Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3976
Gene name
LocationContig_36:50795..52287
Strand+
Gene length (bp)1492
Transcript length (bp)1431
Coding sequence length (bp)1431
Protein length (aa) 477

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13621 Cupin_8 Cupin-like domain 2.1E-14 172 385
PF02373 JmjC JmjC domain, hydroxylase 1.8E-08 275 385
PF12937 F-box-like F-box-like 4.1E-07 47 91
PF00646 F-box F-box domain 7.3E-05 48 86

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q67XX3|FB252_ARATH F-box protein At5g06550 OS=Arabidopsis thaliana GN=At5g06550 PE=2 SV=1 18 467 9.0E-81
sp|Q9M9E8|FB92_ARATH F-box protein At1g78280 OS=Arabidopsis thaliana GN=At1g78280 PE=2 SV=3 27 386 3.0E-54
sp|Q6Q4H1|JMJD6_HYDVU Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Hydra vulgaris GN=PSR PE=1 SV=1 137 385 2.0E-37
sp|Q9GYI4|JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans GN=psr-1 PE=1 SV=2 133 436 2.0E-37
sp|Q5R6G2|JMJD6_PONAB Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Pongo abelii GN=JMJD6 PE=2 SV=1 152 386 8.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q67XX3|FB252_ARATH F-box protein At5g06550 OS=Arabidopsis thaliana GN=At5g06550 PE=2 SV=1 18 467 9.0E-81
sp|Q9M9E8|FB92_ARATH F-box protein At1g78280 OS=Arabidopsis thaliana GN=At1g78280 PE=2 SV=3 27 386 3.0E-54
sp|Q6Q4H1|JMJD6_HYDVU Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Hydra vulgaris GN=PSR PE=1 SV=1 137 385 2.0E-37
sp|Q9GYI4|JMJD6_CAEEL Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis elegans GN=psr-1 PE=1 SV=2 133 436 2.0E-37
sp|Q5R6G2|JMJD6_PONAB Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Pongo abelii GN=JMJD6 PE=2 SV=1 152 386 8.0E-37
sp|Q6NYC1|JMJD6_HUMAN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Homo sapiens GN=JMJD6 PE=1 SV=1 152 386 8.0E-37
sp|Q58DS6|JMJD6_BOVIN Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Bos taurus GN=JMJD6 PE=2 SV=1 117 386 9.0E-37
sp|Q7ZX37|JMD6B_XENLA Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6-B OS=Xenopus laevis GN=jmjd6-b PE=2 SV=1 155 389 3.0E-36
sp|Q9ERI5|JMJD6_MOUSE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Mus musculus GN=Jmjd6 PE=1 SV=2 117 386 7.0E-36
sp|Q6PFM0|JMJD6_DANRE Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Danio rerio GN=jmjd6 PE=2 SV=2 137 386 1.0E-35
sp|Q6AYK2|JMJD6_RAT Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Rattus norvegicus GN=Jmjd6 PE=2 SV=2 160 386 1.0E-35
sp|Q5ZMK5|JMJD6_CHICK Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6 OS=Gallus gallus GN=JMJD6 PE=2 SV=1 160 386 1.0E-35
sp|Q6GND3|JMD6A_XENLA Bifunctional arginine demethylase and lysyl-hydroxylase JMJD6-A OS=Xenopus laevis GN=jmjd6-a PE=2 SV=1 161 389 5.0E-35
sp|Q9VD28|JMJD6_DROME Bifunctional arginine demethylase and lysyl-hydroxylase PSR OS=Drosophila melanogaster GN=PSR PE=2 SV=1 147 385 1.0E-34
sp|Q623U2|JMJD6_CAEBR Bifunctional arginine demethylase and lysyl-hydroxylase psr-1 OS=Caenorhabditis briggsae GN=psr-1 PE=3 SV=1 133 395 3.0E-34
sp|Q08BY5|JMJD4_DANRE JmjC domain-containing protein 4 OS=Danio rerio GN=jmjd4 PE=2 SV=1 215 386 2.0E-09
sp|Q9VJ97|JMJD4_DROME JmjC domain-containing protein 4 homolog OS=Drosophila melanogaster GN=CG7200 PE=2 SV=1 252 385 4.0E-08
sp|Q5ZHV5|JMJD4_CHICK JmjC domain-containing protein 4 OS=Gallus gallus GN=JMJD4 PE=2 SV=1 273 386 1.0E-07
sp|Q8BFT6|JMJD4_MOUSE JmjC domain-containing protein 4 OS=Mus musculus GN=Jmjd4 PE=2 SV=1 273 460 3.0E-07
sp|Q9H9V9|JMJD4_HUMAN JmjC domain-containing protein 4 OS=Homo sapiens GN=JMJD4 PE=1 SV=2 154 386 1.0E-06
sp|Q6BXJ4|JHD1_DEBHA JmjC domain-containing histone demethylation protein 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=JHD1 PE=3 SV=2 274 388 3.0E-06
sp|Q5RHD1|KDM7A_DANRE Lysine-specific demethylase 7A OS=Danio rerio GN=kdm7a PE=2 SV=2 252 386 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5365
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6086
Ophiocordyceps australis map64 (Brazil) OphauB2|7660
Ophiocordyceps camponoti-floridani Ophcf2|00404
Ophiocordyceps camponoti-rufipedis Ophun1|3976 (this protein)
Ophiocordyceps kimflemingae Ophio5|6346
Ophiocordyceps subramaniannii Hirsu2|53

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3976
MVMTTTLDIASPHHDTIPTHPLHIKPLGNRLLARGPDARAGIGAWQPLPDETLMLVLEFLDGPELAVLGSTCKFM
HALCRSDELWKAIYLRLPKERSHSLPWRGSWRSTVRALPKDREAKVDCGCVFSDVLHRPFACSNINLSQYVADIP
EANLISRFDSLTYDDFAERWTERPFILTRCIRGWPACSLWTLDSLSRDYADVEFRAEAVDWTLRQYWSYMNDNQD
ESPLYLFDRKFVEKMKIRVGREAEAAYWRPDCFGPDLLEVLGTERPAHRWLIAGPKRSGSTFHKDPNGTSAWNAV
IQGAKYWIMFPPTACVPGVYVSADSSEVTSPLSIAEWLLTFHGEARRLPGCVEGVCLAGEILHVPSGWWHLVVNL
ESGIAVTQNFVPLSPSLKLVSEVLSFLRDKPDQVSGFPTAVEDPYGLLVERLREAYPDVLDKALDLSLKRGGNKR
KWDTAVKEAGQGFSFGFGVDDDVDVP*
Coding >Ophun1|3976
ATGGTCATGACGACGACTCTGGATATCGCCTCGCCGCATCATGATACGATTCCCACCCATCCTCTACACATCAAG
CCTCTGGGAAACCGTCTTCTTGCCCGAGGCCCCGATGCTCGTGCCGGTATAGGCGCGTGGCAGCCTCTCCCAGAC
GAGACTCTCATGTTAGTCCTAGAGTTCCTCGACGGCCCGGAGCTAGCTGTCCTTGGCTCAACCTGCAAGTTTATG
CATGCCTTGTGTCGTTCAGACGAGCTGTGGAAGGCTATTTATCTCCGATTGCCCAAGGAACGCAGCCACTCACTT
CCGTGGCGTGGGTCCTGGAGGAGCACCGTCCGAGCTTTGCCCAAGGACCGCGAGGCCAAGGTCGACTGCGGGTGT
GTCTTCTCTGACGTTCTGCATCGACCCTTTGCCTGCTCCAACATAAACCTGTCGCAATATGTCGCCGACATCCCA
GAGGCCAACCTCATCTCCCGCTTCGACAGTCTTACGTACGATGACTTTGCAGAGCGCTGGACCGAGCGGCCCTTC
ATCTTGACAAGATGCATACGGGGCTGGCCCGCTTGCTCCTTGTGGACGCTAGATAGCCTCTCCCGAGACTATGCA
GACGTCGAGTTTAGAGCTGAGGCCGTCGACTGGACGCTACGCCAGTATTGGAGCTACATGAACGATAACCAGGAC
GAGAGCCCCTTGTACCTGTTTGATCGCAAATTCGTCGAAAAGATGAAGATCAGGGTCGGCCGCGAAGCCGAAGCG
GCGTATTGGCGACCGGACTGCTTCGGACCGGACCTCTTGGAGGTTCTGGGAACGGAGCGGCCGGCTCACCGGTGG
CTGATTGCGGGCCCCAAAAGGAGCGGCTCAACCTTTCACAAGGACCCCAATGGAACTAGCGCCTGGAACGCGGTG
ATTCAGGGAGCCAAGTATTGGATCATGTTTCCGCCCACGGCGTGCGTCCCGGGCGTCTACGTCTCAGCGGACAGC
AGCGAGGTGACGAGCCCGCTCAGCATCGCCGAGTGGCTGCTCACCTTTCACGGCGAGGCTCGCCGGCTGCCCGGG
TGTGTCGAGGGAGTTTGTCTCGCCGGCGAGATTCTCCATGTGCCCAGCGGCTGGTGGCACTTGGTGGTGAATCTT
GAGAGCGGCATCGCCGTGACGCAGAACTTTGTACCTCTTTCGCCGAGTCTAAAGCTCGTCTCCGAGGTGCTGTCT
TTTCTACGCGACAAGCCAGACCAGGTATCGGGCTTTCCCACGGCGGTCGAGGATCCCTATGGACTCTTGGTGGAG
AGGCTCCGGGAAGCATATCCCGATGTCCTCGACAAGGCGCTGGACCTGTCGCTGAAAAGGGGGGGGAACAAGCGC
AAATGGGACACGGCCGTCAAAGAAGCTGGACAGGGATTTAGTTTTGGCTTCGGCGTCGACGACGACGTGGACGTG
CCTTAG
Transcript >Ophun1|3976
ATGGTCATGACGACGACTCTGGATATCGCCTCGCCGCATCATGATACGATTCCCACCCATCCTCTACACATCAAG
CCTCTGGGAAACCGTCTTCTTGCCCGAGGCCCCGATGCTCGTGCCGGTATAGGCGCGTGGCAGCCTCTCCCAGAC
GAGACTCTCATGTTAGTCCTAGAGTTCCTCGACGGCCCGGAGCTAGCTGTCCTTGGCTCAACCTGCAAGTTTATG
CATGCCTTGTGTCGTTCAGACGAGCTGTGGAAGGCTATTTATCTCCGATTGCCCAAGGAACGCAGCCACTCACTT
CCGTGGCGTGGGTCCTGGAGGAGCACCGTCCGAGCTTTGCCCAAGGACCGCGAGGCCAAGGTCGACTGCGGGTGT
GTCTTCTCTGACGTTCTGCATCGACCCTTTGCCTGCTCCAACATAAACCTGTCGCAATATGTCGCCGACATCCCA
GAGGCCAACCTCATCTCCCGCTTCGACAGTCTTACGTACGATGACTTTGCAGAGCGCTGGACCGAGCGGCCCTTC
ATCTTGACAAGATGCATACGGGGCTGGCCCGCTTGCTCCTTGTGGACGCTAGATAGCCTCTCCCGAGACTATGCA
GACGTCGAGTTTAGAGCTGAGGCCGTCGACTGGACGCTACGCCAGTATTGGAGCTACATGAACGATAACCAGGAC
GAGAGCCCCTTGTACCTGTTTGATCGCAAATTCGTCGAAAAGATGAAGATCAGGGTCGGCCGCGAAGCCGAAGCG
GCGTATTGGCGACCGGACTGCTTCGGACCGGACCTCTTGGAGGTTCTGGGAACGGAGCGGCCGGCTCACCGGTGG
CTGATTGCGGGCCCCAAAAGGAGCGGCTCAACCTTTCACAAGGACCCCAATGGAACTAGCGCCTGGAACGCGGTG
ATTCAGGGAGCCAAGTATTGGATCATGTTTCCGCCCACGGCGTGCGTCCCGGGCGTCTACGTCTCAGCGGACAGC
AGCGAGGTGACGAGCCCGCTCAGCATCGCCGAGTGGCTGCTCACCTTTCACGGCGAGGCTCGCCGGCTGCCCGGG
TGTGTCGAGGGAGTTTGTCTCGCCGGCGAGATTCTCCATGTGCCCAGCGGCTGGTGGCACTTGGTGGTGAATCTT
GAGAGCGGCATCGCCGTGACGCAGAACTTTGTACCTCTTTCGCCGAGTCTAAAGCTCGTCTCCGAGGTGCTGTCT
TTTCTACGCGACAAGCCAGACCAGGTATCGGGCTTTCCCACGGCGGTCGAGGATCCCTATGGACTCTTGGTGGAG
AGGCTCCGGGAAGCATATCCCGATGTCCTCGACAAGGCGCTGGACCTGTCGCTGAAAAGGGGGGGGAACAAGCGC
AAATGGGACACGGCCGTCAAAGAAGCTGGACAGGGATTTAGTTTTGGCTTCGGCGTCGACGACGACGTGGACGTG
CCTTAG
Gene >Ophun1|3976
ATGGTCATGACGACGACTCTGGATATCGCCTCGCCGCATCATGATACGATTCCCACCCATCCTCTACACATCAAG
CCTCTGGGAAACCGTCTTCTTGCCCGAGGCCCCGATGCTCGTGCCGGTATAGGCGCGTGGCAGCCTCTCCCAGAC
GAGACTCTCATGTTAGTCCTAGAGTTCCTCGACGGCCCGGAGCTAGCTGTCCTTGGCTCAACCTGCAAGTTTATG
CATGCCTTGTGTCGTTCAGACGAGCTGTGGAAGGCTATTTATCTCCGGTGCGCCTCTTGTTCTAGTCACTGCCTA
AACTATGCCGTGTCTCTGATGTCGCCACTGCAGATTGCCCAAGGAACGCAGCCACTCACTTCCGTGGCGTGGGTC
CTGGAGGAGCACCGTCCGAGCTTTGCCCAAGGACCGCGAGGCCAAGGTCGACTGCGGGTGTGTCTTCTCTGACGT
TCTGCATCGACCCTTTGCCTGCTCCAACATAAACCTGTCGCAATATGTCGCCGACATCCCAGAGGCCAACCTCAT
CTCCCGCTTCGACAGTCTTACGTACGATGACTTTGCAGAGCGCTGGACCGAGCGGCCCTTCATCTTGACAAGATG
CATACGGGGCTGGCCCGCTTGCTCCTTGTGGACGCTAGATAGCCTCTCCCGAGACTATGCAGACGTCGAGTTTAG
AGCTGAGGCCGTCGACTGGACGCTACGCCAGTATTGGAGCTACATGAACGATAACCAGGACGAGAGCCCCTTGTA
CCTGTTTGATCGCAAATTCGTCGAAAAGATGAAGATCAGGGTCGGCCGCGAAGCCGAAGCGGCGTATTGGCGACC
GGACTGCTTCGGACCGGACCTCTTGGAGGTTCTGGGAACGGAGCGGCCGGCTCACCGGTGGCTGATTGCGGGCCC
CAAAAGGAGCGGCTCAACCTTTCACAAGGACCCCAATGGAACTAGCGCCTGGAACGCGGTGATTCAGGGAGCCAA
GTATTGGATCATGTTTCCGCCCACGGCGTGCGTCCCGGGCGTCTACGTCTCAGCGGACAGCAGCGAGGTGACGAG
CCCGCTCAGCATCGCCGAGTGGCTGCTCACCTTTCACGGCGAGGCTCGCCGGCTGCCCGGGTGTGTCGAGGGAGT
TTGTCTCGCCGGCGAGATTCTCCATGTGCCCAGCGGCTGGTGGCACTTGGTGGTGAATCTTGAGAGCGGCATCGC
CGTGACGCAGAACTTTGTACCTCTTTCGCCGAGTCTAAAGCTCGTCTCCGAGGTGCTGTCTTTTCTACGCGACAA
GCCAGACCAGGTATCGGGCTTTCCCACGGCGGTCGAGGATCCCTATGGACTCTTGGTGGAGAGGCTCCGGGAAGC
ATATCCCGATGTCCTCGACAAGGCGCTGGACCTGTCGCTGAAAAGGGGGGGGAACAAGCGCAAATGGGACACGGC
CGTCAAAGAAGCTGGACAGGGATTTAGTTTTGGCTTCGGCGTCGACGACGACGTGGACGTGCCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail