MDTK_SALG2 Multidrug resistance protein MdtK OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mdtK PE=3 SV=1 46 482 7.0E-18
sp|B5QV34|MDTK_SALEP Multidrug resistance protein MdtK OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtK PE=3 SV=1 46 482 7.0E-18
sp|Q0T4A9|MDTK_SHIF8 Multidrug resistance protein MdtK OS=Shigella flexneri serotype 5b (strain 8401) GN=mdtK PE=3 SV=1 44 458 7.0E-18
sp|B5BKE4|MDTK_SALPK Multidrug resistance protein MdtK OS=Salmonella paratyphi A (strain AKU_12601) GN=mdtK PE=3 SV=1 46 482 7.0E-18
sp|Q5PH16|MDTK_SALPA Multidrug resistance protein MdtK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=mdtK PE=3 SV=1 46 482 7.0E-18
sp|Q57PL1|MDTK_SALCH Multidrug resistance protein MdtK OS=Salmonella choleraesuis (strain SC-B67) GN=mdtK PE=3 SV=1 46 482 7.0E-18
sp|Q65SY9|NORM_MANSM Probable multidrug resistance protein NorM OS=Mannheimia succiniciproducens (strain MBEL55E) GN=norM PE=3 SV=1 64 465 8.0E-18
sp|Q3Z218|MDTK_SHISS Multidrug resistance protein MdtK OS=Shigella sonnei (strain Ss046) GN=mdtK PE=3 SV=1 44 470 9.0E-18
sp|Q321C2|MDTK_SHIBS Multidrug resistance protein MdtK OS=Shigella boydii serotype 4 (strain Sb227) GN=mdtK PE=3 SV=1 44 470 9.0E-18
sp|Q7WTR3|MDTK_ERWAM Multidrug resistance protein MdtK OS=Erwinia amylovora GN=mdtK PE=3 SV=1 44 482 9.0E-18
sp|B1LEM1|MDTK_ECOSM Multidrug resistance protein MdtK OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=mdtK PE=3 SV=1 44 482 9.0E-18
sp|B7NBB6|MDTK_ECOLU Multidrug resistance protein MdtK OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=mdtK PE=3 SV=1 44 482 9.0E-18
sp|Q8ZPP2|MDTK_SALTY Multidrug resistance protein MdtK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtK PE=3 SV=1 46 482 9.0E-18
sp|P37340|MDTK_ECOLI Multidrug resistance protein MdtK OS=Escherichia coli (strain K12) GN=mdtK PE=1 SV=2 44 470 9.0E-18
sp|Q0THG4|MDTK_ECOL5 Multidrug resistance protein MdtK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=mdtK PE=3 SV=1 44 470 9.0E-18
sp|B1XFX3|MDTK_ECODH Multidrug resistance protein MdtK OS=Escherichia coli (strain K12 / DH10B) GN=mdtK PE=3 SV=1 44 470 9.0E-18
sp|C4ZYC7|MDTK_ECOBW Multidrug resistance protein MdtK OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=mdtK PE=3 SV=1 44 470 9.0E-18
sp|B7MV43|MDTK_ECO81 Multidrug resistance protein MdtK OS=Escherichia coli O81 (strain ED1a) GN=mdtK PE=3 SV=1 44 470 9.0E-18
sp|B7US04|MDTK_ECO27 Multidrug resistance protein MdtK OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=mdtK PE=3 SV=1 44 470 9.0E-18
sp|Q1RBD2|MDTK_ECOUT Multidrug resistance protein MdtK OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtK PE=3 SV=1 44 482 1.0E-17
sp|Q8FH68|MDTK_ECOL6 Multidrug resistance protein MdtK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=mdtK PE=3 SV=1 44 482 1.0E-17
sp|A1ABK4|MDTK_ECOK1 Multidrug resistance protein MdtK OS=Escherichia coli O1:K1 / APEC GN=mdtK PE=3 SV=1 44 482 1.0E-17
sp|B7MA17|MDTK_ECO45 Multidrug resistance protein MdtK OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtK PE=3 SV=1 44 482 1.0E-17
sp|B2U2G8|MDTK_SHIB3 Multidrug resistance protein MdtK OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=mdtK PE=3 SV=1 44 470 1.0E-17
sp|B7M0M0|MDTK_ECO8A Multidrug resistance protein MdtK OS=Escherichia coli O8 (strain IAI1) GN=mdtK PE=3 SV=1 44 470 1.0E-17
sp|B7NTX0|MDTK_ECO7I Multidrug resistance protein MdtK OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=mdtK PE=3 SV=1 44 470 1.0E-17
sp|B7L5L6|MDTK_ECO55 Multidrug resistance protein MdtK OS=Escherichia coli (strain 55989 / EAEC) GN=mdtK PE=3 SV=1 44 470 1.0E-17
sp|A7ZMC9|MDTK_ECO24 Multidrug resistance protein MdtK OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=mdtK PE=3 SV=1 44 470 1.0E-17
sp|Q89W72|NORM_BRADU Probable multidrug resistance protein NorM OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=norM PE=3 SV=1 29 456 1.0E-17
sp|B6IBA3|MDTK_ECOSE Multidrug resistance protein MdtK OS=Escherichia coli (strain SE11) GN=mdtK PE=3 SV=1 44 470 1.0E-17
sp|A8AH48|MDTK_CITK8 Multidrug resistance protein MdtK OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mdtK PE=3 SV=1 44 482 1.0E-17
sp|Q7VMB5|NORM_HAEDU Probable multidrug resistance protein NorM OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=norM PE=3 SV=1 45 461 2.0E-17
sp|Q7UAH8|MDTK_SHIFL Multidrug resistance protein MdtK OS=Shigella flexneri GN=mdtK PE=3 SV=1 44 458 2.0E-17
sp|Q6D5W6|MDTK_PECAS Multidrug resistance protein MdtK OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=mdtK PE=3 SV=1 44 463 2.0E-17
sp|B4EWN4|MDTK_PROMH Multidrug resistance protein MdtK OS=Proteus mirabilis (strain HI4320) GN=mdtK PE=3 SV=1 44 458 2.0E-17
sp|A6TA11|MDTK_KLEP7 Multidrug resistance protein MdtK OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mdtK PE=3 SV=1 46 482 7.0E-17
sp|Q32FA7|MDTK_SHIDS Multidrug resistance protein MdtK OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=mdtK PE=3 SV=1 44 470 1.0E-16
sp|Q9JV27|NORM_NEIMA Probable multidrug resistance protein NorM OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=norM PE=3 SV=1 41 462 2.0E-16
sp|C5BDY7|MDTK_EDWI9 Multidrug resistance protein MdtK OS=Edwardsiella ictaluri (strain 93-146) GN=mdtK PE=3 SV=1 45 482 2.0E-16
sp|Q9CMZ9|NORM_PASMU Probable multidrug resistance protein NorM OS=Pasteurella multocida (strain Pm70) GN=norM PE=3 SV=1 64 459 2.0E-16
sp|B5XWL3|MDTK_KLEP3 Multidrug resistance protein MdtK OS=Klebsiella pneumoniae (strain 342) GN=mdtK PE=3 SV=1 46 482 3.0E-16
sp|Q63S57|NORM_BURPS Probable multidrug resistance protein NorM OS=Burkholderia pseudomallei (strain K96243) GN=norM PE=3 SV=1 36 463 4.0E-16
sp|Q7N1G0|NORM_PHOLL Probable multidrug resistance protein NorM OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=norM PE=3 SV=1 45 457 5.0E-16
sp|Q92PZ0|NORM_RHIME Probable multidrug resistance protein NorM OS=Rhizobium meliloti (strain 1021) GN=norM PE=3 SV=1 48 440 6.0E-16
sp|Q98D15|NORM_RHILO Probable multidrug resistance protein NorM OS=Rhizobium loti (strain MAFF303099) GN=norM PE=3 SV=1 30 472 1.0E-15
sp|Q9F5N7|NORM_BURVI Multidrug resistance protein NorM OS=Burkholderia vietnamiensis GN=norM PE=3 SV=1 56 463 1.0E-15
sp|Q9K015|NORM_NEIMB Probable multidrug resistance protein NorM OS=Neisseria meningitidis serogroup B (strain MC58) GN=norM PE=3 SV=1 44 462 2.0E-15
sp|Q62LW6|NORM_BURMA Probable multidrug resistance protein NorM OS=Burkholderia mallei (strain ATCC 23344) GN=norM PE=3 SV=1 36 463 4.0E-15
sp|Q6FEY7|NORM_ACIAD Probable multidrug resistance protein NorM OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=norM PE=3 SV=1 46 480 4.0E-15
sp|Q7NXN3|NORM_CHRVO Probable multidrug resistance protein NorM OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=norM PE=3 SV=1 44 475 2.0E-14
sp|Q8G2I1|NORM_BRUSU Probable multidrug resistance protein NorM OS=Brucella suis biovar 1 (strain 1330) GN=norM PE=3 SV=1 46 463 2.0E-14
sp|Q8YFD7|NORM_BRUME Probable multidrug resistance protein NorM OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=norM PE=3 SV=1 46 463 2.0E-14
sp|Q5NYX9|NORM_AROAE Probable multidrug resistance protein NorM OS=Aromatoleum aromaticum (strain EbN1) GN=norM PE=3 SV=1 50 470 3.0E-14
sp|Q88CB9|NORM_PSEPK Probable multidrug resistance protein NorM OS=Pseudomonas putida (strain KT2440) GN=norM PE=3 SV=1 150 462 6.0E-14
sp|Q89AX2|NORM_BUCBP Probable multidrug resistance protein NorM OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=norM PE=3 SV=1 43 457 5.0E-13
sp|Q8EES3|NORM_SHEON Probable multidrug resistance protein NorM OS=Shewanella oneidensis (strain MR-1) GN=norM PE=3 SV=1 46 458 9.0E-13
sp|Q55364|NORM_SYNY3 Probable multidrug resistance protein NorM OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=norM PE=3 SV=1 46 470 1.0E-12
sp|Q5QWR6|NORM_IDILO Probable multidrug resistance protein NorM OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=norM PE=3 SV=1 56 459 7.0E-12
sp|Q88BA2|NORM_PSESM Probable multidrug resistance protein NorM OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=norM PE=3 SV=1 38 476 8.0E-12
sp|Q9PA34|NORM_XYLFA Probable multidrug resistance protein NorM OS=Xylella fastidiosa (strain 9a5c) GN=norM PE=3 SV=1 270 463 7.0E-11
sp|Q879Z5|NORM_XYLFT Probable multidrug resistance protein NorM OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=norM PE=3 SV=1 270 458 8.0E-11
sp|O31855|NORM_BACSU Probable multidrug resistance protein NorM OS=Bacillus subtilis (strain 168) GN=norM PE=3 SV=1 45 458 1.0E-10
sp|Q65IG9|NORM_BACLD Probable multidrug resistance protein NorM OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=norM PE=3 SV=1 45 458 1.0E-10
sp|Q9RY44|NORM_DEIRA Probable multidrug resistance protein NorM OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=norM PE=3 SV=1 37 459 1.0E-10
sp|Q5MZD9|NORM_SYNP6 Probable multidrug resistance protein NorM OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=norM PE=3 SV=1 46 479 2.0E-09
sp|Q8DPQ6|NORM_STRR6 Probable multidrug resistance protein NorM OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=norM PE=3 SV=1 44 457 2.0E-09
sp|Q9HTR0|NORM_PSEAE Probable multidrug resistance protein NorM OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=norM PE=3 SV=1 41 484 3.0E-09
sp|Q97QN5|NORM_STRPN Probable multidrug resistance protein NorM OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=norM PE=3 SV=1 271 457 4.0E-08
sp|Q4L8N9|MEPA_STAHJ Multidrug export protein MepA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mepA PE=3 SV=2 48 415 1.0E-07
sp|Q8PG07|NORM_XANAC Probable multidrug resistance protein NorM OS=Xanthomonas axonopodis pv. citri (strain 306) GN=norM PE=3 SV=1 270 463 5.0E-07
sp|Q9WZS2|NORM_THEMA Probable multidrug resistance protein NorM OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=norM PE=3 SV=1 48 485 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015297 antiporter activity Yes
GO:0016020 membrane Yes
GO:0042910 xenobiotic transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0015291 secondary active transmembrane transporter activity No
GO:0022804 active transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 54 76 22
2 83 105 22
3 131 153 22
4 165 182 17
5 197 219 22
6 224 246 22
7 269 291 22
8 304 326 22
9 346 368 22
10 420 442 22
11 447 469 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3979
MPTHDIPPVDDEHRSLLSQDVSPSYGIADSANDHDSPPPGSTRLHEARVLLSYSLPLIVTSLLQYSINLSGIFTV
GRLGRAELGAVSLANTTFIISCLAPFQGLATSLDTLCAQAHGSGQKHLVGLQCQRMLSFLFLLAVPLAVFWCASE
HLLRRLVSDAETARLAGLYLKVAIASLPGLILFETGKRFVQAQGLFRATTYVLLVAAPANLLLSWLLVYRLRLGF
VGAPIALAATQNLLGLLLILYVRFVDGSTCWGGLDHRAFSNWSIMIRLALPSMIMVEAEWFAFHAVTLLAGRFGT
DYLAAQSVLMTLMTVSFQLPFPLSIGASTRVANLIGGRRTEAAKMAAQVTFITAAVIGVANVTIFILLRSRLPLL
FTKDEQVIAIVARTSPVVAVAQLFDSLGTGANGLLRGIGRQTVGGMAGLFAYYVVSLPVSLALAFGADWKLAGMW
TGLAIGLSIVTVIEYSYLLRADWNKAASEAARRNKAY*
Coding >Ophun1|3979
ATGCCAACACATGATATCCCCCCTGTCGACGACGAGCATCGCAGCCTCCTATCCCAAGACGTCTCGCCCTCGTAC
GGCATTGCAGACTCGGCCAATGACCACGATTCGCCCCCCCCGGGCTCTACTCGCCTCCACGAAGCTAGAGTCCTG
CTGTCATACTCGCTGCCTCTCATCGTCACCAGCCTGCTGCAGTACTCCATCAACTTATCCGGCATCTTCACCGTC
GGCCGCCTAGGAAGAGCAGAGTTGGGCGCCGTGTCGCTGGCAAACACCACCTTCATCATCTCCTGTCTCGCCCCC
TTCCAGGGCCTCGCCACCAGCCTCGACACTCTCTGCGCCCAGGCCCATGGCTCGGGCCAGAAACACCTCGTCGGA
CTGCAATGCCAGCGCATGCTCTCCTTTCTCTTCCTCCTGGCAGTGCCCCTGGCCGTCTTTTGGTGCGCGTCAGAA
CACCTGCTGCGACGGCTGGTGTCGGACGCTGAGACGGCCAGGTTGGCCGGCCTGTACCTCAAGGTCGCCATCGCC
AGCCTCCCCGGCCTCATCCTCTTTGAGACGGGCAAGCGTTTCGTACAGGCTCAGGGCCTGTTCCGGGCCACGACG
TACGTGCTGCTCGTCGCCGCGCCCGCCAACCTGCTGCTGAGCTGGTTGCTCGTCTACAGGCTGAGGCTGGGCTTC
GTCGGGGCCCCCATCGCCCTGGCGGCCACGCAGAACCTGCTGGGCTTGCTGCTGATTCTCTACGTCCGCTTCGTC
GATGGCTCGACCTGCTGGGGCGGACTCGACCATCGGGCCTTTTCAAATTGGTCCATCATGATCCGTCTGGCGCTG
CCGAGCATGATCATGGTCGAGGCTGAGTGGTTTGCCTTTCACGCTGTTACCCTCTTGGCTGGACGCTTCGGCACA
GACTATCTCGCCGCTCAGAGCGTGCTGATGACGCTCATGACTGTGTCCTTTCAGCTGCCCTTTCCCCTATCCATC
GGGGCCTCGACACGAGTGGCCAACCTCATCGGCGGCAGACGGACCGAGGCAGCCAAGATGGCGGCCCAAGTGACG
TTTATCACGGCCGCCGTCATCGGCGTGGCAAACGTCACCATCTTCATCCTCCTCCGATCGCGGCTCCCTCTGCTA
TTCACCAAAGATGAACAGGTCATCGCCATCGTGGCCCGCACCTCGCCCGTCGTAGCCGTGGCCCAGCTCTTCGAC
AGTCTCGGCACCGGCGCCAACGGGCTCCTCCGCGGCATCGGCAGACAGACGGTCGGCGGCATGGCTGGTCTTTTC
GCCTACTACGTCGTCTCGCTGCCCGTGTCGCTGGCGTTGGCCTTTGGGGCGGACTGGAAGCTGGCCGGCATGTGG
ACGGGGCTGGCGATTGGGCTGTCGATCGTGACGGTCATTGAGTATAGCTATCTGCTTAGGGCGGATTGGAACAAG
GCTGCTTCCGAGGCGGCGAGGCGGAATAAGGCGTATTGA
Transcript >Ophun1|3979
ATGCCAACACATGATATCCCCCCTGTCGACGACGAGCATCGCAGCCTCCTATCCCAAGACGTCTCGCCCTCGTAC
GGCATTGCAGACTCGGCCAATGACCACGATTCGCCCCCCCCGGGCTCTACTCGCCTCCACGAAGCTAGAGTCCTG
CTGTCATACTCGCTGCCTCTCATCGTCACCAGCCTGCTGCAGTACTCCATCAACTTATCCGGCATCTTCACCGTC
GGCCGCCTAGGAAGAGCAGAGTTGGGCGCCGTGTCGCTGGCAAACACCACCTTCATCATCTCCTGTCTCGCCCCC
TTCCAGGGCCTCGCCACCAGCCTCGACACTCTCTGCGCCCAGGCCCATGGCTCGGGCCAGAAACACCTCGTCGGA
CTGCAATGCCAGCGCATGCTCTCCTTTCTCTTCCTCCTGGCAGTGCCCCTGGCCGTCTTTTGGTGCGCGTCAGAA
CACCTGCTGCGACGGCTGGTGTCGGACGCTGAGACGGCCAGGTTGGCCGGCCTGTACCTCAAGGTCGCCATCGCC
AGCCTCCCCGGCCTCATCCTCTTTGAGACGGGCAAGCGTTTCGTACAGGCTCAGGGCCTGTTCCGGGCCACGACG
TACGTGCTGCTCGTCGCCGCGCCCGCCAACCTGCTGCTGAGCTGGTTGCTCGTCTACAGGCTGAGGCTGGGCTTC
GTCGGGGCCCCCATCGCCCTGGCGGCCACGCAGAACCTGCTGGGCTTGCTGCTGATTCTCTACGTCCGCTTCGTC
GATGGCTCGACCTGCTGGGGCGGACTCGACCATCGGGCCTTTTCAAATTGGTCCATCATGATCCGTCTGGCGCTG
CCGAGCATGATCATGGTCGAGGCTGAGTGGTTTGCCTTTCACGCTGTTACCCTCTTGGCTGGACGCTTCGGCACA
GACTATCTCGCCGCTCAGAGCGTGCTGATGACGCTCATGACTGTGTCCTTTCAGCTGCCCTTTCCCCTATCCATC
GGGGCCTCGACACGAGTGGCCAACCTCATCGGCGGCAGACGGACCGAGGCAGCCAAGATGGCGGCCCAAGTGACG
TTTATCACGGCCGCCGTCATCGGCGTGGCAAACGTCACCATCTTCATCCTCCTCCGATCGCGGCTCCCTCTGCTA
TTCACCAAAGATGAACAGGTCATCGCCATCGTGGCCCGCACCTCGCCCGTCGTAGCCGTGGCCCAGCTCTTCGAC
AGTCTCGGCACCGGCGCCAACGGGCTCCTCCGCGGCATCGGCAGACAGACGGTCGGCGGCATGGCTGGTCTTTTC
GCCTACTACGTCGTCTCGCTGCCCGTGTCGCTGGCGTTGGCCTTTGGGGCGGACTGGAAGCTGGCCGGCATGTGG
ACGGGGCTGGCGATTGGGCTGTCGATCGTGACGGTCATTGAGTATAGCTATCTGCTTAGGGCGGATTGGAACAAG
GCTGCTTCCGAGGCGGCGAGGCGGAATAAGGCGTATTGA
Gene >Ophun1|3979
ATGCCAACACATGATATCCCCCCTGTCGACGACGAGCATCGCAGCCTCCTATCCCAAGACGTCTCGCCCTCGTAC
GGCATTGCAGACTCGGCCAATGACCACGATTCGCCCCCCCCGGGCTCTACTCGCCTCCACGAAGCTAGAGTCCTG
CTGTCATACTCGCTGCCTCTCATCGTCACCAGCCTGCTGCAGTACTCCATCAACTTATCCGGCATCTTCACCGTC
GGCCGCCTAGGAAGAGCAGAGTTGGGCGCCGTGTCGCGTAAGAAGGCTTCTTCTACCCATCCGTCCCTCCATCAA
CTAACCGCCATACAGTGGCAAACACCACCTTCATCATCTCCTGTCTCGCCCCCTTCCAGGGCCTCGCCACCAGCC
TCGACACTCTCTGCGCCCAGGCCCATGGCTCGGGCCAGAAACACCTCGTCGGACTGCAATGCCAGCGCATGCTCT
CCTTTCTCTTCCTCCTGGCAGTGCCCCTGGCCGTCTTTTGGTGCGCGTCAGAACACCTGCTGCGACGGCTGGTGT
CGGACGCTGAGACGGCCAGGTTGGCCGGCCTGTACCTCAAGGTCGCCATCGCCAGCCTCCCCGGCCTCATCCTCT
TTGAGACGGGCAAGCGTTTCGTACAGGCTCAGGGCCTGTTCCGGGCCACGACGTACGTGCTGCTCGTCGCCGCGC
CCGCCAACCTGCTGCTGAGCTGGTTGCTCGTCTACAGGCTGAGGCTGGGCTTCGTCGGGGCCCCCATCGCCCTGG
CGGCCACGCAGAACCTGCTGGGCTTGCTGCTGATTCTCTACGTCCGCTTCGTCGATGGCTCGACCTGCTGGGGCG
GACTCGACCATCGGGCCTTTTCAAATTGGTCCATCATGATCCGTCTGGCGCTGCCGAGCATGATCATGGTCGAGG
CTGAGTGGTTTGCCTTTCACGCTGTTACCCTCTTGGCTGGACGCTTCGGCACAGACTATCTCGCCGCTCAGAGCG
TGCTGATGACGCTCATGACTGTGTCCTTTCAGCTGCCCTTTCCCCTATCCATCGGGGCCTCGACACGAGTGGCCA
ACCTCATCGGCGGCAGACGGACCGAGGCAGCCAAGATGGCGGCCCAAGTGGTATGTCTTCCGGTGACAAGGAAAA
AGAAACTTGACTAACGGCTTCAGACGTTTATCACGGCCGCCGTCATCGGCGTGGCAAACGTCACCATCTTCATCC
TCCTCCGATCGCGGCTCCCTCTGCTATTCACCAAAGATGAACAGGTCATCGCCATCGTGGCCCGCACCTCGCCCG
TCGTAGCCGTGGCCCAGCTCTTCGACAGTCTCGGCACCGGCGCCAACGGGCTCCTCCGCGGCATCGGCAGACAGA
CGGTCGGCGGCATGGCTGGTCTTTTCGCCTACTACGTCGTCTCGCTGCCCGTGTCGCTGGCGTTGGCCTTTGGGG
CGGACTGGAAGCTGGCCGGCATGTGGACGGGGCTGGCGATTGGGCTGTCGATGTGAGTTGCCTCTCGTCTGCTTA
TTTCTTTGATGCTGACGGGCGTGTTTAGCGTGACGGTCATTGAGTATAGCTATCTGCTTAGGGCGGATTGGAACA
AGGCTGCTTCCGAGGCGGCGAGGCGGAATAAGGCGTATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail