Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3970
Gene name
LocationContig_36:38101..41484
Strand-
Gene length (bp)3383
Transcript length (bp)3336
Coding sequence length (bp)3336
Protein length (aa) 1112

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00488 MutS_V MutS domain V 4.9E-69 891 1087
PF05192 MutS_III MutS domain III 3.3E-47 481 831
PF01624 MutS_I MutS domain I 7.4E-22 188 301
PF05188 MutS_II MutS domain II 2.9E-09 349 456

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13921|MSH1_SCHPO MutS protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh1 PE=3 SV=2 153 1087 0.0E+00
sp|P25846|MSH1_YEAST DNA mismatch repair protein MSH1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH1 PE=1 SV=2 189 1086 2.0E-152
sp|A8EZG1|MUTS_RICCK DNA mismatch repair protein MutS OS=Rickettsia canadensis (strain McKiel) GN=mutS PE=3 SV=1 186 1108 5.0E-121
sp|Q21CE8|MUTS_RHOPB DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisB18) GN=mutS PE=3 SV=2 188 1092 4.0E-117
sp|A6WV86|MUTS_OCHA4 DNA mismatch repair protein MutS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mutS PE=3 SV=1 182 1086 4.0E-115
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13921|MSH1_SCHPO MutS protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh1 PE=3 SV=2 153 1087 0.0E+00
sp|P25846|MSH1_YEAST DNA mismatch repair protein MSH1, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH1 PE=1 SV=2 189 1086 2.0E-152
sp|A8EZG1|MUTS_RICCK DNA mismatch repair protein MutS OS=Rickettsia canadensis (strain McKiel) GN=mutS PE=3 SV=1 186 1108 5.0E-121
sp|Q21CE8|MUTS_RHOPB DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisB18) GN=mutS PE=3 SV=2 188 1092 4.0E-117
sp|A6WV86|MUTS_OCHA4 DNA mismatch repair protein MutS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=mutS PE=3 SV=1 182 1086 4.0E-115
sp|Q1RJJ5|MUTS_RICBR DNA mismatch repair protein MutS OS=Rickettsia bellii (strain RML369-C) GN=mutS PE=3 SV=1 181 1108 2.0E-113
sp|Q1QQJ4|MUTS_NITHX DNA mismatch repair protein MutS OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=mutS PE=3 SV=1 186 1096 3.0E-113
sp|A8GX86|MUTS_RICB8 DNA mismatch repair protein MutS OS=Rickettsia bellii (strain OSU 85-389) GN=mutS PE=3 SV=1 181 1108 7.0E-113
sp|A5VN83|MUTS_BRUO2 DNA mismatch repair protein MutS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=mutS PE=3 SV=1 179 1086 3.0E-112
sp|Q13ED0|MUTS_RHOPS DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisB5) GN=mutS PE=3 SV=1 182 1093 5.0E-112
sp|Q8YES6|MUTS_BRUME DNA mismatch repair protein MutS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=mutS PE=3 SV=2 179 1086 8.0E-112
sp|C0R5H4|MUTS_WOLWR DNA mismatch repair protein MutS OS=Wolbachia sp. subsp. Drosophila simulans (strain wRi) GN=mutS PE=3 SV=1 186 1086 9.0E-112
sp|Q8G310|MUTS_BRUSU DNA mismatch repair protein MutS OS=Brucella suis biovar 1 (strain 1330) GN=mutS PE=3 SV=1 179 1086 1.0E-111
sp|A9M792|MUTS_BRUC2 DNA mismatch repair protein MutS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=mutS PE=3 SV=1 179 1086 1.0E-111
sp|P61670|MUTS_RHOPA DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=mutS PE=3 SV=1 188 1093 1.0E-111
sp|B0CIQ5|MUTS_BRUSI DNA mismatch repair protein MutS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=mutS PE=3 SV=1 179 1086 2.0E-111
sp|Q9ZDM9|MUTS_RICPR DNA mismatch repair protein MutS OS=Rickettsia prowazekii (strain Madrid E) GN=mutS PE=3 SV=1 186 1108 3.0E-111
sp|Q68X73|MUTS_RICTY DNA mismatch repair protein MutS OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=mutS PE=3 SV=1 186 1104 3.0E-111
sp|Q57FM9|MUTS_BRUAB DNA mismatch repair protein MutS OS=Brucella abortus biovar 1 (strain 9-941) GN=mutS PE=3 SV=1 179 1086 3.0E-111
sp|Q2YNZ0|MUTS_BRUA2 DNA mismatch repair protein MutS OS=Brucella abortus (strain 2308) GN=mutS PE=3 SV=1 179 1086 3.0E-111
sp|Q4UM86|MUTS_RICFE DNA mismatch repair protein MutS OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=mutS PE=3 SV=1 186 1108 3.0E-110
sp|P61673|MUTS_WOLPM DNA mismatch repair protein MutS OS=Wolbachia pipientis wMel GN=mutS PE=3 SV=1 186 1086 4.0E-110
sp|Q5FHE8|MUTS_EHRRG DNA mismatch repair protein MutS OS=Ehrlichia ruminantium (strain Gardel) GN=mutS PE=3 SV=1 175 1086 8.0E-110
sp|A1B095|MUTS_PARDP DNA mismatch repair protein MutS OS=Paracoccus denitrificans (strain Pd 1222) GN=mutS PE=3 SV=1 185 1086 1.0E-109
sp|B0BWY8|MUTS_RICRO DNA mismatch repair protein MutS OS=Rickettsia rickettsii (strain Iowa) GN=mutS PE=3 SV=1 186 1108 1.0E-109
sp|A8GRI6|MUTS_RICRS DNA mismatch repair protein MutS OS=Rickettsia rickettsii (strain Sheila Smith) GN=mutS PE=3 SV=1 186 1108 1.0E-109
sp|A5CDU2|MUTS_ORITB DNA mismatch repair protein MutS OS=Orientia tsutsugamushi (strain Boryong) GN=mutS PE=3 SV=1 186 1086 2.0E-108
sp|Q92IL9|MUTS_RICCN DNA mismatch repair protein MutS OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=mutS PE=3 SV=1 186 1108 7.0E-108
sp|Q98C21|MUTS_RHILO DNA mismatch repair protein MutS OS=Rhizobium loti (strain MAFF303099) GN=mutS PE=3 SV=1 167 1093 7.0E-108
sp|A8F164|MUTS_RICM5 DNA mismatch repair protein MutS OS=Rickettsia massiliae (strain Mtu5) GN=mutS PE=3 SV=1 186 1102 1.0E-107
sp|Q0AK91|MUTS_MARMM DNA mismatch repair protein MutS OS=Maricaulis maris (strain MCS10) GN=mutS PE=3 SV=1 186 1095 3.0E-107
sp|C3PN02|MUTS_RICAE DNA mismatch repair protein MutS OS=Rickettsia africae (strain ESF-5) GN=mutS PE=3 SV=1 186 1108 3.0E-107
sp|Q6G542|MUTS_BARHE DNA mismatch repair protein MutS OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=mutS PE=3 SV=1 186 1103 4.0E-107
sp|Q5HBQ7|MUTS_EHRRW DNA mismatch repair protein MutS OS=Ehrlichia ruminantium (strain Welgevonden) GN=mutS PE=3 SV=1 175 1086 6.0E-107
sp|Q7UP05|MUTS_RHOBA DNA mismatch repair protein MutS OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mutS PE=3 SV=1 200 1093 8.0E-107
sp|A6U5G0|MUTS_SINMW DNA mismatch repair protein MutS OS=Sinorhizobium medicae (strain WSM419) GN=mutS PE=3 SV=1 200 1091 7.0E-106
sp|A7HZ64|MUTS_PARL1 DNA mismatch repair protein MutS OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=mutS PE=3 SV=1 182 1092 1.0E-105
sp|A8GMX2|MUTS_RICAH DNA mismatch repair protein MutS OS=Rickettsia akari (strain Hartford) GN=mutS PE=3 SV=1 186 1108 3.0E-105
sp|A1UU95|MUTS_BARBK DNA mismatch repair protein MutS OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=mutS PE=3 SV=1 186 1103 5.0E-105
sp|Q3YSJ8|MUTS_EHRCJ DNA mismatch repair protein MutS OS=Ehrlichia canis (strain Jake) GN=mutS PE=3 SV=1 187 1086 1.0E-104
sp|Q2GG13|MUTS_EHRCR DNA mismatch repair protein MutS OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=mutS PE=3 SV=1 187 1087 1.0E-104
sp|A5VA00|MUTS_SPHWW DNA mismatch repair protein MutS OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=mutS PE=3 SV=1 175 1099 8.0E-103
sp|P61667|MUTS_GEOSL DNA mismatch repair protein MutS OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=mutS PE=3 SV=1 200 1086 1.0E-102
sp|Q4L5Z9|MUTS_STAHJ DNA mismatch repair protein MutS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=mutS PE=3 SV=1 186 1088 8.0E-102
sp|B3CQY2|MUTS_ORITI DNA mismatch repair protein MutS OS=Orientia tsutsugamushi (strain Ikeda) GN=mutS PE=3 SV=1 186 1086 4.0E-101
sp|A9ILT1|MUTS_BART1 DNA mismatch repair protein MutS OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=mutS PE=3 SV=1 185 1103 1.0E-100
sp|Q2GJL7|MUTS_ANAPZ DNA mismatch repair protein MutS OS=Anaplasma phagocytophilum (strain HZ) GN=mutS PE=3 SV=1 186 1087 7.0E-100
sp|Q67NK1|MUTS_SYMTH DNA mismatch repair protein MutS OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=mutS PE=3 SV=1 180 1097 7.0E-100
sp|Q1D5J6|MUTS_MYXXD DNA mismatch repair protein MutS OS=Myxococcus xanthus (strain DK 1622) GN=mutS PE=3 SV=1 186 1086 5.0E-98
sp|Q3M892|MUTS_ANAVT DNA mismatch repair protein MutS OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=mutS PE=3 SV=1 188 1086 2.0E-96
sp|A5N8I5|MUTS_CLOK5 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=mutS PE=3 SV=1 186 1088 6.0E-96
sp|B9E1Z0|MUTS_CLOK1 DNA mismatch repair protein MutS OS=Clostridium kluyveri (strain NBRC 12016) GN=mutS PE=3 SV=1 186 1088 6.0E-96
sp|Q187T6|MUTS_PEPD6 DNA mismatch repair protein MutS OS=Peptoclostridium difficile (strain 630) GN=mutS PE=3 SV=2 187 1086 7.0E-96
sp|A6TR79|MUTS_ALKMQ DNA mismatch repair protein MutS OS=Alkaliphilus metalliredigens (strain QYMF) GN=mutS PE=3 SV=1 178 1087 8.0E-96
sp|Q2RNG0|MUTS_RHORT DNA mismatch repair protein MutS OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=mutS PE=3 SV=1 200 1096 9.0E-96
sp|B0CF30|MUTS_ACAM1 DNA mismatch repair protein MutS OS=Acaryochloris marina (strain MBIC 11017) GN=mutS PE=3 SV=1 174 1086 3.0E-95
sp|A3DDI3|MUTS_CLOTH DNA mismatch repair protein MutS OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=mutS PE=3 SV=1 186 1086 1.0E-94
sp|Q64MG7|MUTS_BACFR DNA mismatch repair protein MutS OS=Bacteroides fragilis (strain YCH46) GN=mutS PE=3 SV=1 188 1098 3.0E-94
sp|Q5L7B7|MUTS_BACFN DNA mismatch repair protein MutS OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=mutS PE=3 SV=1 186 1098 4.0E-94
sp|B9MJU0|MUTS_CALBD DNA mismatch repair protein MutS OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=mutS PE=3 SV=1 186 1093 1.0E-93
sp|C3KX35|MUTS_CLOB6 DNA mismatch repair protein MutS OS=Clostridium botulinum (strain 657 / Type Ba4) GN=mutS PE=3 SV=1 200 1105 2.0E-93
sp|A5I2S2|MUTS_CLOBH DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=mutS PE=3 SV=1 200 1105 3.0E-93
sp|A7FUL0|MUTS_CLOB1 DNA mismatch repair protein MutS OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=mutS PE=3 SV=1 200 1105 3.0E-93
sp|Q8A334|MUTS_BACTN DNA mismatch repair protein MutS OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=mutS PE=3 SV=1 188 1098 5.0E-93
sp|Q0STR4|MUTS_CLOPS DNA mismatch repair protein MutS OS=Clostridium perfringens (strain SM101 / Type A) GN=mutS PE=3 SV=1 187 1086 6.0E-93
sp|A9KL10|MUTS_CLOPH DNA mismatch repair protein MutS OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=mutS PE=3 SV=1 187 1093 7.0E-93
sp|B1KSA3|MUTS_CLOBM DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=mutS PE=3 SV=1 200 1105 7.0E-93
sp|Q10YG4|MUTS_TRIEI DNA mismatch repair protein MutS OS=Trichodesmium erythraeum (strain IMS101) GN=mutS PE=3 SV=1 168 1086 1.0E-92
sp|Q8XL87|MUTS_CLOPE DNA mismatch repair protein MutS OS=Clostridium perfringens (strain 13 / Type A) GN=mutS PE=3 SV=1 187 1086 1.0E-92
sp|B8CX98|MUTS_HALOH DNA mismatch repair protein MutS OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=mutS PE=3 SV=1 186 1094 1.0E-92
sp|Q8RA71|MUTS_CALS4 DNA mismatch repair protein MutS OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=mutS PE=3 SV=1 187 1098 2.0E-92
sp|P61672|MUTS_TREDE DNA mismatch repair protein MutS OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=mutS PE=3 SV=1 180 1089 2.0E-92
sp|Q0TRD6|MUTS_CLOP1 DNA mismatch repair protein MutS OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=mutS PE=3 SV=1 187 1086 2.0E-92
sp|Q9KAC0|MUTS_BACHD DNA mismatch repair protein MutS OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mutS PE=3 SV=1 186 1093 3.0E-92
sp|Q9AC54|MUTS_CAUCR DNA mismatch repair protein MutS OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=mutS PE=3 SV=1 166 1091 4.0E-92
sp|B8I2Q5|MUTS_CLOCE DNA mismatch repair protein MutS OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=mutS PE=3 SV=1 186 1087 4.0E-92
sp|C1FNT9|MUTS_CLOBJ DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Kyoto / Type A2) GN=mutS PE=3 SV=1 200 1093 9.0E-92
sp|A7GE45|MUTS_CLOBL DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=mutS PE=3 SV=1 200 1093 9.0E-92
sp|B0T142|MUTS_CAUSK DNA mismatch repair protein MutS OS=Caulobacter sp. (strain K31) GN=mutS PE=3 SV=1 187 1091 1.0E-91
sp|B1IM68|MUTS_CLOBK DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Okra / Type B1) GN=mutS PE=3 SV=1 200 1105 3.0E-91
sp|Q24X61|MUTS_DESHY DNA mismatch repair protein MutS OS=Desulfitobacterium hafniense (strain Y51) GN=mutS PE=3 SV=1 182 1086 4.0E-91
sp|A1AMW9|MUTS_PELPD DNA mismatch repair protein MutS OS=Pelobacter propionicus (strain DSM 2379) GN=mutS PE=3 SV=1 186 1086 4.0E-91
sp|Q3A4F1|MUTS_PELCD DNA mismatch repair protein MutS OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=mutS PE=3 SV=1 186 1110 8.0E-91
sp|A8AZU4|MUTS_STRGC DNA mismatch repair protein MutS OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=mutS PE=3 SV=1 189 1087 1.0E-90
sp|A0B976|MUTS_METTP DNA mismatch repair protein MutS OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=mutS PE=3 SV=1 187 1086 1.0E-90
sp|B8FJL5|MUTS_DESAA DNA mismatch repair protein MutS OS=Desulfatibacillum alkenivorans (strain AK-01) GN=mutS PE=3 SV=1 180 1086 1.0E-90
sp|Q6AQ04|MUTS_DESPS DNA mismatch repair protein MutS OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=mutS PE=3 SV=1 187 1099 3.0E-90
sp|B3QPY5|MUTS_CHLP8 DNA mismatch repair protein MutS OS=Chlorobaculum parvum (strain NCIB 8327) GN=mutS PE=3 SV=1 185 1086 3.0E-90
sp|A8MFD4|MUTS_ALKOO DNA mismatch repair protein MutS OS=Alkaliphilus oremlandii (strain OhILAs) GN=mutS PE=3 SV=2 186 1111 8.0E-90
sp|Q8DRW8|MUTS_STRMU DNA mismatch repair protein MutS OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=mutS PE=3 SV=1 189 1087 3.0E-89
sp|Q97I19|MUTS_CLOAB DNA mismatch repair protein MutS OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=mutS PE=3 SV=1 188 1086 3.0E-89
sp|Q8RFK2|MUTS_FUSNN DNA mismatch repair protein MutS OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=mutS PE=3 SV=1 186 1086 4.0E-89
sp|B0JFY0|MUTS_MICAN DNA mismatch repair protein MutS OS=Microcystis aeruginosa (strain NIES-843) GN=mutS PE=3 SV=1 186 1086 6.0E-89
sp|A4SFT1|MUTS_CHLPM DNA mismatch repair protein MutS OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=mutS PE=3 SV=1 188 1087 8.0E-89
sp|Q6MBV4|MUTS_PARUW DNA mismatch repair protein MutS OS=Protochlamydia amoebophila (strain UWE25) GN=mutS PE=3 SV=1 188 1086 9.0E-89
sp|Q2S254|MUTS_SALRD DNA mismatch repair protein MutS OS=Salinibacter ruber (strain DSM 13855 / M31) GN=mutS PE=3 SV=1 187 1086 1.0E-88
sp|A4W4J7|MUTS_STRS2 DNA mismatch repair protein MutS OS=Streptococcus suis (strain 98HAH33) GN=mutS PE=3 SV=1 189 1086 2.0E-88
sp|C0MGC5|MUTS_STRS7 DNA mismatch repair protein MutS OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=mutS PE=3 SV=1 189 1097 3.0E-88
sp|B2J434|MUTS_NOSP7 DNA mismatch repair protein MutS OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=mutS PE=3 SV=1 197 1086 3.0E-88
sp|C0MAS5|MUTS_STRE4 DNA mismatch repair protein MutS OS=Streptococcus equi subsp. equi (strain 4047) GN=mutS PE=3 SV=1 189 1097 5.0E-88
sp|P73769|MUTS_SYNY3 DNA mismatch repair protein MutS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mutS PE=3 SV=2 163 1086 8.0E-87
sp|A5GHU5|MUTS_SYNPW DNA mismatch repair protein MutS OS=Synechococcus sp. (strain WH7803) GN=mutS PE=3 SV=1 169 1086 8.0E-87
sp|Q31KZ2|MUTS_SYNE7 DNA mismatch repair protein MutS OS=Synechococcus elongatus (strain PCC 7942) GN=mutS PE=3 SV=1 186 1087 2.0E-86
sp|Q7NRW7|MUTS_CHRVO DNA mismatch repair protein MutS OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=mutS PE=3 SV=1 180 1097 3.0E-86
sp|A7NPT5|MUTS_ROSCS DNA mismatch repair protein MutS OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=mutS PE=3 SV=1 184 1086 3.0E-86
sp|Q02VS3|MUTS_LACLS DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=mutS PE=3 SV=1 189 1086 4.0E-86
sp|Q3KKQ0|MUTS_CHLTA DNA mismatch repair protein MutS OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=mutS PE=3 SV=1 186 1086 4.0E-86
sp|Q12VC9|MUTS_METBU DNA mismatch repair protein MutS OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=mutS PE=3 SV=1 188 1086 5.0E-86
sp|O84797|MUTS_CHLTR DNA mismatch repair protein MutS OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=mutS PE=3 SV=1 186 1086 5.0E-86
sp|A4IMI0|MUTS_GEOTN DNA mismatch repair protein MutS OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mutS PE=3 SV=1 183 1096 5.0E-86
sp|B2G6E5|MUTS_LACRJ DNA mismatch repair protein MutS OS=Lactobacillus reuteri (strain JCM 1112) GN=mutS PE=3 SV=1 186 1086 6.0E-86
sp|A5VIW9|MUTS_LACRD DNA mismatch repair protein MutS OS=Lactobacillus reuteri (strain DSM 20016) GN=mutS PE=3 SV=1 186 1086 6.0E-86
sp|A8ZXH5|MUTS_DESOH DNA mismatch repair protein MutS OS=Desulfococcus oleovorans (strain DSM 6200 / Hxd3) GN=mutS PE=3 SV=1 186 1086 6.0E-86
sp|Q46IE5|MUTS_PROMT DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain NATL2A) GN=mutS PE=3 SV=1 202 1086 6.0E-86
sp|A5UZK7|MUTS_ROSS1 DNA mismatch repair protein MutS OS=Roseiflexus sp. (strain RS-1) GN=mutS PE=3 SV=1 184 1086 6.0E-86
sp|Q46CE2|MUTS_METBF DNA mismatch repair protein MutS OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=mutS PE=3 SV=1 188 1086 8.0E-86
sp|Q1JEH0|MUTS_STRPD DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=mutS PE=3 SV=1 189 1102 1.0E-85
sp|A6LG92|MUTS_PARD8 DNA mismatch repair protein MutS OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mutS PE=3 SV=1 187 1110 1.0E-85
sp|A6W1Q6|MUTS_MARMS DNA mismatch repair protein MutS OS=Marinomonas sp. (strain MWYL1) GN=mutS PE=3 SV=1 186 1086 1.0E-85
sp|Q5N0X9|MUTS_SYNP6 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=mutS PE=3 SV=1 186 1087 1.0E-85
sp|Q1LPG5|MUTS_CUPMC DNA mismatch repair protein MutS OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=mutS PE=3 SV=1 187 1086 1.0E-85
sp|Q1JJH0|MUTS_STRPC DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=mutS PE=3 SV=1 189 1102 3.0E-85
sp|Q1J9C1|MUTS_STRPB DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=mutS PE=3 SV=1 189 1102 3.0E-85
sp|P0DC61|MUTS_STRPQ DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=mutS PE=3 SV=1 189 1091 3.0E-85
sp|P0DC60|MUTS_STRP3 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=mutS PE=3 SV=1 189 1091 3.0E-85
sp|B5XJ75|MUTS_STRPZ DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=mutS PE=3 SV=1 189 1091 3.0E-85
sp|Q99XL8|MUTS_STRP1 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M1 GN=mutS PE=3 SV=1 189 1091 4.0E-85
sp|Q48QT6|MUTS_STRPM DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=mutS PE=3 SV=1 189 1091 4.0E-85
sp|B0BAP7|MUTS_CHLTB DNA mismatch repair protein MutS OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=mutS PE=3 SV=1 186 1086 4.0E-85
sp|B0B918|MUTS_CHLT2 DNA mismatch repair protein MutS OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=mutS PE=3 SV=1 186 1086 4.0E-85
sp|B9EBI4|MUTS_MACCJ DNA mismatch repair protein MutS OS=Macrococcus caseolyticus (strain JCSC5402) GN=mutS PE=3 SV=1 185 1100 6.0E-85
sp|A2RGX2|MUTS_STRPG DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=mutS PE=3 SV=1 189 1102 7.0E-85
sp|Q5X9F3|MUTS_STRP6 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=mutS PE=3 SV=1 189 1102 7.0E-85
sp|B1I9E5|MUTS_STRPI DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain Hungary19A-6) GN=mutS PE=3 SV=1 189 1094 7.0E-85
sp|A2RP10|MUTS_LACLM DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=mutS PE=3 SV=1 189 1086 7.0E-85
sp|C1CTY2|MUTS_STRZT DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=mutS PE=3 SV=1 189 1094 1.0E-84
sp|Q5L0E5|MUTS_GEOKA DNA mismatch repair protein MutS OS=Geobacillus kaustophilus (strain HTA426) GN=mutS PE=3 SV=1 188 1097 1.0E-84
sp|Q65JE2|MUTS_BACLD DNA mismatch repair protein MutS OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=mutS PE=3 SV=1 186 1086 2.0E-84
sp|Q47WN0|MUTS_COLP3 DNA mismatch repair protein MutS OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=mutS PE=3 SV=1 186 1087 2.0E-84
sp|C1CN23|MUTS_STRZP DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain P1031) GN=mutS PE=3 SV=1 189 1094 2.0E-84
sp|C1CH06|MUTS_STRZJ DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain JJA) GN=mutS PE=3 SV=1 189 1094 2.0E-84
sp|B8ZPK0|MUTS_STRPJ DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=mutS PE=3 SV=1 189 1094 2.0E-84
sp|C1CAQ5|MUTS_STRP7 DNA mismatch repair protein MutS OS=Streptococcus pneumoniae (strain 70585) GN=mutS PE=3 SV=1 189 1094 2.0E-84
sp|Q04I96|MUTS_STRP2 DNA mismatch repair protein MutS OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=mutS PE=3 SV=1 189 1094 2.0E-84
sp|P0A3R4|HEXA_STRR6 DNA mismatch repair protein HexA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=hexA PE=3 SV=1 189 1094 2.0E-84
sp|P0A3R3|HEXA_STRPN DNA mismatch repair protein HexA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=hexA PE=3 SV=1 189 1094 2.0E-84
sp|A0Q0M6|MUTS_CLONN DNA mismatch repair protein MutS OS=Clostridium novyi (strain NT) GN=mutS PE=3 SV=1 200 1086 3.0E-84
sp|Q8Y093|MUTS_RALSO DNA mismatch repair protein MutS OS=Ralstonia solanacearum (strain GMI1000) GN=mutS PE=3 SV=1 168 1086 4.0E-84
sp|Q9CDK9|MUTS_LACLA DNA mismatch repair protein MutS OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=mutS PE=3 SV=1 189 1086 4.0E-84
sp|Q9PLD0|MUTS_CHLMU DNA mismatch repair protein MutS OS=Chlamydia muridarum (strain MoPn / Nigg) GN=mutS PE=3 SV=1 186 1086 8.0E-84
sp|Q8NZ24|MUTS_STRP8 DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=mutS PE=3 SV=1 189 1091 1.0E-83
sp|A9GIM9|MUTS_SORC5 DNA mismatch repair protein MutS OS=Sorangium cellulosum (strain So ce56) GN=mutS PE=3 SV=1 195 1099 1.0E-83
sp|Q1H2P1|MUTS_METFK DNA mismatch repair protein MutS OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=mutS1 PE=3 SV=1 186 1087 2.0E-83
sp|B8J008|MUTS_DESDA DNA mismatch repair protein MutS OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=mutS PE=3 SV=1 186 1101 3.0E-83
sp|Q2LUL3|MUTS_SYNAS DNA mismatch repair protein MutS OS=Syntrophus aciditrophicus (strain SB) GN=mutS PE=3 SV=1 200 1086 4.0E-83
sp|Q01X96|MUTS_SOLUE DNA mismatch repair protein MutS OS=Solibacter usitatus (strain Ellin6076) GN=mutS PE=3 SV=1 200 1086 5.0E-83
sp|Q60BA1|MUTS_METCA DNA mismatch repair protein MutS OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=mutS PE=3 SV=1 187 1086 6.0E-83
sp|A0LG76|MUTS_SYNFM DNA mismatch repair protein MutS OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=mutS PE=3 SV=1 186 1086 9.0E-83
sp|Q0AYB5|MUTS_SYNWW DNA mismatch repair protein MutS OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=mutS PE=3 SV=1 184 1097 9.0E-83
sp|A2C5A9|MUTS_PROM1 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain NATL1A) GN=mutS PE=3 SV=1 202 1086 1.0E-82
sp|P61668|MUTS_LACJO DNA mismatch repair protein MutS OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=mutS PE=3 SV=1 187 1097 1.0E-82
sp|Q3IUH3|MUTS_NATPD DNA mismatch repair protein MutS OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=mutS PE=3 SV=1 180 1107 2.0E-82
sp|Q5E7G7|MUTS_VIBF1 DNA mismatch repair protein MutS OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=mutS PE=3 SV=2 186 1086 2.0E-82
sp|B5FAC8|MUTS_VIBFM DNA mismatch repair protein MutS OS=Vibrio fischeri (strain MJ11) GN=mutS PE=3 SV=1 186 1086 2.0E-82
sp|C0QFS1|MUTS_DESAH DNA mismatch repair protein MutS OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=mutS PE=3 SV=1 186 1088 2.0E-82
sp|B1N025|MUTS_LEUCK DNA mismatch repair protein MutS OS=Leuconostoc citreum (strain KM20) GN=mutS PE=3 SV=1 180 1086 2.0E-82
sp|Q5FLX5|MUTS_LACAC DNA mismatch repair protein MutS OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=mutS PE=3 SV=1 187 1094 3.0E-82
sp|Q03MY4|MUTS_STRTD DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=mutS PE=3 SV=1 189 1093 1.0E-81
sp|Q5M1Z0|MUTS_STRT1 DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain CNRZ 1066) GN=mutS PE=3 SV=1 189 1093 1.0E-81
sp|Q2SBR5|MUTS_HAHCH DNA mismatch repair protein MutS OS=Hahella chejuensis (strain KCTC 2396) GN=mutS PE=3 SV=2 183 1086 1.0E-81
sp|A8YTH9|MUTS_LACH4 DNA mismatch repair protein MutS OS=Lactobacillus helveticus (strain DPC 4571) GN=mutS PE=3 SV=1 187 1094 1.0E-81
sp|Q88UZ7|MUTS_LACPL DNA mismatch repair protein MutS OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=mutS PE=3 SV=1 187 1088 1.0E-81
sp|Q5M6I1|MUTS_STRT2 DNA mismatch repair protein MutS OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=mutS PE=3 SV=1 189 1093 1.0E-81
sp|Q1WT15|MUTS_LACS1 DNA mismatch repair protein MutS OS=Lactobacillus salivarius (strain UCC118) GN=mutS PE=3 SV=1 186 1094 1.0E-81
sp|Q1MRT4|MUTS_LAWIP DNA mismatch repair protein MutS OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=mutS PE=3 SV=1 186 1087 2.0E-81
sp|Q47DJ8|MUTS_DECAR DNA mismatch repair protein MutS OS=Dechloromonas aromatica (strain RCB) GN=mutS PE=3 SV=1 200 1086 3.0E-81
sp|Q2YB94|MUTS_NITMU DNA mismatch repair protein MutS OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=mutS PE=3 SV=1 187 1086 3.0E-81
sp|Q8CXG6|MUTS_OCEIH DNA mismatch repair protein MutS OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=mutS PE=3 SV=1 186 1097 6.0E-81
sp|Q13X51|MUTS_BURXL DNA mismatch repair protein MutS OS=Burkholderia xenovorans (strain LB400) GN=mutS PE=3 SV=2 187 1086 6.0E-81
sp|Q11YS6|MUTS_CYTH3 DNA mismatch repair protein MutS OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=mutS PE=3 SV=1 197 1086 6.0E-81
sp|Q7V9M5|MUTS_PROMA DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=mutS PE=3 SV=1 106 1091 6.0E-81
sp|Q3IDC8|MUTS_PSEHT DNA mismatch repair protein MutS OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=mutS PE=3 SV=1 186 1086 7.0E-81
sp|B2SXQ9|MUTS_BURPP DNA mismatch repair protein MutS OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=mutS PE=3 SV=1 186 1091 7.0E-81
sp|B6ENH6|MUTS_ALISL DNA mismatch repair protein MutS OS=Aliivibrio salmonicida (strain LFI1238) GN=mutS PE=3 SV=1 186 1086 9.0E-81
sp|A8F753|MUTS_PSELT DNA mismatch repair protein MutS OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=mutS PE=3 SV=1 186 1086 2.0E-80
sp|Q0IE05|MUTS_SYNS3 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9311) GN=mutS PE=3 SV=1 166 1086 2.0E-80
sp|Q1QZX5|MUTS_CHRSD DNA mismatch repair protein MutS OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=mutS PE=3 SV=1 187 1099 2.0E-80
sp|Q5QUB6|MUTS_IDILO DNA mismatch repair protein MutS OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=mutS PE=3 SV=2 187 1087 2.0E-80
sp|B9DW73|MUTS_STRU0 DNA mismatch repair protein MutS OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=mutS PE=3 SV=1 189 1086 2.0E-80
sp|B3EEE1|MUTS_CHLL2 DNA mismatch repair protein MutS OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=mutS PE=3 SV=1 188 1086 4.0E-80
sp|Q3AQZ8|MUTS_CHLCH DNA mismatch repair protein MutS OS=Chlorobium chlorochromatii (strain CaD3) GN=mutS PE=3 SV=1 187 1086 4.0E-80
sp|B3W9W4|MUTS_LACCB DNA mismatch repair protein MutS OS=Lactobacillus casei (strain BL23) GN=mutS PE=3 SV=1 186 1097 5.0E-80
sp|Q89AD3|MUTS_BUCBP DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=mutS PE=3 SV=1 186 1086 5.0E-80
sp|A1BHN5|MUTS_CHLPD DNA mismatch repair protein MutS OS=Chlorobium phaeobacteroides (strain DSM 266) GN=mutS PE=3 SV=1 182 1086 9.0E-80
sp|Q035Z2|MUTS_LACC3 DNA mismatch repair protein MutS OS=Lactobacillus casei (strain ATCC 334) GN=mutS PE=3 SV=1 186 1097 9.0E-80
sp|B2U9E4|MUTS_RALPJ DNA mismatch repair protein MutS OS=Ralstonia pickettii (strain 12J) GN=mutS PE=3 SV=1 168 1099 1.0E-79
sp|Q7UA23|MUTS_SYNPX DNA mismatch repair protein MutS OS=Synechococcus sp. (strain WH8102) GN=mutS PE=3 SV=1 167 1086 2.0E-79
sp|B0VAU7|MUTS_ACIBY DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AYE) GN=mutS PE=3 SV=1 186 1086 2.0E-79
sp|B2HX50|MUTS_ACIBC DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain ACICU) GN=mutS PE=3 SV=1 186 1086 2.0E-79
sp|B7IBV9|MUTS_ACIB5 DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AB0057) GN=mutS PE=3 SV=1 186 1086 2.0E-79
sp|B7GW85|MUTS_ACIB3 DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain AB307-0294) GN=mutS PE=3 SV=1 186 1086 2.0E-79
sp|B0VUC9|MUTS_ACIBS DNA mismatch repair protein MutS OS=Acinetobacter baumannii (strain SDF) GN=mutS PE=3 SV=1 186 1086 2.0E-79
sp|A7MJ43|MUTS_CROS8 DNA mismatch repair protein MutS OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=mutS PE=3 SV=1 186 1086 3.0E-79
sp|A5EX62|MUTS_DICNV DNA mismatch repair protein MutS OS=Dichelobacter nodosus (strain VCS1703A) GN=mutS PE=3 SV=1 186 1082 4.0E-79
sp|B8CJQ5|MUTS_SHEPW DNA mismatch repair protein MutS OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=mutS PE=3 SV=1 186 1086 5.0E-79
sp|B4F220|MUTS_PROMH DNA mismatch repair protein MutS OS=Proteus mirabilis (strain HI4320) GN=mutS PE=3 SV=1 175 1104 5.0E-79
sp|A7Z4X5|MUTS_BACMF DNA mismatch repair protein MutS OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=mutS PE=3 SV=1 186 1094 6.0E-79
sp|Q048Y4|MUTS_LACDB DNA mismatch repair protein MutS OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=mutS PE=3 SV=1 187 1095 6.0E-79
sp|Q15QR9|MUTS_PSEA6 DNA mismatch repair protein MutS OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=mutS PE=3 SV=1 186 1098 7.0E-79
sp|Q1G938|MUTS_LACDA DNA mismatch repair protein MutS OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=mutS PE=3 SV=1 187 1095 1.0E-78
sp|Q8PWA7|MUTS_METMA DNA mismatch repair protein MutS OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=mutS PE=3 SV=1 188 1086 2.0E-78
sp|A5UE20|MUTS_HAEIE DNA mismatch repair protein MutS OS=Haemophilus influenzae (strain PittEE) GN=mutS PE=3 SV=1 186 1087 3.0E-78
sp|A6VL76|MUTS_ACTSZ DNA mismatch repair protein MutS OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=mutS PE=3 SV=1 200 1091 3.0E-78
sp|Q4QML2|MUTS_HAEI8 DNA mismatch repair protein MutS OS=Haemophilus influenzae (strain 86-028NP) GN=mutS PE=3 SV=1 186 1087 3.0E-78
sp|P44834|MUTS_HAEIN DNA mismatch repair protein MutS OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=mutS PE=3 SV=1 186 1087 4.0E-78
sp|Q1LTQ0|MUTS_BAUCH DNA mismatch repair protein MutS OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=mutS PE=3 SV=1 173 1086 4.0E-78
sp|Q21LB1|MUTS_SACD2 DNA mismatch repair protein MutS OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=mutS PE=3 SV=1 187 1082 5.0E-78
sp|A7MTT8|MUTS_VIBCB DNA mismatch repair protein MutS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=mutS PE=3 SV=1 186 1087 6.0E-78
sp|Q7VKA1|MUTS_HAEDU DNA mismatch repair protein MutS OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=mutS PE=3 SV=1 186 1087 6.0E-78
sp|A8LPD4|MUTS_DINSH DNA mismatch repair protein MutS OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=mutS PE=3 SV=1 735 1103 9.0E-78
sp|Q31F87|MUTS_THICR DNA mismatch repair protein MutS OS=Thiomicrospira crunogena (strain XCL-2) GN=mutS PE=3 SV=1 186 1097 1.0E-77
sp|A1K764|MUTS_AZOSB DNA mismatch repair protein MutS OS=Azoarcus sp. (strain BH72) GN=mutS PE=3 SV=2 165 1088 2.0E-77
sp|B2S2S5|MUTS_TREPS DNA mismatch repair protein MutS OS=Treponema pallidum subsp. pallidum (strain SS14) GN=mutS PE=3 SV=1 186 1096 2.0E-77
sp|O83348|MUTS_TREPA DNA mismatch repair protein MutS OS=Treponema pallidum (strain Nichols) GN=mutS PE=3 SV=1 186 1096 2.0E-77
sp|A5W816|MUTS_PSEP1 DNA mismatch repair protein MutS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mutS PE=3 SV=1 187 1091 2.0E-77
sp|A1T004|MUTS_PSYIN DNA mismatch repair protein MutS OS=Psychromonas ingrahamii (strain 37) GN=mutS PE=3 SV=1 186 1086 2.0E-77
sp|B0TK13|MUTS_SHEHH DNA mismatch repair protein MutS OS=Shewanella halifaxensis (strain HAW-EB4) GN=mutS PE=3 SV=1 186 1103 2.0E-77
sp|B0KSD2|MUTS_PSEPG DNA mismatch repair protein MutS OS=Pseudomonas putida (strain GB-1) GN=mutS PE=3 SV=2 187 1091 2.0E-77
sp|Q88ME7|MUTS_PSEPK DNA mismatch repair protein MutS OS=Pseudomonas putida (strain KT2440) GN=mutS PE=3 SV=1 187 1091 3.0E-77
sp|A4VJN9|MUTS_PSEU5 DNA mismatch repair protein MutS OS=Pseudomonas stutzeri (strain A1501) GN=mutS PE=3 SV=2 174 1091 4.0E-77
sp|B5XV49|MUTS_KLEP3 DNA mismatch repair protein MutS OS=Klebsiella pneumoniae (strain 342) GN=mutS PE=3 SV=1 174 1086 9.0E-77
sp|A9M4L8|MUTS_NEIM0 DNA mismatch repair protein MutS OS=Neisseria meningitidis serogroup C (strain 053442) GN=mutS PE=3 SV=1 188 1086 1.0E-76
sp|A7HC64|MUTS_ANADF DNA mismatch repair protein MutS OS=Anaeromyxobacter sp. (strain Fw109-5) GN=mutS PE=3 SV=1 185 1086 2.0E-76
sp|A6TD24|MUTS_KLEP7 DNA mismatch repair protein MutS OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=mutS PE=3 SV=1 174 1086 2.0E-76
sp|Q87LQ9|MUTS_VIBPA DNA mismatch repair protein MutS OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=mutS PE=3 SV=1 186 1087 2.0E-76
sp|Q65QA9|MUTS_MANSM DNA mismatch repair protein MutS OS=Mannheimia succiniciproducens (strain MBEL55E) GN=mutS PE=3 SV=1 200 1091 2.0E-76
sp|A6LLR1|MUTS_THEM4 DNA mismatch repair protein MutS OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=mutS PE=3 SV=1 178 1086 4.0E-76
sp|B1JB25|MUTS_PSEPW DNA mismatch repair protein MutS OS=Pseudomonas putida (strain W619) GN=mutS PE=3 SV=1 187 1091 4.0E-76
sp|B1KPS7|MUTS_SHEWM DNA mismatch repair protein MutS OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=mutS PE=3 SV=1 186 1086 5.0E-76
sp|B2VG22|MUTS_ERWT9 DNA mismatch repair protein MutS OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=mutS PE=3 SV=1 176 1096 8.0E-76
sp|B1YMD7|MUTS_EXIS2 DNA mismatch repair protein MutS OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=mutS PE=3 SV=1 186 1087 1.0E-75
sp|Q03EQ7|MUTS_PEDPA DNA mismatch repair protein MutS OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=mutS PE=3 SV=1 186 1086 1.0E-75
sp|Q12PY3|MUTS_SHEDO DNA mismatch repair protein MutS OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=mutS PE=3 SV=1 186 1086 2.0E-75
sp|Q4KHE3|MUTS_PSEF5 DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mutS PE=3 SV=1 187 1091 2.0E-75
sp|A8H1T4|MUTS_SHEPA DNA mismatch repair protein MutS OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=mutS PE=3 SV=1 186 1086 8.0E-75
sp|Q8TTB4|MUTS_METAC DNA mismatch repair protein MutS OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=mutS PE=3 SV=1 188 1086 9.0E-75
sp|Q7N8K0|MUTS_PHOLL DNA mismatch repair protein MutS OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=mutS PE=3 SV=1 186 1086 9.0E-75
sp|A9MF43|MUTS_SALAR DNA mismatch repair protein MutS OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=mutS PE=3 SV=1 186 1086 2.0E-74
sp|B5FTQ5|MUTS_SALDC DNA mismatch repair protein MutS OS=Salmonella dublin (strain CT_02021853) GN=mutS PE=3 SV=1 186 1086 5.0E-74
sp|C0PWV2|MUTS_SALPC DNA mismatch repair protein MutS OS=Salmonella paratyphi C (strain RKS4594) GN=mutS PE=3 SV=1 186 1086 7.0E-74
sp|Q8UIF2|MUTS_AGRFC DNA mismatch repair protein MutS OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mutS PE=3 SV=1 653 1087 8.0E-74
sp|P0A1Y0|MUTS_SALTY DNA mismatch repair protein MutS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mutS PE=1 SV=1 186 1086 9.0E-74
sp|P0A1Y1|MUTS_SALTI DNA mismatch repair protein MutS OS=Salmonella typhi GN=mutS PE=3 SV=1 186 1086 9.0E-74
sp|A9N1F8|MUTS_SALPB DNA mismatch repair protein MutS OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=mutS PE=3 SV=2 186 1086 9.0E-74
sp|B4TFU6|MUTS_SALHS DNA mismatch repair protein MutS OS=Salmonella heidelberg (strain SL476) GN=mutS PE=3 SV=1 186 1086 9.0E-74
sp|B5RDN2|MUTS_SALG2 DNA mismatch repair protein MutS OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=mutS PE=3 SV=1 186 1086 9.0E-74
sp|Q57KL5|MUTS_SALCH DNA mismatch repair protein MutS OS=Salmonella choleraesuis (strain SC-B67) GN=mutS PE=3 SV=1 186 1086 9.0E-74
sp|B5F3Y8|MUTS_SALA4 DNA mismatch repair protein MutS OS=Salmonella agona (strain SL483) GN=mutS PE=3 SV=1 186 1086 9.0E-74
sp|B4TTU0|MUTS_SALSV DNA mismatch repair protein MutS OS=Salmonella schwarzengrund (strain CVM19633) GN=mutS PE=3 SV=1 186 1086 2.0E-73
sp|A3PNR5|MUTS_RHOS1 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mutS PE=3 SV=1 735 1097 3.0E-73
sp|A6V1G8|MUTS_PSEA7 DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain PA7) GN=mutS PE=3 SV=1 186 1091 3.0E-73
sp|A7HMG4|MUTS_FERNB DNA mismatch repair protein MutS OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=mutS PE=3 SV=1 186 1091 3.0E-73
sp|Q02R92|MUTS_PSEAB DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mutS PE=3 SV=1 186 1091 3.0E-73
sp|Q9HY08|MUTS_PSEAE DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mutS PE=3 SV=1 186 1091 3.0E-73
sp|B4T436|MUTS_SALNS DNA mismatch repair protein MutS OS=Salmonella newport (strain SL254) GN=mutS PE=3 SV=1 186 1086 4.0E-73
sp|Q9JX94|MUTS_NEIMB DNA mismatch repair protein MutS OS=Neisseria meningitidis serogroup B (strain MC58) GN=mutS PE=3 SV=1 188 1086 6.0E-73
sp|Q9ZIX6|MUTS_THECA DNA mismatch repair protein MutS OS=Thermus caldophilus GN=mutS PE=3 SV=1 181 1088 6.0E-73
sp|B7V8C8|MUTS_PSEA8 DNA mismatch repair protein MutS OS=Pseudomonas aeruginosa (strain LESB58) GN=mutS PE=3 SV=1 186 1091 9.0E-73
sp|Q9JWT7|MUTS_NEIMA DNA mismatch repair protein MutS OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=mutS PE=3 SV=1 188 1086 9.0E-73
sp|A6GWN3|MUTS_FLAPJ DNA mismatch repair protein MutS OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=mutS PE=3 SV=1 196 1086 1.0E-72
sp|A8I275|MUTS_AZOC5 DNA mismatch repair protein MutS OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mutS PE=3 SV=1 721 1087 2.0E-72
sp|A1KWM6|MUTS_NEIMF DNA mismatch repair protein MutS OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=mutS PE=3 SV=1 188 1086 2.0E-72
sp|Q3SVD4|MUTS_NITWN DNA mismatch repair protein MutS OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mutS PE=3 SV=1 722 1096 3.0E-72
sp|Q3IYI5|MUTS_RHOS4 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mutS PE=3 SV=1 735 1097 5.0E-72
sp|A8FST7|MUTS_SHESH DNA mismatch repair protein MutS OS=Shewanella sediminis (strain HAW-EB3) GN=mutS PE=3 SV=1 176 1086 5.0E-72
sp|B0TX99|MUTS_FRAP2 DNA mismatch repair protein MutS OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=mutS PE=3 SV=1 186 1091 7.0E-72
sp|A4IXL2|MUTS_FRATW DNA mismatch repair protein MutS OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=mutS PE=3 SV=1 186 1086 8.0E-72
sp|B2SEQ6|MUTS_FRATM DNA mismatch repair protein MutS OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=mutS PE=3 SV=1 186 1086 1.0E-71
sp|Q5NEV8|MUTS_FRATT DNA mismatch repair protein MutS OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=mutS PE=3 SV=1 186 1086 1.0E-71
sp|Q14GB1|MUTS_FRAT1 DNA mismatch repair protein MutS OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=mutS PE=3 SV=1 186 1086 1.0E-71
sp|A4WVX8|MUTS_RHOS5 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mutS PE=3 SV=1 735 1093 3.0E-71
sp|C0QPF0|MUTS_PERMH DNA mismatch repair protein MutS OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=mutS PE=3 SV=1 186 1086 3.0E-71
sp|Q2A5B5|MUTS_FRATH DNA mismatch repair protein MutS OS=Francisella tularensis subsp. holarctica (strain LVS) GN=mutS PE=3 SV=1 186 1086 4.0E-71
sp|A7N9Y6|MUTS_FRATF DNA mismatch repair protein MutS OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=mutS PE=3 SV=1 186 1086 4.0E-71
sp|Q11B27|MUTS_CHESB DNA mismatch repair protein MutS OS=Chelativorans sp. (strain BNC1) GN=mutS PE=3 SV=1 723 1103 4.0E-71
sp|A0KU91|MUTS_SHESA DNA mismatch repair protein MutS OS=Shewanella sp. (strain ANA-3) GN=mutS PE=3 SV=1 186 1106 1.0E-70
sp|Q5F5J4|MUTS_NEIG1 DNA mismatch repair protein MutS OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=mutS PE=3 SV=1 188 1086 2.0E-70
sp|A0Q809|MUTS_FRATN DNA mismatch repair protein MutS OS=Francisella tularensis subsp. novicida (strain U112) GN=mutS PE=3 SV=1 186 1086 2.0E-70
sp|Q8KCC0|MUTS_CHLTE DNA mismatch repair protein MutS OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mutS PE=3 SV=1 185 1086 5.0E-70
sp|A5ETJ3|MUTS_BRASB DNA mismatch repair protein MutS OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mutS PE=3 SV=1 722 1092 6.0E-70
sp|A4YKQ0|MUTS_BRASO DNA mismatch repair protein MutS OS=Bradyrhizobium sp. (strain ORS278) GN=mutS PE=3 SV=1 722 1092 8.0E-70
sp|Q0HL63|MUTS_SHESM DNA mismatch repair protein MutS OS=Shewanella sp. (strain MR-4) GN=mutS PE=3 SV=1 186 1106 8.0E-70
sp|Q1GCK9|MUTS_RUEST DNA mismatch repair protein MutS OS=Ruegeria sp. (strain TM1040) GN=mutS PE=3 SV=1 723 1086 9.0E-70
sp|B4RPP9|MUTS_NEIG2 DNA mismatch repair protein MutS OS=Neisseria gonorrhoeae (strain NCCP11945) GN=mutS PE=3 SV=1 188 1086 1.0E-69
sp|Q07V29|MUTS_RHOP5 DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisA53) GN=mutS PE=3 SV=1 722 1093 2.0E-69
sp|A1RHG2|MUTS_SHESW DNA mismatch repair protein MutS OS=Shewanella sp. (strain W3-18-1) GN=mutS PE=3 SV=1 186 1086 3.0E-69
sp|A4Y934|MUTS_SHEPC DNA mismatch repair protein MutS OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=mutS PE=3 SV=1 186 1086 3.0E-69
sp|Q045Q5|MUTS_LACGA DNA mismatch repair protein MutS OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=mutS PE=3 SV=1 187 1095 4.0E-69
sp|Q0HXG1|MUTS_SHESR DNA mismatch repair protein MutS OS=Shewanella sp. (strain MR-7) GN=mutS PE=3 SV=1 186 1106 6.0E-69
sp|Q2KD76|MUTS_RHIEC DNA mismatch repair protein MutS OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mutS PE=3 SV=1 735 1091 9.0E-69
sp|Q2J2S1|MUTS_RHOP2 DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain HaA2) GN=mutS PE=3 SV=1 722 1093 1.0E-68
sp|Q4FV41|MUTS_PSYA2 DNA mismatch repair protein MutS OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=mutS PE=3 SV=1 187 1094 1.0E-68
sp|Q28VY6|MUTS_JANSC DNA mismatch repair protein MutS OS=Jannaschia sp. (strain CCS1) GN=mutS PE=3 SV=1 684 1097 3.0E-68
sp|P56883|MUTS_RHIME DNA mismatch repair protein MutS OS=Rhizobium meliloti (strain 1021) GN=mutS PE=3 SV=1 649 1091 3.0E-68
sp|Q1QE46|MUTS_PSYCK DNA mismatch repair protein MutS OS=Psychrobacter cryohalolentis (strain K5) GN=mutS PE=3 SV=1 186 1094 4.0E-68
sp|Q18FJ9|MUTS_HALWD DNA mismatch repair protein MutS OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=mutS PE=3 SV=1 200 1086 1.0E-67
sp|Q5LWH0|MUTS_RUEPO DNA mismatch repair protein MutS OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=mutS PE=3 SV=1 723 1086 1.0E-67
sp|Q89VX1|MUTS_BRADU DNA mismatch repair protein MutS OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mutS PE=3 SV=1 722 1092 2.0E-67
sp|A9KYG1|MUTS_SHEB9 DNA mismatch repair protein MutS OS=Shewanella baltica (strain OS195) GN=mutS PE=3 SV=1 186 1086 6.0E-67
sp|Q1MMA5|MUTS_RHIL3 DNA mismatch repair protein MutS OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mutS PE=3 SV=1 735 1091 1.0E-66
sp|Q2N5V9|MUTS_ERYLH DNA mismatch repair protein MutS OS=Erythrobacter litoralis (strain HTCC2594) GN=mutS PE=3 SV=1 721 1086 7.0E-66
sp|A1S4E6|MUTS_SHEAM DNA mismatch repair protein MutS OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=mutS PE=3 SV=1 186 1086 1.0E-65
sp|Q051T9|MUTS_LEPBL DNA mismatch repair protein MutS OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=mutS PE=3 SV=1 178 1086 2.0E-65
sp|Q04RT2|MUTS_LEPBJ DNA mismatch repair protein MutS OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=mutS PE=3 SV=1 178 1086 2.0E-65
sp|B0S1C1|MUTS_FINM2 DNA mismatch repair protein MutS OS=Finegoldia magna (strain ATCC 29328) GN=mutS PE=3 SV=1 694 1086 8.0E-65
sp|Q5NL79|MUTS_ZYMMO DNA mismatch repair protein MutS OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=mutS PE=3 SV=2 722 1095 8.0E-65
sp|B3E6P2|MUTS_GEOLS DNA mismatch repair protein MutS OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mutS PE=3 SV=1 723 1093 1.0E-64
sp|A1TNU7|MUTS_ACIAC DNA mismatch repair protein MutS OS=Acidovorax citrulli (strain AAC00-1) GN=mutS PE=3 SV=1 186 1111 2.0E-64
sp|A5GQ22|MUTS_SYNR3 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain RCC307) GN=mutS PE=3 SV=1 438 1092 4.0E-64
sp|B8JA66|MUTS_ANAD2 DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=mutS PE=3 SV=1 721 1086 4.0E-64
sp|Q6G0X1|MUTS_BARQU DNA mismatch repair protein MutS OS=Bartonella quintana (strain Toulouse) GN=mutS PE=3 SV=1 723 1103 8.0E-64
sp|Q2IIJ3|MUTS_ANADE DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mutS PE=3 SV=1 723 1086 1.0E-63
sp|Q39VR6|MUTS_GEOMG DNA mismatch repair protein MutS OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mutS PE=3 SV=1 723 1086 5.0E-63
sp|A9VS13|MUTS_BACWK DNA mismatch repair protein MutS OS=Bacillus weihenstephanensis (strain KBAB4) GN=mutS PE=3 SV=1 723 1092 7.0E-63
sp|A7GR99|MUTS_BACCN DNA mismatch repair protein MutS OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mutS PE=3 SV=1 723 1092 7.0E-63
sp|Q0C5G6|MUTS_HYPNA DNA mismatch repair protein MutS OS=Hyphomonas neptunium (strain ATCC 15444) GN=mutS PE=3 SV=1 723 1086 1.0E-62
sp|B4UCY7|MUTS_ANASK DNA mismatch repair protein MutS OS=Anaeromyxobacter sp. (strain K) GN=mutS PE=3 SV=1 682 1086 1.0E-62
sp|Q3ANH5|MUTS_SYNSC DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9605) GN=mutS PE=3 SV=1 474 1086 1.0E-62
sp|Q16D05|MUTS_ROSDO DNA mismatch repair protein MutS OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=mutS PE=3 SV=1 716 1086 2.0E-62
sp|Q1IN52|MUTS_KORVE DNA mismatch repair protein MutS OS=Koribacter versatilis (strain Ellin345) GN=mutS PE=3 SV=1 723 1103 3.0E-62
sp|B7HDP4|MUTS_BACC4 DNA mismatch repair protein MutS OS=Bacillus cereus (strain B4264) GN=mutS PE=3 SV=1 723 1092 1.0E-61
sp|B7ITM1|MUTS_BACC2 DNA mismatch repair protein MutS OS=Bacillus cereus (strain G9842) GN=mutS PE=3 SV=1 723 1092 1.0E-61
sp|Q0BV38|MUTS_GRABC DNA mismatch repair protein MutS OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=mutS PE=3 SV=1 708 1088 2.0E-61
sp|B9IV59|MUTS_BACCQ DNA mismatch repair protein MutS OS=Bacillus cereus (strain Q1) GN=mutS PE=3 SV=1 723 1092 3.0E-61
sp|P61665|MUTS_BACC1 DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mutS PE=3 SV=1 723 1092 3.0E-61
sp|B5YJY3|MUTS_THEYD DNA mismatch repair protein MutS OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mutS PE=3 SV=1 694 1091 4.0E-61
sp|Q81WR3|MUTS_BACAN DNA mismatch repair protein MutS OS=Bacillus anthracis GN=mutS PE=3 SV=1 723 1092 5.0E-61
sp|C3L822|MUTS_BACAC DNA mismatch repair protein MutS OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mutS PE=3 SV=1 723 1092 5.0E-61
sp|C3P5H5|MUTS_BACAA DNA mismatch repair protein MutS OS=Bacillus anthracis (strain A0248) GN=mutS PE=3 SV=1 723 1092 5.0E-61
sp|A0RHE1|MUTS_BACAH DNA mismatch repair protein MutS OS=Bacillus thuringiensis (strain Al Hakam) GN=mutS PE=3 SV=1 723 1092 6.0E-61
sp|C1ENZ3|MUTS_BACC3 DNA mismatch repair protein MutS OS=Bacillus cereus (strain 03BB102) GN=mutS PE=3 SV=1 723 1092 6.0E-61
sp|Q6HF46|MUTS_BACHK DNA mismatch repair protein MutS OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mutS PE=3 SV=1 723 1092 6.0E-61
sp|B7JJ47|MUTS_BACC0 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH820) GN=mutS PE=3 SV=1 723 1092 7.0E-61
sp|Q2WAN4|MUTS_MAGSA DNA mismatch repair protein MutS OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mutS PE=3 SV=2 723 1086 7.0E-61
sp|B7HLA3|MUTS_BACC7 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH187) GN=mutS PE=3 SV=1 723 1092 7.0E-61
sp|Q636Q7|MUTS_BACCZ DNA mismatch repair protein MutS OS=Bacillus cereus (strain ZK / E33L) GN=mutS PE=3 SV=1 723 1092 8.0E-61
sp|Q81A25|MUTS_BACCR DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mutS PE=3 SV=1 723 1092 4.0E-60
sp|A6LWJ5|MUTS_CLOB8 DNA mismatch repair protein MutS OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=mutS PE=3 SV=1 722 1095 7.0E-60
sp|Q87CI8|MUTS_XYLFT DNA mismatch repair protein MutS OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mutS PE=3 SV=1 723 1094 2.0E-59
sp|Q2JIA6|MUTS_SYNJB DNA mismatch repair protein MutS OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=mutS PE=3 SV=1 693 1086 5.0E-59
sp|A5G447|MUTS_GEOUR DNA mismatch repair protein MutS OS=Geobacter uraniireducens (strain Rf4) GN=mutS PE=3 SV=1 723 1098 6.0E-59
sp|B2TIC3|MUTS_CLOBB DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=mutS PE=3 SV=1 722 1092 1.0E-58
sp|Q7NLT8|MUTS_GLOVI DNA mismatch repair protein MutS OS=Gloeobacter violaceus (strain PCC 7421) GN=mutS PE=3 SV=1 693 1086 2.0E-58
sp|B2V1M2|MUTS_CLOBA DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=mutS PE=3 SV=1 722 1086 3.0E-58
sp|Q3ACA5|MUTS_CARHZ DNA mismatch repair protein MutS OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mutS PE=3 SV=1 724 1094 4.0E-58
sp|Q2RJG2|MUTS_MOOTA DNA mismatch repair protein MutS OS=Moorella thermoacetica (strain ATCC 39073) GN=mutS PE=3 SV=1 718 1086 4.0E-58
sp|Q473E4|MUTS_CUPPJ DNA mismatch repair protein MutS OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mutS PE=3 SV=2 723 1086 5.0E-58
sp|Q82U08|MUTS_NITEU DNA mismatch repair protein MutS OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=mutS PE=3 SV=1 723 1097 6.0E-58
sp|P61671|MUTS_THET2 DNA mismatch repair protein MutS OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=mutS PE=3 SV=1 723 1088 1.0E-57
sp|Q56239|MUTS_THET8 DNA mismatch repair protein MutS OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mutS PE=1 SV=3 723 1088 1.0E-57
sp|Q2SXA6|MUTS_BURTA DNA mismatch repair protein MutS OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=mutS PE=3 SV=1 723 1091 1.0E-57
sp|C5BMR5|MUTS_TERTT DNA mismatch repair protein MutS OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=mutS PE=3 SV=1 723 1086 2.0E-57
sp|Q0AEI7|MUTS_NITEC DNA mismatch repair protein MutS OS=Nitrosomonas eutropha (strain C91) GN=mutS PE=3 SV=1 723 1097 2.0E-57
sp|Q2JT35|MUTS_SYNJA DNA mismatch repair protein MutS OS=Synechococcus sp. (strain JA-3-3Ab) GN=mutS PE=3 SV=1 693 1086 7.0E-57
sp|A3NB64|MUTS_BURP6 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 668) GN=mutS PE=3 SV=1 723 1091 7.0E-57
sp|Q0KCC0|MUTS_CUPNH DNA mismatch repair protein MutS OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=mutS PE=3 SV=1 723 1086 7.0E-57
sp|Q3Z767|MUTS_DEHM1 DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mutS PE=3 SV=1 694 1087 7.0E-57
sp|Q4US90|MUTS_XANC8 DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mutS PE=3 SV=2 723 1109 7.0E-57
sp|Q63SR9|MUTS_BURPS DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain K96243) GN=mutS PE=3 SV=1 723 1091 8.0E-57
sp|Q8PBB5|MUTS_XANCP DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mutS PE=3 SV=1 723 1109 9.0E-57
sp|A1V5I2|MUTS_BURMS DNA mismatch repair protein MutS OS=Burkholderia mallei (strain SAVP1) GN=mutS PE=3 SV=2 723 1091 9.0E-57
sp|Q62J26|MUTS_BURMA DNA mismatch repair protein MutS OS=Burkholderia mallei (strain ATCC 23344) GN=mutS PE=3 SV=1 723 1091 9.0E-57
sp|A2SAW7|MUTS_BURM9 DNA mismatch repair protein MutS OS=Burkholderia mallei (strain NCTC 10229) GN=mutS PE=3 SV=2 723 1091 9.0E-57
sp|A3ML57|MUTS_BURM7 DNA mismatch repair protein MutS OS=Burkholderia mallei (strain NCTC 10247) GN=mutS PE=3 SV=2 723 1091 9.0E-57
sp|A3NWZ4|MUTS_BURP0 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 1106a) GN=mutS PE=3 SV=2 723 1086 9.0E-57
sp|C0ZEZ4|MUTS_BREBN DNA mismatch repair protein MutS OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=mutS PE=3 SV=1 723 1100 1.0E-56
sp|Q3JQS6|MUTS_BURP1 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 1710b) GN=mutS PE=3 SV=2 723 1091 2.0E-56
sp|Q8PMX2|MUTS_XANAC DNA mismatch repair protein MutS OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mutS PE=3 SV=1 723 1109 2.0E-56
sp|B1YSP3|MUTS_BURA4 DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain MC40-6) GN=mutS PE=3 SV=1 723 1086 2.0E-56
sp|Q0BDU3|MUTS_BURCM DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mutS PE=3 SV=1 723 1086 3.0E-56
sp|Q3BVY0|MUTS_XANC5 DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mutS PE=3 SV=1 723 1109 5.0E-56
sp|A4JFW7|MUTS_BURVG DNA mismatch repair protein MutS OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mutS PE=3 SV=1 723 1086 8.0E-56
sp|Q7V978|MUTS_PROMM DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9313) GN=mutS PE=3 SV=1 674 1096 8.0E-56
sp|Q1BHQ1|MUTS_BURCA DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain AU 1054) GN=mutS PE=3 SV=1 723 1097 9.0E-56
sp|B9DPB9|MUTS_STACT DNA mismatch repair protein MutS OS=Staphylococcus carnosus (strain TM300) GN=mutS PE=3 SV=1 723 1093 1.0E-55
sp|A4XL47|MUTS_CALS8 DNA mismatch repair protein MutS OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mutS PE=3 SV=1 724 1093 1.0E-55
sp|C6DZZ3|MUTS_GEOSM DNA mismatch repair protein MutS OS=Geobacter sp. (strain M21) GN=mutS PE=3 SV=1 723 1098 2.0E-55
sp|Q895H2|MUTS_CLOTE DNA mismatch repair protein MutS OS=Clostridium tetani (strain Massachusetts / E88) GN=mutS PE=3 SV=1 610 1088 2.0E-55
sp|Q6FC54|MUTS_ACIAD DNA mismatch repair protein MutS OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mutS PE=3 SV=1 723 1086 2.0E-55
sp|Q5H2C5|MUTS_XANOR DNA mismatch repair protein MutS OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mutS PE=3 SV=1 723 1109 3.0E-55
sp|Q3ZYA0|MUTS_DEHMC DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain CBDB1) GN=mutS PE=3 SV=1 682 1087 3.0E-55
sp|Q82ZA2|MUTS_ENTFA DNA mismatch repair protein MutS OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=mutS PE=3 SV=1 723 1088 3.0E-55
sp|Q30ZX3|MUTS_DESAG DNA mismatch repair protein MutS OS=Desulfovibrio alaskensis (strain G20) GN=mutS PE=3 SV=1 781 1105 4.0E-55
sp|Q3B0S2|MUTS_SYNS9 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9902) GN=mutS PE=3 SV=1 714 1086 7.0E-55
sp|Q255T1|MUTS_CHLFF DNA mismatch repair protein MutS OS=Chlamydophila felis (strain Fe/C-56) GN=mutS PE=3 SV=1 724 1097 7.0E-55
sp|A2C5T5|MUTS_PROM3 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9303) GN=mutS PE=3 SV=1 674 1096 1.0E-54
sp|A4J5Q6|MUTS_DESRM DNA mismatch repair protein MutS OS=Desulfotomaculum reducens (strain MI-1) GN=mutS PE=3 SV=1 621 1086 1.0E-54
sp|B9LB04|MUTS_CHLSY DNA mismatch repair protein MutS OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=mutS PE=3 SV=1 723 1092 1.0E-54
sp|A9WFZ9|MUTS_CHLAA DNA mismatch repair protein MutS OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mutS PE=3 SV=1 723 1092 1.0E-54
sp|A6SXI2|MUTS_JANMA DNA mismatch repair protein MutS OS=Janthinobacterium sp. (strain Marseille) GN=mutS PE=3 SV=1 723 1093 1.0E-54
sp|P65494|MUTS_STAAW DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MW2) GN=mutS PE=3 SV=1 723 1099 2.0E-54
sp|P0C1S1|MUTS_STAAU DNA mismatch repair protein MutS OS=Staphylococcus aureus GN=mutS PE=3 SV=1 723 1099 2.0E-54
sp|A8Z1W6|MUTS_STAAT DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mutS PE=3 SV=1 723 1099 2.0E-54
sp|Q6G9R8|MUTS_STAAS DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MSSA476) GN=mutS PE=3 SV=1 723 1099 2.0E-54
sp|P65493|MUTS_STAAN DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain N315) GN=mutS PE=3 SV=1 723 1099 2.0E-54
sp|Q931S8|MUTS_STAAM DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mutS PE=3 SV=2 723 1099 2.0E-54
sp|A6QGJ4|MUTS_STAAE DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Newman) GN=mutS PE=3 SV=1 723 1099 2.0E-54
sp|Q5HGD6|MUTS_STAAC DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain COL) GN=mutS PE=3 SV=1 723 1099 2.0E-54
sp|A5ISH9|MUTS_STAA9 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH9) GN=mutS PE=3 SV=1 723 1099 2.0E-54
sp|A6U1B4|MUTS_STAA2 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH1) GN=mutS PE=3 SV=1 723 1099 2.0E-54
sp|A7X1T6|MUTS_STAA1 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mutS PE=3 SV=1 723 1099 2.0E-54
sp|Q2FYZ9|MUTS_STAA8 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain NCTC 8325) GN=mutS PE=3 SV=2 723 1099 2.0E-54
sp|C5D9H5|MUTS_GEOSW DNA mismatch repair protein MutS OS=Geobacillus sp. (strain WCH70) GN=mutS PE=3 SV=1 723 1091 2.0E-54
sp|Q0VNJ1|MUTS_ALCBS DNA mismatch repair protein MutS OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mutS PE=3 SV=1 723 1082 2.0E-54
sp|Q49X88|MUTS_STAS1 DNA mismatch repair protein MutS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mutS PE=3 SV=1 723 1102 2.0E-54
sp|Q6GHE0|MUTS_STAAR DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MRSA252) GN=mutS PE=3 SV=1 723 1099 3.0E-54
sp|A8FDH3|MUTS_BACP2 DNA mismatch repair protein MutS OS=Bacillus pumilus (strain SAFR-032) GN=mutS PE=3 SV=1 723 1087 3.0E-54
sp|B3EP11|MUTS_CHLPB DNA mismatch repair protein MutS OS=Chlorobium phaeobacteroides (strain BS1) GN=mutS PE=3 SV=1 728 1087 3.0E-54
sp|Q7VY01|MUTS_BORPE DNA mismatch repair protein MutS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mutS PE=3 SV=1 723 1095 4.0E-54
sp|Q7W880|MUTS_BORPA DNA mismatch repair protein MutS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mutS PE=3 SV=2 723 1095 5.0E-54
sp|Q7WLT5|MUTS_BORBR DNA mismatch repair protein MutS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mutS PE=3 SV=2 723 1095 6.0E-54
sp|Q2YXR9|MUTS_STAAB DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mutS PE=3 SV=1 723 1087 6.0E-54
sp|C1L2V9|MUTS_LISMC DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=mutS PE=3 SV=1 723 1093 7.0E-54
sp|A0L7L5|MUTS_MAGMM DNA mismatch repair protein MutS OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mutS PE=3 SV=1 721 1086 7.0E-54
sp|A1VDD9|MUTS_DESVV DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mutS PE=3 SV=1 734 1105 7.0E-54
sp|P61666|MUTS_DESVH DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mutS PE=3 SV=1 734 1105 7.0E-54
sp|Q5L554|MUTS_CHLAB DNA mismatch repair protein MutS OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=mutS PE=3 SV=1 724 1092 7.0E-54
sp|Q8CPF0|MUTS_STAES DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mutS PE=3 SV=1 723 1088 8.0E-54
sp|Q5HPP5|MUTS_STAEQ DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mutS PE=3 SV=1 723 1088 8.0E-54
sp|B9K800|MUTS_THENN DNA mismatch repair protein MutS OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=mutS PE=3 SV=1 594 1101 8.0E-54
sp|B8D9K7|MUTS_BUCA5 DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=mutS PE=3 SV=1 723 1086 8.0E-54
sp|P57504|MUTS_BUCAI DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mutS PE=3 SV=1 723 1086 9.0E-54
sp|B8D7V9|MUTS_BUCAT DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=mutS PE=3 SV=1 723 1086 9.0E-54
sp|A4G717|MUTS_HERAR DNA mismatch repair protein MutS OS=Herminiimonas arsenicoxydans GN=mutS PE=3 SV=3 723 1093 9.0E-54
sp|A3CR17|MUTS_STRSV DNA mismatch repair protein MutS OS=Streptococcus sanguinis (strain SK36) GN=mutS PE=3 SV=1 723 1095 1.0E-53
sp|Q5WFY3|MUTS_BACSK DNA mismatch repair protein MutS OS=Bacillus clausii (strain KSM-K16) GN=mutS PE=3 SV=1 723 1087 1.0E-53
sp|O65607|MSH3_ARATH DNA mismatch repair protein MSH3 OS=Arabidopsis thaliana GN=MSH3 PE=1 SV=2 476 1097 1.0E-53
sp|P26359|MSH3_SCHPO DNA mismatch repair protein msh3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=msh3 PE=3 SV=1 242 1085 1.0E-53
sp|P25847|MSH2_YEAST DNA mismatch repair protein MSH2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSH2 PE=1 SV=2 500 1084 2.0E-53
sp|Q03VV4|MUTS_LEUMM DNA mismatch repair protein MutS OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=mutS PE=3 SV=1 723 1087 2.0E-53
sp|Q3SJP0|MUTS_THIDA DNA mismatch repair protein MutS OS=Thiobacillus denitrificans (strain ATCC 25259) GN=mutS PE=3 SV=1 723 1086 2.0E-53
sp|A9BJY3|MUTS_PETMO DNA mismatch repair protein MutS OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mutS PE=3 SV=1 697 1087 3.0E-53
sp|Q0A8K3|MUTS_ALKEH DNA mismatch repair protein MutS OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mutS PE=3 SV=1 723 1088 3.0E-53
sp|A5ILG0|MUTS_THEP1 DNA mismatch repair protein MutS OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=mutS PE=3 SV=1 594 1098 3.0E-53
sp|Q71ZR7|MUTS_LISMF DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mutS PE=3 SV=1 723 1093 3.0E-53
sp|Q8Y789|MUTS_LISMO DNA mismatch repair protein MutS OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mutS PE=3 SV=1 723 1093 4.0E-53
sp|Q3JCL5|MUTS_NITOC DNA mismatch repair protein MutS OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mutS PE=3 SV=1 723 1086 5.0E-53
sp|B8DFS4|MUTS_LISMH DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=mutS PE=3 SV=1 723 1093 5.0E-53
sp|P20585|MSH3_HUMAN DNA mismatch repair protein Msh3 OS=Homo sapiens GN=MSH3 PE=1 SV=4 468 1082 5.0E-53
sp|Q56215|MUTS_THEAQ DNA mismatch repair protein MutS OS=Thermus aquaticus GN=mutS PE=1 SV=1 734 1088 5.0E-53
sp|Q9PCR2|MUTS_XYLFA DNA mismatch repair protein MutS OS=Xylella fastidiosa (strain 9a5c) GN=mutS PE=3 SV=2 723 1067 6.0E-53
sp|Q821V6|MUTS_CHLCV DNA mismatch repair protein MutS OS=Chlamydophila caviae (strain GPIC) GN=mutS PE=3 SV=1 791 1092 6.0E-53
sp|A9KG24|MUTS_COXBN DNA mismatch repair protein MutS OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mutS PE=3 SV=1 723 1086 7.0E-53
sp|A5FQC0|MUTS_DEHMB DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=mutS PE=3 SV=1 682 1087 7.0E-53
sp|Q03R33|MUTS_LACBA DNA mismatch repair protein MutS OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mutS PE=3 SV=1 723 1087 8.0E-53
sp|Q92BV3|MUTS_LISIN DNA mismatch repair protein MutS OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mutS PE=3 SV=1 723 1086 9.0E-53
sp|B2GB17|MUTS_LACF3 DNA mismatch repair protein MutS OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=mutS PE=3 SV=1 735 1092 1.0E-52
sp|O66652|MUTS_AQUAE DNA mismatch repair protein MutS OS=Aquifex aeolicus (strain VF5) GN=mutS PE=3 SV=1 724 1086 1.0E-52
sp|Q83CQ2|MUTS_COXBU DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mutS PE=3 SV=1 723 1086 1.0E-52
sp|A9NCN3|MUTS_COXBR DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mutS PE=3 SV=1 723 1086 1.0E-52
sp|C3KCT2|MUTS_PSEFS DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain SBW25) GN=mutS PE=3 SV=1 612 1091 2.0E-52
sp|Q5NYP9|MUTS_AROAE DNA mismatch repair protein MutS OS=Aromatoleum aromaticum (strain EbN1) GN=mutS PE=3 SV=1 697 1088 2.0E-52
sp|A0AIK5|MUTS_LISW6 DNA mismatch repair protein MutS OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mutS PE=3 SV=1 723 1086 2.0E-52
sp|Q1DQ73|MSH3_COCIM DNA mismatch repair protein MSH3 OS=Coccidioides immitis (strain RS) GN=MSH3 PE=3 SV=2 762 1110 4.0E-52
sp|Q65ZX6|MUTS_BORBP DNA mismatch repair protein MutS OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=mutS PE=3 SV=1 762 1096 4.0E-52
sp|B2JIT0|MUTS_BURP8 DNA mismatch repair protein MutS OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=mutS PE=3 SV=1 723 1086 5.0E-52
sp|B4ED83|MUTS_BURCJ DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=mutS PE=3 SV=1 723 1097 6.0E-52
sp|Q1ZXH0|MSH3_DICDI DNA mismatch repair protein Msh3 OS=Dictyostelium discoideum GN=msh3 PE=3 SV=1 181 1082 6.0E-52
sp|B7J0P3|MUTS_BORBZ DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ZS7) GN=mutS PE=3 SV=1 762 1096 7.0E-52
sp|O51737|MUTS_BORBU DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=mutS PE=3 SV=1 762 1096 7.0E-52
sp|Q8DGS4|MUTS_THEEB DNA mismatch repair protein MutS OS=Thermosynechococcus elongatus (strain BP-1) GN=mutS PE=3 SV=1 693 1087 8.0E-52
sp|Q5ZUJ3|MUTS_LEGPH DNA mismatch repair protein MutS OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mutS PE=3 SV=2 619 1086 9.0E-52
sp|A5ICW2|MUTS_LEGPC DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Corby) GN=mutS PE=3 SV=2 619 1086 9.0E-52
sp|Q0SM54|MUTS_BORAP DNA mismatch repair protein MutS OS=Borrelia afzelii (strain PKo) GN=mutS PE=3 SV=1 769 1088 1.0E-51
sp|Q0UXL8|MSH3_PHANO DNA mismatch repair protein MSH3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MSH3 PE=3 SV=3 764 1095 2.0E-51
sp|Q39EX8|MUTS_BURL3 DNA mismatch repair protein MutS OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=mutS PE=3 SV=1 723 1097 2.0E-51
sp|A1U2E8|MUTS_MARHV DNA mismatch repair protein MutS OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mutS PE=3 SV=1 723 1092 2.0E-51
sp|A0K8L2|MUTS_BURCH DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain HI2424) GN=mutS PE=3 SV=1 723 1097 3.0E-51
sp|B1JUW8|MUTS_BURCC DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain MC0-3) GN=mutS PE=3 SV=1 723 1097 3.0E-51
sp|Q5X4B2|MUTS_LEGPA DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Paris) GN=mutS PE=3 SV=1 619 1086 3.0E-51
sp|C1DSR1|MUTS_AZOVD DNA mismatch repair protein MutS OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mutS PE=3 SV=1 723 1092 3.0E-51
sp|P27345|MUTS_AZOVI DNA mismatch repair protein MutS OS=Azotobacter vinelandii GN=mutS PE=3 SV=1 723 1092 3.0E-51
sp|A5FJ63|MUTS_FLAJ1 DNA mismatch repair protein MutS OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=mutS PE=3 SV=2 723 1096 5.0E-51
sp|B1LAW3|MUTS_THESQ DNA mismatch repair protein MutS OS=Thermotoga sp. (strain RQ2) GN=mutS PE=3 SV=1 594 1098 5.0E-51
sp|A5D2K2|MUTS_PELTS DNA mismatch repair protein MutS OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mutS PE=3 SV=1 722 1086 6.0E-51
sp|P49849|MUTS_BACSU DNA mismatch repair protein MutS OS=Bacillus subtilis (strain 168) GN=mutS PE=3 SV=3 627 1095 8.0E-51
sp|A6R7S1|MSH3_AJECN DNA mismatch repair protein MSH3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MSH3 PE=3 SV=2 762 1091 8.0E-51
sp|Q5WVP6|MUTS_LEGPL DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Lens) GN=mutS PE=3 SV=1 619 1086 9.0E-51
sp|A6KZM1|MUTS_BACV8 DNA mismatch repair protein MutS OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=mutS PE=3 SV=1 734 1098 1.0E-50
sp|B1JJF1|MUTS_YERPY DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mutS PE=3 SV=1 717 1086 1.0E-50
sp|Q66EB5|MUTS_YERPS DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mutS PE=3 SV=1 717 1086 2.0E-50
sp|B2K584|MUTS_YERPB DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mutS PE=3 SV=1 717 1086 2.0E-50
sp|A7FLX1|MUTS_YERP3 DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mutS PE=3 SV=1 717 1086 2.0E-50
sp|O04716|MSH6_ARATH DNA mismatch repair protein MSH6 OS=Arabidopsis thaliana GN=MSH6 PE=1 SV=2 190 1082 2.0E-50
sp|Q87XW6|MUTS_PSESM DNA mismatch repair protein MutS OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mutS PE=3 SV=1 612 1091 2.0E-50
sp|Q9Z6W5|MUTS_CHLPN DNA mismatch repair protein MutS OS=Chlamydia pneumoniae GN=mutS PE=3 SV=2 724 1092 2.0E-50
sp|C5BGI4|MUTS_EDWI9 DNA mismatch repair protein MutS OS=Edwardsiella ictaluri (strain 93-146) GN=mutS PE=3 SV=1 723 1086 2.0E-50
sp|Q3KH79|MUTS_PSEPF DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain Pf0-1) GN=mutS PE=3 SV=1 723 1091 2.0E-50
sp|Q1J489|MUTS_STRPF DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=mutS PE=3 SV=1 723 1102 2.0E-50
sp|A8ANU8|MUTS_CITK8 DNA mismatch repair protein MutS OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mutS PE=3 SV=1 697 1086 2.0E-50
sp|Q895H2|MUTS_CLOTE DNA mismatch repair protein MutS OS=Clostridium tetani (strain Massachusetts / E88) GN=mutS PE=3 SV=1 186 609 1.0E-37
sp|Q07V29|MUTS_RHOP5 DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain BisA53) GN=mutS PE=3 SV=1 188 581 2.0E-37
sp|Q16D05|MUTS_ROSDO DNA mismatch repair protein MutS OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=mutS PE=3 SV=1 186 620 6.0E-37
sp|Q8UIF2|MUTS_AGRFC DNA mismatch repair protein MutS OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=mutS PE=3 SV=1 202 595 7.0E-37
sp|Q6G0X1|MUTS_BARQU DNA mismatch repair protein MutS OS=Bartonella quintana (strain Toulouse) GN=mutS PE=3 SV=1 186 581 1.0E-36
sp|Q11B27|MUTS_CHESB DNA mismatch repair protein MutS OS=Chelativorans sp. (strain BNC1) GN=mutS PE=3 SV=1 188 578 2.0E-36
sp|Q2KD76|MUTS_RHIEC DNA mismatch repair protein MutS OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=mutS PE=3 SV=1 200 595 4.0E-36
sp|Q2J2S1|MUTS_RHOP2 DNA mismatch repair protein MutS OS=Rhodopseudomonas palustris (strain HaA2) GN=mutS PE=3 SV=1 188 604 4.0E-36
sp|Q1GCK9|MUTS_RUEST DNA mismatch repair protein MutS OS=Ruegeria sp. (strain TM1040) GN=mutS PE=3 SV=1 187 591 1.0E-35
sp|Q2WAN4|MUTS_MAGSA DNA mismatch repair protein MutS OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=mutS PE=3 SV=2 182 615 1.0E-35
sp|Q89VX1|MUTS_BRADU DNA mismatch repair protein MutS OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=mutS PE=3 SV=1 164 604 7.0E-35
sp|Q8CPF0|MUTS_STAES DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 12228) GN=mutS PE=3 SV=1 186 615 7.0E-35
sp|Q5HPP5|MUTS_STAEQ DNA mismatch repair protein MutS OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=mutS PE=3 SV=1 186 615 7.0E-35
sp|A5ETJ3|MUTS_BRASB DNA mismatch repair protein MutS OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=mutS PE=3 SV=1 163 604 1.0E-34
sp|Q8DGS4|MUTS_THEEB DNA mismatch repair protein MutS OS=Thermosynechococcus elongatus (strain BP-1) GN=mutS PE=3 SV=1 186 602 3.0E-34
sp|Q0BV38|MUTS_GRABC DNA mismatch repair protein MutS OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=mutS PE=3 SV=1 182 596 4.0E-34
sp|A4YKQ0|MUTS_BRASO DNA mismatch repair protein MutS OS=Bradyrhizobium sp. (strain ORS278) GN=mutS PE=3 SV=1 164 604 5.0E-34
sp|A0L7L5|MUTS_MAGMM DNA mismatch repair protein MutS OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=mutS PE=3 SV=1 180 597 1.0E-33
sp|C6DZZ3|MUTS_GEOSM DNA mismatch repair protein MutS OS=Geobacter sp. (strain M21) GN=mutS PE=3 SV=1 200 585 2.0E-33
sp|P65494|MUTS_STAAW DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MW2) GN=mutS PE=3 SV=1 186 625 5.0E-33
sp|P0C1S1|MUTS_STAAU DNA mismatch repair protein MutS OS=Staphylococcus aureus GN=mutS PE=3 SV=1 186 625 5.0E-33
sp|A8Z1W6|MUTS_STAAT DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=mutS PE=3 SV=1 186 625 5.0E-33
sp|Q6G9R8|MUTS_STAAS DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MSSA476) GN=mutS PE=3 SV=1 186 625 5.0E-33
sp|P65493|MUTS_STAAN DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain N315) GN=mutS PE=3 SV=1 186 625 5.0E-33
sp|Q931S8|MUTS_STAAM DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=mutS PE=3 SV=2 186 625 5.0E-33
sp|A6QGJ4|MUTS_STAAE DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Newman) GN=mutS PE=3 SV=1 186 625 5.0E-33
sp|Q5HGD6|MUTS_STAAC DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain COL) GN=mutS PE=3 SV=1 186 625 5.0E-33
sp|A5ISH9|MUTS_STAA9 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH9) GN=mutS PE=3 SV=1 186 625 5.0E-33
sp|A6U1B4|MUTS_STAA2 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain JH1) GN=mutS PE=3 SV=1 186 625 5.0E-33
sp|A7X1T6|MUTS_STAA1 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=mutS PE=3 SV=1 186 625 5.0E-33
sp|Q2FYZ9|MUTS_STAA8 DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain NCTC 8325) GN=mutS PE=3 SV=2 186 625 5.0E-33
sp|Q6GHE0|MUTS_STAAR DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain MRSA252) GN=mutS PE=3 SV=1 186 625 9.0E-33
sp|Q2N5V9|MUTS_ERYLH DNA mismatch repair protein MutS OS=Erythrobacter litoralis (strain HTCC2594) GN=mutS PE=3 SV=1 199 578 1.0E-32
sp|Q2YXR9|MUTS_STAAB DNA mismatch repair protein MutS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=mutS PE=3 SV=1 186 625 1.0E-32
sp|A6KZM1|MUTS_BACV8 DNA mismatch repair protein MutS OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=mutS PE=3 SV=1 187 591 2.0E-32
sp|B9DPB9|MUTS_STACT DNA mismatch repair protein MutS OS=Staphylococcus carnosus (strain TM300) GN=mutS PE=3 SV=1 186 621 3.0E-32
sp|A4J5Q6|MUTS_DESRM DNA mismatch repair protein MutS OS=Desulfotomaculum reducens (strain MI-1) GN=mutS PE=3 SV=1 186 585 5.0E-32
sp|A3CR17|MUTS_STRSV DNA mismatch repair protein MutS OS=Streptococcus sanguinis (strain SK36) GN=mutS PE=3 SV=1 189 602 5.0E-32
sp|Q3SVD4|MUTS_NITWN DNA mismatch repair protein MutS OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=mutS PE=3 SV=1 202 600 6.0E-32
sp|C5D9H5|MUTS_GEOSW DNA mismatch repair protein MutS OS=Geobacillus sp. (strain WCH70) GN=mutS PE=3 SV=1 186 685 3.0E-31
sp|Q1MMA5|MUTS_RHIL3 DNA mismatch repair protein MutS OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=mutS PE=3 SV=1 200 595 4.0E-31
sp|Q2JT35|MUTS_SYNJA DNA mismatch repair protein MutS OS=Synechococcus sp. (strain JA-3-3Ab) GN=mutS PE=3 SV=1 182 595 7.0E-31
sp|Q49X88|MUTS_STAS1 DNA mismatch repair protein MutS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=mutS PE=3 SV=1 186 601 9.0E-31
sp|Q5LWH0|MUTS_RUEPO DNA mismatch repair protein MutS OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=mutS PE=3 SV=1 187 594 3.0E-30
sp|Q1J489|MUTS_STRPF DNA mismatch repair protein MutS OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=mutS PE=3 SV=1 189 596 3.0E-30
sp|Q2RJG2|MUTS_MOOTA DNA mismatch repair protein MutS OS=Moorella thermoacetica (strain ATCC 39073) GN=mutS PE=3 SV=1 186 595 7.0E-30
sp|A8LPD4|MUTS_DINSH DNA mismatch repair protein MutS OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=mutS PE=3 SV=1 200 585 1.0E-29
sp|A5G447|MUTS_GEOUR DNA mismatch repair protein MutS OS=Geobacter uraniireducens (strain Rf4) GN=mutS PE=3 SV=1 186 585 1.0E-29
sp|A1U2E8|MUTS_MARHV DNA mismatch repair protein MutS OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=mutS PE=3 SV=1 186 602 1.0E-29
sp|Q5NL79|MUTS_ZYMMO DNA mismatch repair protein MutS OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=mutS PE=3 SV=2 187 578 2.0E-29
sp|P56883|MUTS_RHIME DNA mismatch repair protein MutS OS=Rhizobium meliloti (strain 1021) GN=mutS PE=3 SV=1 200 586 3.0E-29
sp|Q0C5G6|MUTS_HYPNA DNA mismatch repair protein MutS OS=Hyphomonas neptunium (strain ATCC 15444) GN=mutS PE=3 SV=1 167 595 3.0E-29
sp|A6LWJ5|MUTS_CLOB8 DNA mismatch repair protein MutS OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=mutS PE=3 SV=1 187 654 4.0E-29
sp|Q2JIA6|MUTS_SYNJB DNA mismatch repair protein MutS OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=mutS PE=3 SV=1 180 595 4.0E-29
sp|A8I275|MUTS_AZOC5 DNA mismatch repair protein MutS OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=mutS PE=3 SV=1 200 617 6.0E-29
sp|B2V1M2|MUTS_CLOBA DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=mutS PE=3 SV=1 187 601 6.0E-29
sp|B7HDP4|MUTS_BACC4 DNA mismatch repair protein MutS OS=Bacillus cereus (strain B4264) GN=mutS PE=3 SV=1 186 577 1.0E-28
sp|Q81WR3|MUTS_BACAN DNA mismatch repair protein MutS OS=Bacillus anthracis GN=mutS PE=3 SV=1 186 577 1.0E-28
sp|C3L822|MUTS_BACAC DNA mismatch repair protein MutS OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=mutS PE=3 SV=1 186 577 1.0E-28
sp|C3P5H5|MUTS_BACAA DNA mismatch repair protein MutS OS=Bacillus anthracis (strain A0248) GN=mutS PE=3 SV=1 186 577 1.0E-28
sp|A0RHE1|MUTS_BACAH DNA mismatch repair protein MutS OS=Bacillus thuringiensis (strain Al Hakam) GN=mutS PE=3 SV=1 186 577 1.0E-28
sp|C1ENZ3|MUTS_BACC3 DNA mismatch repair protein MutS OS=Bacillus cereus (strain 03BB102) GN=mutS PE=3 SV=1 186 577 1.0E-28
sp|Q636Q7|MUTS_BACCZ DNA mismatch repair protein MutS OS=Bacillus cereus (strain ZK / E33L) GN=mutS PE=3 SV=1 186 577 1.0E-28
sp|B2TIC3|MUTS_CLOBB DNA mismatch repair protein MutS OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=mutS PE=3 SV=1 187 601 1.0E-28
sp|B9IV59|MUTS_BACCQ DNA mismatch repair protein MutS OS=Bacillus cereus (strain Q1) GN=mutS PE=3 SV=1 186 577 2.0E-28
sp|P61665|MUTS_BACC1 DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=mutS PE=3 SV=1 186 577 2.0E-28
sp|Q6HF46|MUTS_BACHK DNA mismatch repair protein MutS OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=mutS PE=3 SV=1 186 577 2.0E-28
sp|B7JJ47|MUTS_BACC0 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH820) GN=mutS PE=3 SV=1 186 577 2.0E-28
sp|B7HLA3|MUTS_BACC7 DNA mismatch repair protein MutS OS=Bacillus cereus (strain AH187) GN=mutS PE=3 SV=1 186 577 2.0E-28
sp|Q81A25|MUTS_BACCR DNA mismatch repair protein MutS OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=mutS PE=3 SV=1 188 577 2.0E-28
sp|Q3ZYA0|MUTS_DEHMC DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain CBDB1) GN=mutS PE=3 SV=1 196 591 2.0E-28
sp|A5FQC0|MUTS_DEHMB DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=mutS PE=3 SV=1 196 591 3.0E-28
sp|Q7V978|MUTS_PROMM DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9313) GN=mutS PE=3 SV=1 109 585 4.0E-28
sp|Q39VR6|MUTS_GEOMG DNA mismatch repair protein MutS OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=mutS PE=3 SV=1 200 598 5.0E-28
sp|B7ITM1|MUTS_BACC2 DNA mismatch repair protein MutS OS=Bacillus cereus (strain G9842) GN=mutS PE=3 SV=1 186 577 1.0E-27
sp|A9VS13|MUTS_BACWK DNA mismatch repair protein MutS OS=Bacillus weihenstephanensis (strain KBAB4) GN=mutS PE=3 SV=1 186 577 2.0E-27
sp|Q3Z767|MUTS_DEHM1 DNA mismatch repair protein MutS OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=mutS PE=3 SV=1 196 591 3.0E-27
sp|A4XL47|MUTS_CALS8 DNA mismatch repair protein MutS OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=mutS PE=3 SV=1 186 620 3.0E-27
sp|Q83CQ2|MUTS_COXBU DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=mutS PE=3 SV=1 168 615 3.0E-27
sp|A9NCN3|MUTS_COXBR DNA mismatch repair protein MutS OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=mutS PE=3 SV=1 168 615 3.0E-27
sp|A9KG24|MUTS_COXBN DNA mismatch repair protein MutS OS=Coxiella burnetii (strain Dugway 5J108-111) GN=mutS PE=3 SV=1 168 615 4.0E-27
sp|P49849|MUTS_BACSU DNA mismatch repair protein MutS OS=Bacillus subtilis (strain 168) GN=mutS PE=3 SV=3 186 595 7.0E-27
sp|Q3JCL5|MUTS_NITOC DNA mismatch repair protein MutS OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=mutS PE=3 SV=1 183 579 1.0E-26
sp|Q82U08|MUTS_NITEU DNA mismatch repair protein MutS OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=mutS PE=3 SV=1 187 595 2.0E-26
sp|Q0A8K3|MUTS_ALKEH DNA mismatch repair protein MutS OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=mutS PE=3 SV=1 187 595 2.0E-26
sp|Q56215|MUTS_THEAQ DNA mismatch repair protein MutS OS=Thermus aquaticus GN=mutS PE=1 SV=1 181 595 2.0E-26
sp|Q5WVP6|MUTS_LEGPL DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Lens) GN=mutS PE=3 SV=1 187 585 3.0E-26
sp|Q0AEI7|MUTS_NITEC DNA mismatch repair protein MutS OS=Nitrosomonas eutropha (strain C91) GN=mutS PE=3 SV=1 174 599 4.0E-26
sp|A8FDH3|MUTS_BACP2 DNA mismatch repair protein MutS OS=Bacillus pumilus (strain SAFR-032) GN=mutS PE=3 SV=1 186 595 6.0E-26
sp|Q5ZUJ3|MUTS_LEGPH DNA mismatch repair protein MutS OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=mutS PE=3 SV=2 187 604 6.0E-26
sp|A5ICW2|MUTS_LEGPC DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Corby) GN=mutS PE=3 SV=2 187 604 6.0E-26
sp|Q5X4B2|MUTS_LEGPA DNA mismatch repair protein MutS OS=Legionella pneumophila (strain Paris) GN=mutS PE=3 SV=1 187 604 6.0E-26
sp|Q03VV4|MUTS_LEUMM DNA mismatch repair protein MutS OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / NCDO 523) GN=mutS PE=3 SV=1 187 598 7.0E-26
sp|Q8Y789|MUTS_LISMO DNA mismatch repair protein MutS OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=mutS PE=3 SV=1 186 588 7.0E-26
sp|Q7NLT8|MUTS_GLOVI DNA mismatch repair protein MutS OS=Gloeobacter violaceus (strain PCC 7421) GN=mutS PE=3 SV=1 186 585 9.0E-26
sp|Q5WFY3|MUTS_BACSK DNA mismatch repair protein MutS OS=Bacillus clausii (strain KSM-K16) GN=mutS PE=3 SV=1 186 739 9.0E-26
sp|C5BGI4|MUTS_EDWI9 DNA mismatch repair protein MutS OS=Edwardsiella ictaluri (strain 93-146) GN=mutS PE=3 SV=1 174 578 9.0E-26
sp|A2C5T5|MUTS_PROM3 DNA mismatch repair protein MutS OS=Prochlorococcus marinus (strain MIT 9303) GN=mutS PE=3 SV=1 156 542 2.0E-25
sp|C1L2V9|MUTS_LISMC DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=mutS PE=3 SV=1 186 620 2.0E-25
sp|Q92BV3|MUTS_LISIN DNA mismatch repair protein MutS OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=mutS PE=3 SV=1 186 588 2.0E-25
sp|A0AIK5|MUTS_LISW6 DNA mismatch repair protein MutS OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=mutS PE=3 SV=1 186 588 2.0E-25
sp|Q9Z6W5|MUTS_CHLPN DNA mismatch repair protein MutS OS=Chlamydia pneumoniae GN=mutS PE=3 SV=2 185 599 2.0E-25
sp|Q71ZR7|MUTS_LISMF DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4b (strain F2365) GN=mutS PE=3 SV=1 186 620 3.0E-25
sp|Q28VY6|MUTS_JANSC DNA mismatch repair protein MutS OS=Jannaschia sp. (strain CCS1) GN=mutS PE=3 SV=1 200 581 4.0E-25
sp|B3E6P2|MUTS_GEOLS DNA mismatch repair protein MutS OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=mutS PE=3 SV=1 202 591 4.0E-25
sp|B1JJF1|MUTS_YERPY DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=mutS PE=3 SV=1 186 624 5.0E-25
sp|Q66EB5|MUTS_YERPS DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=mutS PE=3 SV=1 186 602 5.0E-25
sp|B2K584|MUTS_YERPB DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=mutS PE=3 SV=1 186 602 5.0E-25
sp|A7FLX1|MUTS_YERP3 DNA mismatch repair protein MutS OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=mutS PE=3 SV=1 186 602 5.0E-25
sp|Q8PMX2|MUTS_XANAC DNA mismatch repair protein MutS OS=Xanthomonas axonopodis pv. citri (strain 306) GN=mutS PE=3 SV=1 160 628 7.0E-25
sp|Q7VY01|MUTS_BORPE DNA mismatch repair protein MutS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=mutS PE=3 SV=1 169 570 7.0E-25
sp|Q3IYI5|MUTS_RHOS4 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=mutS PE=3 SV=1 200 581 8.0E-25
sp|Q3JQS6|MUTS_BURP1 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 1710b) GN=mutS PE=3 SV=2 187 621 8.0E-25
sp|A3PNR5|MUTS_RHOS1 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=mutS PE=3 SV=1 200 581 9.0E-25
sp|A4WVX8|MUTS_RHOS5 DNA mismatch repair protein MutS OS=Rhodobacter sphaeroides (strain ATCC 17025 / ATH 2.4.3) GN=mutS PE=3 SV=1 200 581 9.0E-25
sp|Q63SR9|MUTS_BURPS DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain K96243) GN=mutS PE=3 SV=1 187 621 9.0E-25
sp|B3EP11|MUTS_CHLPB DNA mismatch repair protein MutS OS=Chlorobium phaeobacteroides (strain BS1) GN=mutS PE=3 SV=1 187 639 9.0E-25
sp|B5YJY3|MUTS_THEYD DNA mismatch repair protein MutS OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=mutS PE=3 SV=1 187 620 1.0E-24
sp|A1V5I2|MUTS_BURMS DNA mismatch repair protein MutS OS=Burkholderia mallei (strain SAVP1) GN=mutS PE=3 SV=2 187 621 1.0E-24
sp|Q62J26|MUTS_BURMA DNA mismatch repair protein MutS OS=Burkholderia mallei (strain ATCC 23344) GN=mutS PE=3 SV=1 187 621 1.0E-24
sp|A2SAW7|MUTS_BURM9 DNA mismatch repair protein MutS OS=Burkholderia mallei (strain NCTC 10229) GN=mutS PE=3 SV=2 187 621 1.0E-24
sp|A3ML57|MUTS_BURM7 DNA mismatch repair protein MutS OS=Burkholderia mallei (strain NCTC 10247) GN=mutS PE=3 SV=2 187 621 1.0E-24
sp|A3NWZ4|MUTS_BURP0 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 1106a) GN=mutS PE=3 SV=2 187 621 1.0E-24
sp|Q7W880|MUTS_BORPA DNA mismatch repair protein MutS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=mutS PE=3 SV=2 169 597 1.0E-24
sp|B8DFS4|MUTS_LISMH DNA mismatch repair protein MutS OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=mutS PE=3 SV=1 186 588 1.0E-24
sp|Q65ZX6|MUTS_BORBP DNA mismatch repair protein MutS OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=mutS PE=3 SV=1 186 603 1.0E-24
sp|A5D2K2|MUTS_PELTS DNA mismatch repair protein MutS OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=mutS PE=3 SV=1 188 585 1.0E-24
sp|P61671|MUTS_THET2 DNA mismatch repair protein MutS OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=mutS PE=3 SV=1 181 629 2.0E-24
sp|Q56239|MUTS_THET8 DNA mismatch repair protein MutS OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=mutS PE=1 SV=3 181 629 2.0E-24
sp|B2JIT0|MUTS_BURP8 DNA mismatch repair protein MutS OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=mutS PE=3 SV=1 186 621 2.0E-24
sp|B7J0P3|MUTS_BORBZ DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ZS7) GN=mutS PE=3 SV=1 186 603 2.0E-24
sp|O51737|MUTS_BORBU DNA mismatch repair protein MutS OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=mutS PE=3 SV=1 186 603 2.0E-24
sp|Q0SM54|MUTS_BORAP DNA mismatch repair protein MutS OS=Borrelia afzelii (strain PKo) GN=mutS PE=3 SV=1 186 603 2.0E-24
sp|A3NB64|MUTS_BURP6 DNA mismatch repair protein MutS OS=Burkholderia pseudomallei (strain 668) GN=mutS PE=3 SV=1 187 587 3.0E-24
sp|Q2SXA6|MUTS_BURTA DNA mismatch repair protein MutS OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=mutS PE=3 SV=1 187 621 4.0E-24
sp|C0ZEZ4|MUTS_BREBN DNA mismatch repair protein MutS OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=mutS PE=3 SV=1 186 591 4.0E-24
sp|Q03R33|MUTS_LACBA DNA mismatch repair protein MutS OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=mutS PE=3 SV=1 186 620 4.0E-24
sp|Q0KCC0|MUTS_CUPNH DNA mismatch repair protein MutS OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=mutS PE=3 SV=1 172 596 6.0E-24
sp|Q3SJP0|MUTS_THIDA DNA mismatch repair protein MutS OS=Thiobacillus denitrificans (strain ATCC 25259) GN=mutS PE=3 SV=1 179 584 6.0E-24
sp|Q5H2C5|MUTS_XANOR DNA mismatch repair protein MutS OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=mutS PE=3 SV=1 169 628 8.0E-24
sp|C1DSR1|MUTS_AZOVD DNA mismatch repair protein MutS OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=mutS PE=3 SV=1 187 602 1.0E-23
sp|Q7WLT5|MUTS_BORBR DNA mismatch repair protein MutS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=mutS PE=3 SV=2 186 599 2.0E-23
sp|B4ED83|MUTS_BURCJ DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=mutS PE=3 SV=1 186 587 2.0E-23
sp|Q82ZA2|MUTS_ENTFA DNA mismatch repair protein MutS OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=mutS PE=3 SV=1 172 638 4.0E-23
sp|Q9PCR2|MUTS_XYLFA DNA mismatch repair protein MutS OS=Xylella fastidiosa (strain 9a5c) GN=mutS PE=3 SV=2 173 627 4.0E-23
sp|Q39EX8|MUTS_BURL3 DNA mismatch repair protein MutS OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=mutS PE=3 SV=1 186 587 4.0E-23
sp|A0K8L2|MUTS_BURCH DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain HI2424) GN=mutS PE=3 SV=1 186 587 5.0E-23
sp|B1JUW8|MUTS_BURCC DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain MC0-3) GN=mutS PE=3 SV=1 186 587 5.0E-23
sp|Q1BHQ1|MUTS_BURCA DNA mismatch repair protein MutS OS=Burkholderia cenocepacia (strain AU 1054) GN=mutS PE=3 SV=1 186 587 6.0E-23
sp|Q5L554|MUTS_CHLAB DNA mismatch repair protein MutS OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=mutS PE=3 SV=1 186 597 6.0E-23
sp|B2GB17|MUTS_LACF3 DNA mismatch repair protein MutS OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=mutS PE=3 SV=1 186 596 6.0E-23
sp|P27345|MUTS_AZOVI DNA mismatch repair protein MutS OS=Azotobacter vinelandii GN=mutS PE=3 SV=1 187 602 7.0E-23
sp|Q821V6|MUTS_CHLCV DNA mismatch repair protein MutS OS=Chlamydophila caviae (strain GPIC) GN=mutS PE=3 SV=1 185 597 8.0E-23
sp|Q473E4|MUTS_CUPPJ DNA mismatch repair protein MutS OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=mutS PE=3 SV=2 180 624 1.0E-22
sp|B1YSP3|MUTS_BURA4 DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain MC40-6) GN=mutS PE=3 SV=1 186 587 1.0E-22
sp|Q3BVY0|MUTS_XANC5 DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=mutS PE=3 SV=1 173 628 1.0E-22
sp|A4JFW7|MUTS_BURVG DNA mismatch repair protein MutS OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=mutS PE=3 SV=1 186 587 1.0E-22
sp|A8ANU8|MUTS_CITK8 DNA mismatch repair protein MutS OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=mutS PE=3 SV=1 186 599 2.0E-22
sp|Q4US90|MUTS_XANC8 DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. campestris (strain 8004) GN=mutS PE=3 SV=2 187 628 3.0E-22
sp|Q8PBB5|MUTS_XANCP DNA mismatch repair protein MutS OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=mutS PE=3 SV=1 187 628 3.0E-22
sp|Q0BDU3|MUTS_BURCM DNA mismatch repair protein MutS OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mutS PE=3 SV=1 186 587 4.0E-22
sp|Q87CI8|MUTS_XYLFT DNA mismatch repair protein MutS OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=mutS PE=3 SV=1 173 627 5.0E-22
sp|C3KCT2|MUTS_PSEFS DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain SBW25) GN=mutS PE=3 SV=1 187 534 5.0E-22
sp|P57504|MUTS_BUCAI DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=mutS PE=3 SV=1 186 585 6.0E-22
sp|Q3KH79|MUTS_PSEPF DNA mismatch repair protein MutS OS=Pseudomonas fluorescens (strain Pf0-1) GN=mutS PE=3 SV=1 187 591 7.0E-22
sp|Q30ZX3|MUTS_DESAG DNA mismatch repair protein MutS OS=Desulfovibrio alaskensis (strain G20) GN=mutS PE=3 SV=1 183 619 9.0E-22
sp|B9LB04|MUTS_CHLSY DNA mismatch repair protein MutS OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=mutS PE=3 SV=1 186 544 1.0E-21
sp|A9WFZ9|MUTS_CHLAA DNA mismatch repair protein MutS OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=mutS PE=3 SV=1 186 544 1.0E-21
sp|B8D9K7|MUTS_BUCA5 DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=mutS PE=3 SV=1 186 585 1.0E-21
sp|B8D7V9|MUTS_BUCAT DNA mismatch repair protein MutS OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=mutS PE=3 SV=1 186 585 1.0E-21
sp|A5FJ63|MUTS_FLAJ1 DNA mismatch repair protein MutS OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=mutS PE=3 SV=2 196 594 1.0E-21
sp|Q87XW6|MUTS_PSESM DNA mismatch repair protein MutS OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mutS PE=3 SV=1 187 591 1.0E-21
sp|C5BMR5|MUTS_TERTT DNA mismatch repair protein MutS OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=mutS PE=3 SV=1 187 596 2.0E-21
sp|Q255T1|MUTS_CHLFF DNA mismatch repair protein MutS OS=Chlamydophila felis (strain Fe/C-56) GN=mutS PE=3 SV=1 186 597 4.0E-21
sp|Q3ACA5|MUTS_CARHZ DNA mismatch repair protein MutS OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=mutS PE=3 SV=1 186 585 6.0E-21
sp|B0S1C1|MUTS_FINM2 DNA mismatch repair protein MutS OS=Finegoldia magna (strain ATCC 29328) GN=mutS PE=3 SV=1 186 586 7.0E-21
sp|Q3B0S2|MUTS_SYNS9 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9902) GN=mutS PE=3 SV=1 202 585 9.0E-21
sp|Q0VNJ1|MUTS_ALCBS DNA mismatch repair protein MutS OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=mutS PE=3 SV=1 186 619 9.0E-21
sp|Q6FC54|MUTS_ACIAD DNA mismatch repair protein MutS OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=mutS PE=3 SV=1 184 581 2.0E-20
sp|A9BJY3|MUTS_PETMO DNA mismatch repair protein MutS OS=Petrotoga mobilis (strain DSM 10674 / SJ95) GN=mutS PE=3 SV=1 186 595 4.0E-20
sp|B9K800|MUTS_THENN DNA mismatch repair protein MutS OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=mutS PE=3 SV=1 187 585 1.0E-19
sp|Q5NYP9|MUTS_AROAE DNA mismatch repair protein MutS OS=Aromatoleum aromaticum (strain EbN1) GN=mutS PE=3 SV=1 187 585 2.0E-19
sp|A5ILG0|MUTS_THEP1 DNA mismatch repair protein MutS OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=mutS PE=3 SV=1 187 585 3.0E-19
sp|A4G717|MUTS_HERAR DNA mismatch repair protein MutS OS=Herminiimonas arsenicoxydans GN=mutS PE=3 SV=3 169 581 2.0E-18
sp|B1LAW3|MUTS_THESQ DNA mismatch repair protein MutS OS=Thermotoga sp. (strain RQ2) GN=mutS PE=3 SV=1 187 585 2.0E-18
sp|A6SXI2|MUTS_JANMA DNA mismatch repair protein MutS OS=Janthinobacterium sp. (strain Marseille) GN=mutS PE=3 SV=1 172 581 1.0E-17
sp|A1VDD9|MUTS_DESVV DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=mutS PE=3 SV=1 179 385 3.0E-14
sp|P61666|MUTS_DESVH DNA mismatch repair protein MutS OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=mutS PE=3 SV=1 179 385 3.0E-14
sp|O66652|MUTS_AQUAE DNA mismatch repair protein MutS OS=Aquifex aeolicus (strain VF5) GN=mutS PE=3 SV=1 186 586 9.0E-14
sp|Q1IN52|MUTS_KORVE DNA mismatch repair protein MutS OS=Koribacter versatilis (strain Ellin345) GN=mutS PE=3 SV=1 186 585 1.0E-13
sp|A5GQ22|MUTS_SYNR3 DNA mismatch repair protein MutS OS=Synechococcus sp. (strain RCC307) GN=mutS PE=3 SV=1 166 315 3.0E-12
sp|B4UCY7|MUTS_ANASK DNA mismatch repair protein MutS OS=Anaeromyxobacter sp. (strain K) GN=mutS PE=3 SV=1 187 397 3.0E-12
sp|Q3ANH5|MUTS_SYNSC DNA mismatch repair protein MutS OS=Synechococcus sp. (strain CC9605) GN=mutS PE=3 SV=1 130 317 3.0E-12
sp|Q2IIJ3|MUTS_ANADE DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mutS PE=3 SV=1 187 396 2.0E-11
sp|B8JA66|MUTS_ANAD2 DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=mutS PE=3 SV=1 187 385 4.0E-11
sp|B8JA66|MUTS_ANAD2 DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=mutS PE=3 SV=1 474 577 2.0E-07
sp|B4UCY7|MUTS_ANASK DNA mismatch repair protein MutS OS=Anaeromyxobacter sp. (strain K) GN=mutS PE=3 SV=1 474 577 3.0E-07
sp|Q2IIJ3|MUTS_ANADE DNA mismatch repair protein MutS OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=mutS PE=3 SV=1 474 577 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0030983 mismatched DNA binding Yes
GO:0006298 mismatch repair Yes
GO:0005524 ATP binding Yes
GO:0050896 response to stimulus No
GO:0003677 DNA binding No
GO:0030554 adenyl nucleotide binding No
GO:0090304 nucleic acid metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0051716 cellular response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0006950 response to stress No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0003690 double-stranded DNA binding No
GO:0017076 purine nucleotide binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:0008150 biological_process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0033554 cellular response to stress No
GO:0006281 DNA repair No
GO:0043167 ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3970
MFRPRGLHGLSSLIRRLHGQHAVYIALIPVRGKKTSTTVKLSELPEGPIRDDSLQPEPVRRKKTSKRVKVSELPE
GCVGNDSSEPQPTRRKKTTRIKLSELPLGPVQDESQSLEPARGKKTSTVKLSELPESSKSPGNDESPSLEPARGK
KTTTFKLSELPQGPIHDESSPPETTDNGNLGPPYPTVMLQAWRNMRKFDNCVLLTRVGGFYELYFEHASEYAPLL
NLKLTTKKTNAGPVPMAGFPFFQLDRYLKILVQDLNRYVAIAEETPNDAANMVKMGGLMHDRKVTRIITPGTLID
ENFIDPYFNNYVLAIHVGQQDTPDAGQLSGREALDCGIATPPVVDSAPLGLAWLDLSTGHFFTQLTNVQSLSAAL
SRIGPREIVLDQDFQKNEAHAIFTILAEDRHFITYSQQGALTDVNEWSSFLEEDVPDSTRDSFTDHEVMAGGLLL
NYVKDRLQGMSIKLQPPQRRDGMEVMSIDKNSLRALEIKQTMRDGLFRGSLLHAIRRTVTKSGARLLNDWLSAPS
TSLDVINQRLNLVAYFIAHPDLCDSIIQLLRRSHDAQRLVQKFALGRGDADDLLALANTIRATDDIVSLLKPTTD
QHQEPNNDESCLEPLVARIDLEQPLKLAQRIKDAIDEESIVYQQEVDESEASDLLTLAQDIVASEGSQEDASLLP
KTRKKRPSSLRDYYGDDNEAWIMKPAASPPLEQLHADLNLLTDEKTALESKIRDQLSAPSLSLKWNPGLGHFAHI
KGRDARTMTDVKALSSSRSTRSFHLPEWTALGQRLDQARFRIRREEQRVFQSLRQHVILNLVKLRRNSVVLDQLD
IVSSFAKLAAHHDLIRPLLNNSDSHTIIGGRHPTVEGGLLARGRTFVRNDCLVGGGGGPPKGGLVWLITGPNMAG
KSTFLRQNALITVLAQIGSYVPASFAEMGIVDAIFSRVGSADNLFGDQSTFMVEMVETAQILRQATARSFVIMDE
IGRGTTPEDGTAVAYACLHHLATVNRCRTLFATHFHDVIDLAAEEGLCDPTGVDAAAIVQTYCTDVQEDGKGGFV
YVHKLRKGVNRRSHALKVARLAGLPESAIEAAQRVLTARLEGDGGSRGGDVMESRAADAET*
Coding >Ophun1|3970
ATGTTTCGGCCACGCGGCCTTCATGGACTGAGCAGTCTGATTCGTCGTCTCCATGGACAGCACGCTGTTTATATC
GCTCTCATACCGGTCCGGGGAAAGAAGACGTCGACCACGGTCAAGCTGTCGGAGCTTCCCGAGGGTCCTATCCGG
GACGATTCGCTACAGCCAGAGCCGGTCCGGAGAAAGAAGACTTCGAAGAGAGTGAAGGTGTCGGAGCTGCCCGAG
GGCTGTGTTGGTAATGATTCATCTGAGCCACAGCCGACTCGGAGAAAGAAGACGACGAGAATCAAGCTATCGGAG
CTGCCTCTGGGCCCTGTTCAGGATGAGTCGCAGTCGCTTGAACCGGCTCGAGGCAAGAAGACGTCGACGGTCAAG
CTGTCGGAGCTTCCAGAGAGCTCTAAAAGCCCTGGAAATGATGAGTCGCCGTCGCTGGAACCAGCACGGGGCAAG
AAGACGACAACATTCAAGCTATCGGAGCTGCCCCAAGGCCCCATCCACGACGAGTCGTCGCCGCCAGAGACGACC
GACAATGGCAATCTTGGACCTCCGTATCCTACTGTCATGCTTCAGGCCTGGCGGAACATGCGCAAGTTTGACAAC
TGCGTTCTGCTGACTCGCGTCGGCGGCTTCTATGAGCTCTACTTTGAACACGCCAGCGAGTACGCGCCGTTGCTC
AACCTGAAGCTGACCACCAAGAAGACCAATGCCGGTCCTGTCCCGATGGCCGGCTTTCCCTTCTTTCAGCTCGAC
CGCTACCTCAAGATCCTCGTCCAGGACCTCAACCGCTACGTCGCCATCGCCGAGGAGACTCCAAACGATGCCGCT
AACATGGTCAAGATGGGCGGTCTGATGCATGACCGAAAAGTCACCCGCATCATCACACCCGGTACTCTCATCGAC
GAGAACTTTATCGACCCCTATTTCAACAACTACGTCTTGGCTATCCACGTCGGTCAACAAGACACACCAGACGCC
GGTCAGCTCTCCGGTCGAGAAGCCTTAGACTGTGGCATCGCGACTCCGCCTGTAGTCGACTCCGCGCCTTTAGGT
CTCGCCTGGCTTGACTTGTCAACTGGCCACTTCTTCACGCAGCTCACCAATGTACAGAGTCTATCGGCCGCGCTA
TCTCGCATAGGCCCTCGCGAGATTGTCTTGGACCAAGACTTTCAAAAGAACGAGGCCCATGCCATCTTCACCATC
CTCGCCGAGGACCGCCATTTCATAACGTACTCTCAGCAGGGCGCTCTCACCGACGTCAACGAATGGTCTTCCTTC
CTCGAAGAAGACGTCCCGGATAGCACGCGAGACAGCTTCACGGATCACGAGGTCATGGCCGGTGGGCTGCTTCTC
AACTATGTCAAGGATCGTTTACAGGGCATGTCCATCAAGCTCCAACCACCGCAGCGACGCGACGGTATGGAGGTC
ATGAGCATCGACAAGAACAGCCTGAGAGCGCTCGAGATCAAGCAGACGATGAGAGACGGCCTGTTCCGAGGCAGC
CTGCTCCATGCCATCCGGCGCACCGTGACCAAGAGCGGCGCGCGTCTGCTCAACGACTGGCTCAGCGCCCCGTCG
ACGTCGCTCGACGTCATCAACCAGCGGCTGAACCTCGTCGCCTACTTCATCGCCCATCCAGACCTATGCGATTCC
ATCATACAGCTCCTCCGTCGAAGCCACGACGCCCAGCGGCTGGTTCAAAAATTCGCTCTAGGCCGCGGTGACGCC
GACGATCTCCTGGCCTTGGCCAACACCATCCGCGCAACCGACGACATCGTCTCCCTCCTCAAGCCAACGACAGAC
CAGCATCAGGAACCGAACAACGACGAAAGCTGTCTCGAACCGCTAGTAGCACGCATCGACCTCGAACAGCCTCTC
AAACTCGCCCAACGAATCAAAGACGCCATCGACGAAGAATCCATCGTCTACCAGCAAGAAGTAGACGAGTCAGAA
GCCAGCGACCTCCTCACCCTCGCCCAGGACATCGTCGCCTCCGAAGGCTCTCAAGAAGACGCCTCACTCCTCCCC
AAGACTCGCAAGAAACGGCCCTCATCCCTCCGAGATTACTACGGCGACGACAACGAAGCCTGGATCATGAAACCC
GCCGCCAGCCCACCCCTCGAGCAACTCCACGCCGACCTCAACCTCCTCACCGACGAGAAAACAGCCCTCGAATCC
AAAATCCGCGACCAGCTCTCCGCCCCAAGCCTCAGCCTCAAATGGAACCCCGGACTCGGCCACTTCGCCCACATC
AAGGGCAGAGACGCGCGAACCATGACAGACGTCAAGGCCCTCTCCTCCAGCCGCTCAACCCGATCCTTCCACCTC
CCAGAATGGACAGCCCTCGGCCAACGCCTCGACCAAGCCCGCTTCCGCATCCGCCGCGAAGAGCAACGCGTCTTC
CAATCCCTCCGCCAGCACGTCATCCTCAACCTCGTCAAACTCCGCCGCAACTCCGTCGTCCTCGACCAGCTGGAC
ATCGTCTCCTCCTTCGCTAAACTAGCCGCCCACCACGACCTCATCCGCCCCCTTCTCAACAACTCGGACTCCCAC
ACCATCATCGGAGGCCGCCACCCCACCGTCGAGGGCGGCCTCCTCGCCCGCGGCCGCACCTTTGTCCGCAACGAC
TGCCTCGTCGGCGGCGGCGGCGGGCCCCCCAAAGGCGGACTCGTCTGGCTCATCACGGGGCCCAACATGGCGGGC
AAGAGCACATTCCTCCGGCAAAACGCCCTCATCACCGTGCTCGCTCAGATCGGGAGCTACGTGCCGGCCTCGTTC
GCCGAGATGGGCATCGTCGACGCCATCTTCAGCCGCGTCGGTTCCGCCGATAACCTGTTTGGCGATCAGAGTACC
TTTATGGTTGAGATGGTTGAGACGGCTCAGATTCTGCGTCAGGCTACCGCTCGGTCCTTTGTGATTATGGATGAG
ATTGGGCGGGGGACCACGCCTGAGGATGGTACGGCCGTTGCTTACGCCTGTCTGCATCACCTTGCTACCGTCAAC
CGGTGCAGGACGCTGTTCGCGACTCACTTCCACGACGTCATTGACTTGGCCGCCGAGGAAGGGCTCTGCGACCCA
ACGGGTGTCGACGCCGCCGCCATCGTCCAGACGTACTGCACCGACGTACAGGAGGATGGGAAGGGCGGCTTCGTC
TACGTCCACAAGCTACGCAAGGGCGTCAACCGCCGGAGCCACGCGCTGAAGGTGGCGAGGCTGGCTGGTCTGCCC
GAGAGTGCCATCGAAGCCGCGCAACGGGTTCTGACGGCGCGGCTGGAAGGGGATGGGGGTTCGAGGGGTGGCGAC
GTCATGGAGAGCAGGGCGGCGGATGCCGAAACCTAG
Transcript >Ophun1|3970
ATGTTTCGGCCACGCGGCCTTCATGGACTGAGCAGTCTGATTCGTCGTCTCCATGGACAGCACGCTGTTTATATC
GCTCTCATACCGGTCCGGGGAAAGAAGACGTCGACCACGGTCAAGCTGTCGGAGCTTCCCGAGGGTCCTATCCGG
GACGATTCGCTACAGCCAGAGCCGGTCCGGAGAAAGAAGACTTCGAAGAGAGTGAAGGTGTCGGAGCTGCCCGAG
GGCTGTGTTGGTAATGATTCATCTGAGCCACAGCCGACTCGGAGAAAGAAGACGACGAGAATCAAGCTATCGGAG
CTGCCTCTGGGCCCTGTTCAGGATGAGTCGCAGTCGCTTGAACCGGCTCGAGGCAAGAAGACGTCGACGGTCAAG
CTGTCGGAGCTTCCAGAGAGCTCTAAAAGCCCTGGAAATGATGAGTCGCCGTCGCTGGAACCAGCACGGGGCAAG
AAGACGACAACATTCAAGCTATCGGAGCTGCCCCAAGGCCCCATCCACGACGAGTCGTCGCCGCCAGAGACGACC
GACAATGGCAATCTTGGACCTCCGTATCCTACTGTCATGCTTCAGGCCTGGCGGAACATGCGCAAGTTTGACAAC
TGCGTTCTGCTGACTCGCGTCGGCGGCTTCTATGAGCTCTACTTTGAACACGCCAGCGAGTACGCGCCGTTGCTC
AACCTGAAGCTGACCACCAAGAAGACCAATGCCGGTCCTGTCCCGATGGCCGGCTTTCCCTTCTTTCAGCTCGAC
CGCTACCTCAAGATCCTCGTCCAGGACCTCAACCGCTACGTCGCCATCGCCGAGGAGACTCCAAACGATGCCGCT
AACATGGTCAAGATGGGCGGTCTGATGCATGACCGAAAAGTCACCCGCATCATCACACCCGGTACTCTCATCGAC
GAGAACTTTATCGACCCCTATTTCAACAACTACGTCTTGGCTATCCACGTCGGTCAACAAGACACACCAGACGCC
GGTCAGCTCTCCGGTCGAGAAGCCTTAGACTGTGGCATCGCGACTCCGCCTGTAGTCGACTCCGCGCCTTTAGGT
CTCGCCTGGCTTGACTTGTCAACTGGCCACTTCTTCACGCAGCTCACCAATGTACAGAGTCTATCGGCCGCGCTA
TCTCGCATAGGCCCTCGCGAGATTGTCTTGGACCAAGACTTTCAAAAGAACGAGGCCCATGCCATCTTCACCATC
CTCGCCGAGGACCGCCATTTCATAACGTACTCTCAGCAGGGCGCTCTCACCGACGTCAACGAATGGTCTTCCTTC
CTCGAAGAAGACGTCCCGGATAGCACGCGAGACAGCTTCACGGATCACGAGGTCATGGCCGGTGGGCTGCTTCTC
AACTATGTCAAGGATCGTTTACAGGGCATGTCCATCAAGCTCCAACCACCGCAGCGACGCGACGGTATGGAGGTC
ATGAGCATCGACAAGAACAGCCTGAGAGCGCTCGAGATCAAGCAGACGATGAGAGACGGCCTGTTCCGAGGCAGC
CTGCTCCATGCCATCCGGCGCACCGTGACCAAGAGCGGCGCGCGTCTGCTCAACGACTGGCTCAGCGCCCCGTCG
ACGTCGCTCGACGTCATCAACCAGCGGCTGAACCTCGTCGCCTACTTCATCGCCCATCCAGACCTATGCGATTCC
ATCATACAGCTCCTCCGTCGAAGCCACGACGCCCAGCGGCTGGTTCAAAAATTCGCTCTAGGCCGCGGTGACGCC
GACGATCTCCTGGCCTTGGCCAACACCATCCGCGCAACCGACGACATCGTCTCCCTCCTCAAGCCAACGACAGAC
CAGCATCAGGAACCGAACAACGACGAAAGCTGTCTCGAACCGCTAGTAGCACGCATCGACCTCGAACAGCCTCTC
AAACTCGCCCAACGAATCAAAGACGCCATCGACGAAGAATCCATCGTCTACCAGCAAGAAGTAGACGAGTCAGAA
GCCAGCGACCTCCTCACCCTCGCCCAGGACATCGTCGCCTCCGAAGGCTCTCAAGAAGACGCCTCACTCCTCCCC
AAGACTCGCAAGAAACGGCCCTCATCCCTCCGAGATTACTACGGCGACGACAACGAAGCCTGGATCATGAAACCC
GCCGCCAGCCCACCCCTCGAGCAACTCCACGCCGACCTCAACCTCCTCACCGACGAGAAAACAGCCCTCGAATCC
AAAATCCGCGACCAGCTCTCCGCCCCAAGCCTCAGCCTCAAATGGAACCCCGGACTCGGCCACTTCGCCCACATC
AAGGGCAGAGACGCGCGAACCATGACAGACGTCAAGGCCCTCTCCTCCAGCCGCTCAACCCGATCCTTCCACCTC
CCAGAATGGACAGCCCTCGGCCAACGCCTCGACCAAGCCCGCTTCCGCATCCGCCGCGAAGAGCAACGCGTCTTC
CAATCCCTCCGCCAGCACGTCATCCTCAACCTCGTCAAACTCCGCCGCAACTCCGTCGTCCTCGACCAGCTGGAC
ATCGTCTCCTCCTTCGCTAAACTAGCCGCCCACCACGACCTCATCCGCCCCCTTCTCAACAACTCGGACTCCCAC
ACCATCATCGGAGGCCGCCACCCCACCGTCGAGGGCGGCCTCCTCGCCCGCGGCCGCACCTTTGTCCGCAACGAC
TGCCTCGTCGGCGGCGGCGGCGGGCCCCCCAAAGGCGGACTCGTCTGGCTCATCACGGGGCCCAACATGGCGGGC
AAGAGCACATTCCTCCGGCAAAACGCCCTCATCACCGTGCTCGCTCAGATCGGGAGCTACGTGCCGGCCTCGTTC
GCCGAGATGGGCATCGTCGACGCCATCTTCAGCCGCGTCGGTTCCGCCGATAACCTGTTTGGCGATCAGAGTACC
TTTATGGTTGAGATGGTTGAGACGGCTCAGATTCTGCGTCAGGCTACCGCTCGGTCCTTTGTGATTATGGATGAG
ATTGGGCGGGGGACCACGCCTGAGGATGGTACGGCCGTTGCTTACGCCTGTCTGCATCACCTTGCTACCGTCAAC
CGGTGCAGGACGCTGTTCGCGACTCACTTCCACGACGTCATTGACTTGGCCGCCGAGGAAGGGCTCTGCGACCCA
ACGGGTGTCGACGCCGCCGCCATCGTCCAGACGTACTGCACCGACGTACAGGAGGATGGGAAGGGCGGCTTCGTC
TACGTCCACAAGCTACGCAAGGGCGTCAACCGCCGGAGCCACGCGCTGAAGGTGGCGAGGCTGGCTGGTCTGCCC
GAGAGTGCCATCGAAGCCGCGCAACGGGTTCTGACGGCGCGGCTGGAAGGGGATGGGGGTTCGAGGGGTGGCGAC
GTCATGGAGAGCAGGGCGGCGGATGCCGAAACCTAG
Gene >Ophun1|3970
ATGTTTCGGCCACGCGGCCTTCATGGACTGAGCAGTCTGATTCGTCGTCTCCATGGACAGCACGCTGTTTATATC
GCTCTCATACCGGTCCGGGGAAAGAAGACGTCGACCACGGTCAAGCTGTCGGAGCTTCCCGAGGGTCCTATCCGG
GACGATTCGCTACAGCCAGAGCCGGTCCGGAGAAAGAAGACTTCGAAGAGAGTGAAGGTGTCGGAGCTGCCCGAG
GGCTGTGTTGGTAATGATTCATCTGAGCCACAGCCGACTCGGAGAAAGAAGACGACGAGAATCAAGCTATCGGAG
CTGCCTCTGGGCCCTGTTCAGGATGAGTCGCAGTCGCTTGAACCGGCTCGAGGCAAGAAGACGTCGACGGTCAAG
CTGTCGGAGCTTCCAGAGAGCTCTAAAAGCCCTGGAAATGATGAGTCGCCGTCGCTGGAACCAGCACGGGGCAAG
AAGACGACAACATTCAAGCTATCGGAGCTGCCCCAAGGCCCCATCCACGACGAGTCGTCGCCGCCAGAGACGACC
GACAATGGCAATCTTGGACCTCCGTATCCTACTGTCATGCTTCAGGCCTGGCGGAACATGCGCAAGTTTGACAAC
TGCGTTCTGCTGACTCGCGTCGGCGGCTTCTATGAGCTCTACTTTGAACACGCCAGCGAGTACGCGCCGTTGCTC
AACCTGAAGCTGACCACCAAGAAGACCAATGCCGGTCCTGTCCCGATGGTATGGCCCCAATTCGATAAGAATGAC
AGATGGCTCACATCATCCAGGCCGGCTTTCCCTTCTTTCAGCTCGACCGCTACCTCAAGATCCTCGTCCAGGACC
TCAACCGCTACGTCGCCATCGCCGAGGAGACTCCAAACGATGCCGCTAACATGGTCAAGATGGGCGGTCTGATGC
ATGACCGAAAAGTCACCCGCATCATCACACCCGGTACTCTCATCGACGAGAACTTTATCGACCCCTATTTCAACA
ACTACGTCTTGGCTATCCACGTCGGTCAACAAGACACACCAGACGCCGGTCAGCTCTCCGGTCGAGAAGCCTTAG
ACTGTGGCATCGCGACTCCGCCTGTAGTCGACTCCGCGCCTTTAGGTCTCGCCTGGCTTGACTTGTCAACTGGCC
ACTTCTTCACGCAGCTCACCAATGTACAGAGTCTATCGGCCGCGCTATCTCGCATAGGCCCTCGCGAGATTGTCT
TGGACCAAGACTTTCAAAAGAACGAGGCCCATGCCATCTTCACCATCCTCGCCGAGGACCGCCATTTCATAACGT
ACTCTCAGCAGGGCGCTCTCACCGACGTCAACGAATGGTCTTCCTTCCTCGAAGAAGACGTCCCGGATAGCACGC
GAGACAGCTTCACGGATCACGAGGTCATGGCCGGTGGGCTGCTTCTCAACTATGTCAAGGATCGTTTACAGGGCA
TGTCCATCAAGCTCCAACCACCGCAGCGACGCGACGGTATGGAGGTCATGAGCATCGACAAGAACAGCCTGAGAG
CGCTCGAGATCAAGCAGACGATGAGAGACGGCCTGTTCCGAGGCAGCCTGCTCCATGCCATCCGGCGCACCGTGA
CCAAGAGCGGCGCGCGTCTGCTCAACGACTGGCTCAGCGCCCCGTCGACGTCGCTCGACGTCATCAACCAGCGGC
TGAACCTCGTCGCCTACTTCATCGCCCATCCAGACCTATGCGATTCCATCATACAGCTCCTCCGTCGAAGCCACG
ACGCCCAGCGGCTGGTTCAAAAATTCGCTCTAGGCCGCGGTGACGCCGACGATCTCCTGGCCTTGGCCAACACCA
TCCGCGCAACCGACGACATCGTCTCCCTCCTCAAGCCAACGACAGACCAGCATCAGGAACCGAACAACGACGAAA
GCTGTCTCGAACCGCTAGTAGCACGCATCGACCTCGAACAGCCTCTCAAACTCGCCCAACGAATCAAAGACGCCA
TCGACGAAGAATCCATCGTCTACCAGCAAGAAGTAGACGAGTCAGAAGCCAGCGACCTCCTCACCCTCGCCCAGG
ACATCGTCGCCTCCGAAGGCTCTCAAGAAGACGCCTCACTCCTCCCCAAGACTCGCAAGAAACGGCCCTCATCCC
TCCGAGATTACTACGGCGACGACAACGAAGCCTGGATCATGAAACCCGCCGCCAGCCCACCCCTCGAGCAACTCC
ACGCCGACCTCAACCTCCTCACCGACGAGAAAACAGCCCTCGAATCCAAAATCCGCGACCAGCTCTCCGCCCCAA
GCCTCAGCCTCAAATGGAACCCCGGACTCGGCCACTTCGCCCACATCAAGGGCAGAGACGCGCGAACCATGACAG
ACGTCAAGGCCCTCTCCTCCAGCCGCTCAACCCGATCCTTCCACCTCCCAGAATGGACAGCCCTCGGCCAACGCC
TCGACCAAGCCCGCTTCCGCATCCGCCGCGAAGAGCAACGCGTCTTCCAATCCCTCCGCCAGCACGTCATCCTCA
ACCTCGTCAAACTCCGCCGCAACTCCGTCGTCCTCGACCAGCTGGACATCGTCTCCTCCTTCGCTAAACTAGCCG
CCCACCACGACCTCATCCGCCCCCTTCTCAACAACTCGGACTCCCACACCATCATCGGAGGCCGCCACCCCACCG
TCGAGGGCGGCCTCCTCGCCCGCGGCCGCACCTTTGTCCGCAACGACTGCCTCGTCGGCGGCGGCGGCGGGCCCC
CCAAAGGCGGACTCGTCTGGCTCATCACGGGGCCCAACATGGCGGGCAAGAGCACATTCCTCCGGCAAAACGCCC
TCATCACCGTGCTCGCTCAGATCGGGAGCTACGTGCCGGCCTCGTTCGCCGAGATGGGCATCGTCGACGCCATCT
TCAGCCGCGTCGGTTCCGCCGATAACCTGTTTGGCGATCAGAGTACCTTTATGGTTGAGATGGTTGAGACGGCTC
AGATTCTGCGTCAGGCTACCGCTCGGTCCTTTGTGATTATGGATGAGATTGGGCGGGGGACCACGCCTGAGGATG
GTACGGCCGTTGCTTACGCCTGTCTGCATCACCTTGCTACCGTCAACCGGTGCAGGACGCTGTTCGCGACTCACT
TCCACGACGTCATTGACTTGGCCGCCGAGGAAGGGCTCTGCGACCCAACGGGTGTCGACGCCGCCGCCATCGTCC
AGACGTACTGCACCGACGTACAGGAGGATGGGAAGGGCGGCTTCGTCTACGTCCACAAGCTACGCAAGGGCGTCA
ACCGCCGGAGCCACGCGCTGAAGGTGGCGAGGCTGGCTGGTCTGCCCGAGAGTGCCATCGAAGCCGCGCAACGGG
TTCTGACGGCGCGGCTGGAAGGGGATGGGGGTTCGAGGGGTGGCGACGTCATGGAGAGCAGGGCGGCGGATGCCG
AAACCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail