Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3977
Gene name
LocationContig_36:53679..56025
Strand+
Gene length (bp)2346
Transcript length (bp)2175
Coding sequence length (bp)2175
Protein length (aa) 725

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08590 DUF1771 Domain of unknown function (DUF1771) 8.0E-15 521 584
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 4.9E-03 285 304
PF14608 zf-CCCH_2 RNA-binding, Nab2-type zinc finger 7.5E-03 310 329
PF01713 Smr Smr domain 1.8E-06 596 651

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O64843|CID7_ARATH Polyadenylate-binding protein-interacting protein 7 OS=Arabidopsis thaliana GN=CID7 PE=1 SV=1 510 651 1.0E-18
sp|Q86UW6|N4BP2_HUMAN NEDD4-binding protein 2 OS=Homo sapiens GN=N4BP2 PE=1 SV=2 521 663 6.0E-08

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3100
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6085
Ophiocordyceps australis map64 (Brazil) OphauB2|7661
Ophiocordyceps camponoti-floridani Ophcf2|00405
Ophiocordyceps camponoti-rufipedis Ophun1|3977 (this protein)
Ophiocordyceps kimflemingae Ophio5|6347
Ophiocordyceps subramaniannii Hirsu2|54

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3977
MVSDENYELCLHILQDASLEDEDKTDRIEELLKKETNLSGPSLENAVLDAMWRYREASGASTSPPSLRQSILRRP
SPASWRGSPTPLNGSPRLGVSPLAPPGFVSTFNRTKSSTASPFSSPRASPRLALATPAIPHSPNLNAYEFASDST
PAAEIMGDYQTENVEWLVNDDAASVTSSVGTSSGLNAAAPEFSSMTSQQADMSPYDMLRSILGKTRTDLEIEAAL
DMHGYDLSATITSIMESQAREGGLMAVPPVDEPKSVLIGKSISADGRPSTPAGQQKSTVICKFYMSTGQCLRADC
RFSHDLSNHLCKYWVMGSCLAGETCIFSHDPSTLLNKVNLDENGNEAAKNQESPSLQDVDSFPCLQDDRSGQRSG
DGGAIAASLAAPMGPRHLFGTEAPRLRSRPVSRQQAKETMTSAPAPDDNEAFPSLGSASTRQGKKHHGKRGGHGH
SHKENLAPSSLADIVRRTPSPAPGPARPEAKKAGQNGSARNGGENSAAALAIPSPKHIPWLETGERANKAYLKAR
QEAIKHGGLRNKFLQSAAQAWNRNDARAAKALSLRGQSENDLMRKAHREAARELYEQRNKGGMNNGSEIYVDLHG
LHPEEAVEYLERTLMENCREARPVYAITGTGHHSKNGKDKMGRAIRSYLGEWRYAYREFSVPGDRNSMGGILGVD
ARSWDKSRGKVTGAQEGSKVDILSQGVEIGDGKVRLLVRDPPKGPSGRR*
Coding >Ophun1|3977
ATGGTTTCTGACGAGAATTACGAGCTGTGCCTGCACATCCTGCAGGACGCCTCGCTGGAAGACGAGGATAAGACG
GACAGGATCGAGGAGCTTCTCAAGAAAGAGACAAATCTGTCCGGCCCCTCGCTTGAAAATGCCGTTCTCGATGCC
ATGTGGAGGTATCGGGAGGCGAGTGGAGCGTCAACATCGCCTCCGTCTCTCCGGCAATCTATCCTGCGCCGTCCG
TCTCCGGCATCCTGGCGCGGATCTCCGACGCCCTTGAACGGCTCCCCGCGTCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGCTTCGTGTCCACCTTTAACCGCACCAAGTCGTCGACAGCCTCGCCCTTCTCGTCGCCTCGTGCCTCCCCG
CGTCTAGCCTTGGCGACGCCCGCTATACCGCATAGTCCGAACCTCAACGCGTACGAGTTCGCAAGCGACTCCACG
CCCGCCGCCGAGATCATGGGCGACTATCAGACGGAGAACGTTGAATGGCTCGTCAACGATGATGCTGCCAGCGTC
ACGTCGTCTGTCGGCACATCAAGCGGGCTCAACGCCGCCGCTCCCGAGTTCTCGTCCATGACCTCGCAGCAGGCC
GACATGTCGCCCTACGATATGCTCCGTTCCATTCTCGGCAAGACCCGGACCGACCTCGAGATAGAGGCCGCCCTC
GACATGCATGGCTACGACTTGAGCGCCACCATCACCTCCATAATGGAGAGTCAGGCCCGCGAAGGAGGGCTGATG
GCCGTGCCCCCTGTCGATGAGCCAAAGAGCGTACTTATAGGAAAATCGATCTCCGCCGACGGACGTCCTTCGACT
CCAGCAGGCCAGCAGAAGTCGACGGTCATCTGCAAGTTTTACATGTCTACAGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATTTGAGCAATCATCTCTGCAAATACTGGGTTATGGGGAGTTGCCTCGCCGGCGAAACCTGC
ATCTTCTCTCACGATCCGTCTACGCTTCTCAACAAAGTAAATCTCGATGAGAACGGAAACGAGGCTGCCAAGAAC
CAGGAAAGCCCTTCGTTGCAAGATGTTGACTCGTTTCCCTGCCTTCAAGACGACAGGTCGGGCCAAAGAAGCGGC
GATGGTGGCGCAATCGCGGCGAGCTTGGCGGCACCGATGGGACCACGTCATCTTTTTGGTACGGAAGCTCCGCGG
TTGCGATCGCGACCCGTCAGCAGACAGCAAGCCAAAGAGACGATGACGTCGGCTCCGGCTCCGGACGACAACGAG
GCGTTTCCGTCGCTAGGTTCGGCCTCGACGAGGCAAGGGAAGAAGCACCACGGAAAGCGCGGCGGTCACGGCCAT
TCTCACAAAGAGAACCTCGCGCCGAGCTCGCTGGCAGACATTGTCAGGAGGACGCCTTCGCCGGCTCCCGGGCCA
GCGAGGCCGGAGGCGAAGAAGGCCGGACAGAACGGCAGCGCGCGCAACGGTGGTGAGAACAGCGCGGCGGCACTG
GCAATCCCCAGCCCCAAGCACATTCCATGGCTGGAAACCGGTGAACGGGCCAACAAGGCGTATCTGAAGGCTCGG
CAAGAAGCCATTAAGCATGGCGGGCTTCGCAATAAGTTTCTGCAAAGTGCGGCGCAGGCGTGGAATCGCAACGAC
GCGAGAGCAGCCAAGGCACTCAGTCTTCGCGGGCAAAGCGAGAACGATTTGATGCGAAAGGCGCATCGAGAGGCG
GCGCGCGAACTATACGAGCAACGGAACAAGGGAGGCATGAACAACGGATCGGAGATTTACGTCGACCTCCACGGA
CTCCATCCGGAAGAAGCGGTCGAATACCTCGAAAGGACGCTGATGGAGAATTGCAGAGAGGCGAGGCCCGTGTAC
GCCATCACCGGCACGGGGCACCACAGCAAGAACGGCAAGGATAAGATGGGCAGAGCGATCCGCAGTTACCTCGGC
GAGTGGCGCTACGCGTATCGCGAGTTTTCGGTGCCGGGCGACCGCAACAGCATGGGCGGGATCCTGGGCGTTGAC
GCGCGCAGCTGGGACAAGTCGCGGGGTAAAGTGACGGGCGCTCAGGAAGGATCCAAGGTGGATATTCTCAGCCAG
GGCGTGGAGATTGGGGATGGCAAGGTCAGGCTGCTGGTTCGGGATCCGCCCAAGGGGCCGAGCGGGCGACGATGA
Transcript >Ophun1|3977
ATGGTTTCTGACGAGAATTACGAGCTGTGCCTGCACATCCTGCAGGACGCCTCGCTGGAAGACGAGGATAAGACG
GACAGGATCGAGGAGCTTCTCAAGAAAGAGACAAATCTGTCCGGCCCCTCGCTTGAAAATGCCGTTCTCGATGCC
ATGTGGAGGTATCGGGAGGCGAGTGGAGCGTCAACATCGCCTCCGTCTCTCCGGCAATCTATCCTGCGCCGTCCG
TCTCCGGCATCCTGGCGCGGATCTCCGACGCCCTTGAACGGCTCCCCGCGTCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGCTTCGTGTCCACCTTTAACCGCACCAAGTCGTCGACAGCCTCGCCCTTCTCGTCGCCTCGTGCCTCCCCG
CGTCTAGCCTTGGCGACGCCCGCTATACCGCATAGTCCGAACCTCAACGCGTACGAGTTCGCAAGCGACTCCACG
CCCGCCGCCGAGATCATGGGCGACTATCAGACGGAGAACGTTGAATGGCTCGTCAACGATGATGCTGCCAGCGTC
ACGTCGTCTGTCGGCACATCAAGCGGGCTCAACGCCGCCGCTCCCGAGTTCTCGTCCATGACCTCGCAGCAGGCC
GACATGTCGCCCTACGATATGCTCCGTTCCATTCTCGGCAAGACCCGGACCGACCTCGAGATAGAGGCCGCCCTC
GACATGCATGGCTACGACTTGAGCGCCACCATCACCTCCATAATGGAGAGTCAGGCCCGCGAAGGAGGGCTGATG
GCCGTGCCCCCTGTCGATGAGCCAAAGAGCGTACTTATAGGAAAATCGATCTCCGCCGACGGACGTCCTTCGACT
CCAGCAGGCCAGCAGAAGTCGACGGTCATCTGCAAGTTTTACATGTCTACAGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATTTGAGCAATCATCTCTGCAAATACTGGGTTATGGGGAGTTGCCTCGCCGGCGAAACCTGC
ATCTTCTCTCACGATCCGTCTACGCTTCTCAACAAAGTAAATCTCGATGAGAACGGAAACGAGGCTGCCAAGAAC
CAGGAAAGCCCTTCGTTGCAAGATGTTGACTCGTTTCCCTGCCTTCAAGACGACAGGTCGGGCCAAAGAAGCGGC
GATGGTGGCGCAATCGCGGCGAGCTTGGCGGCACCGATGGGACCACGTCATCTTTTTGGTACGGAAGCTCCGCGG
TTGCGATCGCGACCCGTCAGCAGACAGCAAGCCAAAGAGACGATGACGTCGGCTCCGGCTCCGGACGACAACGAG
GCGTTTCCGTCGCTAGGTTCGGCCTCGACGAGGCAAGGGAAGAAGCACCACGGAAAGCGCGGCGGTCACGGCCAT
TCTCACAAAGAGAACCTCGCGCCGAGCTCGCTGGCAGACATTGTCAGGAGGACGCCTTCGCCGGCTCCCGGGCCA
GCGAGGCCGGAGGCGAAGAAGGCCGGACAGAACGGCAGCGCGCGCAACGGTGGTGAGAACAGCGCGGCGGCACTG
GCAATCCCCAGCCCCAAGCACATTCCATGGCTGGAAACCGGTGAACGGGCCAACAAGGCGTATCTGAAGGCTCGG
CAAGAAGCCATTAAGCATGGCGGGCTTCGCAATAAGTTTCTGCAAAGTGCGGCGCAGGCGTGGAATCGCAACGAC
GCGAGAGCAGCCAAGGCACTCAGTCTTCGCGGGCAAAGCGAGAACGATTTGATGCGAAAGGCGCATCGAGAGGCG
GCGCGCGAACTATACGAGCAACGGAACAAGGGAGGCATGAACAACGGATCGGAGATTTACGTCGACCTCCACGGA
CTCCATCCGGAAGAAGCGGTCGAATACCTCGAAAGGACGCTGATGGAGAATTGCAGAGAGGCGAGGCCCGTGTAC
GCCATCACCGGCACGGGGCACCACAGCAAGAACGGCAAGGATAAGATGGGCAGAGCGATCCGCAGTTACCTCGGC
GAGTGGCGCTACGCGTATCGCGAGTTTTCGGTGCCGGGCGACCGCAACAGCATGGGCGGGATCCTGGGCGTTGAC
GCGCGCAGCTGGGACAAGTCGCGGGGTAAAGTGACGGGCGCTCAGGAAGGATCCAAGGTGGATATTCTCAGCCAG
GGCGTGGAGATTGGGGATGGCAAGGTCAGGCTGCTGGTTCGGGATCCGCCCAAGGGGCCGAGCGGGCGACGATGA
Gene >Ophun1|3977
ATGGTTTCTGACGAGAATTACGAGCTGTGCCTGCACATCCTGCAGGACGCCTCGCTGGAAGACGAGGATAAGACG
GACAGGATCGAGGAGCTTCTCAAGAAAGAGACAAATCTGTCCGGCCCCTCGCTTGAAAATGCCGTTCTCGATGCC
ATGTGGAGGTATCGGGAGGCGAGTGGAGCGTCAACATCGCCTCCGTCTCTCCGGCAATCTATCCTGCGCCGTCCG
TCTCCGGCATCCTGGCGCGGATCTCCGACGCCCTTGAACGGCTCCCCGCGTCTGGGCGTGAGCCCTCTGGCTCCT
CCCGGCTTCGTGTCCACCTTTAACCGCACCAAGTCGTCGACAGCCTCGCCCTTCTCGTCGCCTCGTGCCTCCCCG
CGTCTAGCCTTGGCGACGCCCGCTATACCGCATAGTCCGAACCTCAACGCGTACGAGTTCGCAAGCGACTCCACG
CCCGCCGCCGAGATCATGGGCGACTATCAGACGGAGAACGTTGAATGGCTCGTCAACGATGATGCTGCCAGCGTC
ACGTCGTCTGTCGGCACATCAAGCGGGCTCAACGCCGCCGCTCCCGAGTTCTCGTCCATGACCTCGCAGCAGGCC
GACATGTCGCCCTACGATATGCTCCGTTCCATTCTCGGCAAGACCCGGACCGACCTCGAGATAGAGGCCGCCCTC
GACATGCATGGCTACGACTTGAGCGCCACCATCACCTCCATAATGGAGAGTCAGGCCCGCGAAGGAGGGCTGATG
GCCGTGCCCCCTGTCGATGAGCCAAAGAGCGTACTTATAGGAAAATCGATCTCCGCCGACGGACGTCCTTCGACT
CCAGCAGGCCAGCAGAAGTCGACGGTCATCTGCAAGTTTTACATGTCTACAGGCCAGTGTCTCCGCGCCGACTGC
CGCTTCAGTCACGATTTGAGCAATCATCTCTGCAAGTAAGTCATCTCATCATGTATCTTTCTTGCCAGCCGCGCC
GCATCCTGTATCTCCGACTGTTTCTTTTATAAATGATAATCAAGGGCTCTCTGTTGACACTTGCTTCCAAGATAC
TGGGTTATGGGGAGTTGCCTCGCCGGCGAAACCTGCATCTTCTCTCACGATCCGTCTACGCTTCTCAACAAAGTA
AATCTCGATGAGAACGGAAACGAGGCTGCCAAGAACCAGGAAAGCCCTTCGTTGCAAGATGTTGACTCGTTTCCC
TGCCTTCAAGACGACAGGTCGGGCCAAAGAAGCGGCGATGGTGGCGCAATCGCGGCGAGCTTGGCGGCACCGATG
GGACCACGTCATCTTTTTGGTACGGAAGCTCCGCGGTTGCGATCGCGACCCGTCAGCAGACAGCAAGCCAAAGAG
ACGATGACGTCGGCTCCGGCTCCGGACGACAACGAGGCGTTTCCGTCGCTAGGTTCGGCCTCGACGAGGCAAGGG
AAGAAGCACCACGGAAAGCGCGGCGGTCACGGCCATTCTCACAAAGAGAACCTCGCGCCGAGCTCGCTGGCAGAC
ATTGTCAGGAGGACGCCTTCGCCGGCTCCCGGGCCAGCGAGGCCGGAGGCGAAGAAGGCCGGACAGAACGGCAGC
GCGCGCAACGGTGGTGAGAACAGCGCGGCGGCACTGGCAATCCCCAGCCCCAAGCACATTCCATGGCTGGAAACC
GGTGAACGGGCCAACAAGGCGTATCTGAAGGCTCGGCAAGAAGCCATTAAGCATGGCGGGCTTCGCAATAAGTTT
CTGCAAAGGTATGCGAATACTGCTGCCCGGGATATAATTGATAGCGCAAGGCTGACTGCAAATAACAGTGCGGCG
CAGGCGTGGAATCGCAACGACGCGAGAGCAGCCAAGGCACTCAGTCTTCGCGGGCAAAGCGAGAACGATTTGATG
CGAAAGGCGCATCGAGAGGCGGCGCGCGAACTATACGAGCAACGGAACAAGGGAGGCATGAACAACGGATCGGAG
ATTTACGTCGACCTCCACGGACTCCATCCGGAAGAAGCGGTCGAATACCTCGAAAGGACGCTGATGGAGAATTGC
AGAGAGGCGAGGCCCGTGTACGCCATCACCGGCACGGGGCACCACAGCAAGAACGGCAAGGATAAGATGGGCAGA
GCGATCCGCAGTTACCTCGGCGAGTGGCGCTACGCGTATCGCGAGTTTTCGGTGCCGGGCGACCGCAACAGCATG
GGCGGGATCCTGGGCGTTGACGCGCGCAGCTGGGACAAGTCGCGGGGTAAAGTGACGGGCGCTCAGGAAGGATCC
AAGGTGGATATTCTCAGCCAGGGCGTGGAGATTGGGGATGGCAAGGTCAGGCTGCTGGTTCGGGATCCGCCCAAG
GGGCCGAGCGGGCGACGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail