Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|397
Gene name
LocationContig_111:7914..8510
Strand-
Gene length (bp)596
Transcript length (bp)465
Coding sequence length (bp)465
Protein length (aa) 155

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain 3.6E-22 59 129
PF01193 RNA_pol_L RNA polymerase Rpb3/Rpb11 dimerisation domain 6.1E-07 60 125

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VJE4|RPB11_DROME DNA-directed RNA polymerase II subunit RPB11 OS=Drosophila melanogaster GN=Rpb11 PE=3 SV=1 15 132 2.0E-17
sp|P52435|RPB11_HUMAN DNA-directed RNA polymerase II subunit RPB11-a OS=Homo sapiens GN=POLR2J PE=1 SV=1 16 132 3.0E-17
sp|O08740|RPB11_MOUSE DNA-directed RNA polymerase II subunit RPB11 OS=Mus musculus GN=Polr2j PE=1 SV=1 16 132 3.0E-17
sp|Q32P79|RPB11_BOVIN DNA-directed RNA polymerase II subunit RPB11 OS=Bos taurus GN=POLR2J PE=3 SV=1 16 132 3.0E-17
sp|Q7PVQ9|RPB11_ANOGA DNA-directed RNA polymerase II subunit RPB11 OS=Anopheles gambiae GN=Rpb11 PE=3 SV=2 15 132 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9VJE4|RPB11_DROME DNA-directed RNA polymerase II subunit RPB11 OS=Drosophila melanogaster GN=Rpb11 PE=3 SV=1 15 132 2.0E-17
sp|P52435|RPB11_HUMAN DNA-directed RNA polymerase II subunit RPB11-a OS=Homo sapiens GN=POLR2J PE=1 SV=1 16 132 3.0E-17
sp|O08740|RPB11_MOUSE DNA-directed RNA polymerase II subunit RPB11 OS=Mus musculus GN=Polr2j PE=1 SV=1 16 132 3.0E-17
sp|Q32P79|RPB11_BOVIN DNA-directed RNA polymerase II subunit RPB11 OS=Bos taurus GN=POLR2J PE=3 SV=1 16 132 3.0E-17
sp|Q7PVQ9|RPB11_ANOGA DNA-directed RNA polymerase II subunit RPB11 OS=Anopheles gambiae GN=Rpb11 PE=3 SV=2 15 132 1.0E-16
sp|Q9H1A7|RPB1C_HUMAN DNA-directed RNA polymerase II subunit RPB11-b2 OS=Homo sapiens GN=POLR2J3 PE=3 SV=1 16 132 5.0E-16
sp|Q9GZM3|RPB1B_HUMAN DNA-directed RNA polymerase II subunit RPB11-b1 OS=Homo sapiens GN=POLR2J2 PE=1 SV=2 16 132 4.0E-15
sp|P87123|RPB11_SCHPO DNA-directed RNA polymerase II subunit RPB11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpb11 PE=1 SV=1 43 145 1.0E-13
sp|Q60SM4|RPB11_CAEBR Probable DNA-directed RNA polymerase II subunit RPB11 OS=Caenorhabditis briggsae GN=rpb-11 PE=3 SV=1 44 128 2.0E-13
sp|P38902|RPB11_YEAST DNA-directed RNA polymerase II subunit RPB11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPB11 PE=1 SV=1 16 141 4.0E-13
sp|Q9XVH6|RPB11_CAEEL Probable DNA-directed RNA polymerase II subunit RPB11 OS=Caenorhabditis elegans GN=rpb-11 PE=3 SV=1 54 147 3.0E-12
sp|Q86JJ5|RPB11_DICDI DNA-directed RNA polymerase II subunit rpb11 OS=Dictyostelium discoideum GN=polr2j PE=3 SV=1 16 147 8.0E-12
sp|Q38859|NRPBB_ARATH DNA-directed RNA polymerases II, IV and V subunit 11 OS=Arabidopsis thaliana GN=NRPB11 PE=1 SV=1 44 143 6.0E-11
sp|A4YHV0|RPOL_METS5 DNA-directed RNA polymerase subunit L OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rpoL PE=3 SV=1 56 137 1.0E-09
sp|Q96YA7|RPOL_SULTO DNA-directed RNA polymerase subunit L OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpoL PE=3 SV=1 51 119 8.0E-09
sp|P46217|RPOL_SULAC DNA-directed RNA polymerase subunit L OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rpoL PE=3 SV=1 62 119 1.0E-08
sp|Q09177|RPAC2_SCHPO DNA-directed RNA polymerases I and III subunit RPAC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpc19 PE=2 SV=1 60 153 2.0E-08
sp|B6YTH7|RPOL_THEON DNA-directed RNA polymerase subunit L OS=Thermococcus onnurineus (strain NA1) GN=rpoL PE=3 SV=1 49 132 3.0E-08
sp|Q9Y2S0|RPAC2_HUMAN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Homo sapiens GN=POLR1D PE=1 SV=1 21 126 4.0E-08
sp|Q1RMG8|RPAC2_BOVIN DNA-directed RNA polymerases I and III subunit RPAC2 OS=Bos taurus GN=POLR1D PE=2 SV=1 21 126 4.0E-08
sp|Q980K0|RPOL_SULSO DNA-directed RNA polymerase subunit L OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpoL PE=1 SV=1 51 121 5.0E-08
sp|Q8U4N1|RPOL_PYRFU DNA-directed RNA polymerase subunit L OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpoL PE=3 SV=1 49 134 5.0E-08
sp|P97304|RPAC2_MOUSE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Mus musculus GN=Polr1d PE=1 SV=1 21 123 7.0E-08
sp|P57671|RPOL_PYRHO DNA-directed RNA polymerase subunit L OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpoL PE=3 SV=1 49 124 2.0E-07
sp|Q5XK67|RPAC2_XENLA DNA-directed RNA polymerases I and III subunit RPAC2 OS=Xenopus laevis GN=polr1d PE=3 SV=1 60 126 3.0E-07
sp|P28000|RPAC2_YEAST DNA-directed RNA polymerases I and III subunit RPAC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPC19 PE=1 SV=1 56 134 3.0E-07
sp|Q9V2M4|RPOL_PYRAB DNA-directed RNA polymerase subunit L OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpoL PE=3 SV=1 59 124 3.0E-07
sp|C3NFY8|RPOL_SULIN DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rpoL PE=3 SV=1 51 121 4.0E-07
sp|C3MZG6|RPOL_SULIA DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain M.16.27) GN=rpoL PE=3 SV=1 51 121 4.0E-07
sp|C4KIP6|RPOL_SULIK DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rpoL PE=3 SV=1 51 121 4.0E-07
sp|C3MRD1|RPOL_SULIL DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rpoL PE=3 SV=1 51 121 4.0E-07
sp|C3MXM0|RPOL_SULIM DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rpoL PE=3 SV=1 51 121 4.0E-07
sp|C3N7I8|RPOL_SULIY DNA-directed RNA polymerase subunit L OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rpoL PE=3 SV=1 51 121 4.0E-07
sp|Q54ES6|RPC19_DICDI DNA-directed RNA polymerases I and III subunit rpc19 OS=Dictyostelium discoideum GN=rpc19 PE=3 SV=1 60 112 6.0E-07
sp|Q5JE88|RPOL_THEKO DNA-directed RNA polymerase subunit L OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpoL PE=1 SV=1 49 124 6.0E-07
sp|C5A5J3|RPOL_THEGJ DNA-directed RNA polymerase subunit L OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpoL PE=3 SV=1 49 132 1.0E-06
sp|Q6DRI4|RPAC2_DANRE DNA-directed RNA polymerases I and III subunit RPAC2 OS=Danio rerio GN=polr1d PE=3 SV=1 60 137 1.0E-06
sp|C6A1R5|RPOL_THESM DNA-directed RNA polymerase subunit L OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpoL PE=3 SV=1 56 124 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0046983 protein dimerization activity Yes
GO:0003899 DNA-directed 5'-3' RNA polymerase activity Yes
GO:0008152 metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016740 transferase activity No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0032774 RNA biosynthetic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0034062 5'-3' RNA polymerase activity No
GO:0009058 biosynthetic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0016070 RNA metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016779 nucleotidyltransferase activity No
GO:1901360 organic cyclic compound metabolic process No
GO:0009059 macromolecule biosynthetic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0097747 RNA polymerase activity No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0005515 protein binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0090304 nucleic acid metabolic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1133
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|703
Ophiocordyceps australis map64 (Brazil) OphauB2|3584
Ophiocordyceps camponoti-floridani Ophcf2|00607
Ophiocordyceps camponoti-rufipedis Ophun1|397 (this protein)
Ophiocordyceps kimflemingae Ophio5|4272
Ophiocordyceps subramaniannii Hirsu2|10193

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|397
MAGCNSRHFNLQDNVFELFLLADGEKKIEEKVYSGMRDYSCLLKRIAADALQGMSNTSDFILNKEDHTLGNLLSE
HLKKHPNVYMAGYKLAHPNVPQLFIRVQTDGSKTPREVFCAVCEKLINQLELLHQAFTREWELRRITNIGEQAMQ
ANGH*
Coding >Ophun1|397
ATGGCTGGTTGCAACTCCCGACACTTCAACCTCCAGGATAACGTCTTCGAACTCTTCCTGCTCGCAGATGGCGAG
AAGAAGATCGAAGAAAAGGTGTACTCTGGTATGAGAGACTATTCCTGCCTTCTCAAACGCATCGCCGCTGATGCC
CTGCAAGGAATGTCCAACACCTCGGATTTCATCCTCAACAAGGAAGATCATACCCTGGGAAATCTTCTCTCCGAG
CATCTCAAGAAACATCCCAACGTTTACATGGCCGGCTACAAGCTCGCCCATCCAAATGTTCCGCAACTTTTCATT
CGTGTTCAGACGGATGGCAGCAAGACGCCCCGTGAAGTCTTTTGTGCCGTCTGCGAAAAGCTCATCAACCAGCTT
GAGTTGTTGCATCAGGCATTCACCCGCGAATGGGAGCTGCGCCGCATCACCAACATTGGTGAGCAGGCCATGCAG
GCTAACGGGCATTAA
Transcript >Ophun1|397
ATGGCTGGTTGCAACTCCCGACACTTCAACCTCCAGGATAACGTCTTCGAACTCTTCCTGCTCGCAGATGGCGAG
AAGAAGATCGAAGAAAAGGTGTACTCTGGTATGAGAGACTATTCCTGCCTTCTCAAACGCATCGCCGCTGATGCC
CTGCAAGGAATGTCCAACACCTCGGATTTCATCCTCAACAAGGAAGATCATACCCTGGGAAATCTTCTCTCCGAG
CATCTCAAGAAACATCCCAACGTTTACATGGCCGGCTACAAGCTCGCCCATCCAAATGTTCCGCAACTTTTCATT
CGTGTTCAGACGGATGGCAGCAAGACGCCCCGTGAAGTCTTTTGTGCCGTCTGCGAAAAGCTCATCAACCAGCTT
GAGTTGTTGCATCAGGCATTCACCCGCGAATGGGAGCTGCGCCGCATCACCAACATTGGTGAGCAGGCCATGCAG
GCTAACGGGCATTAA
Gene >Ophun1|397
ATGGCTGGTTGCAACTCCCGACACTTCAACCTCCAGGATAACGTGTAGCGTCTCGCCCGCGGACCAGCAAAGAAT
GGCATGACCAAAGCACGTCGCCCGCTAATCACGTCTCTAGCTTCGAACTCTTCCTGCTCGCAGATGGCGAGAAGA
AGATCGAAGAAAAGGTGTACTCTGGTATGAGAGACTATTCCTGCCTTCTCAAACGCATCGCCGCTGATGCCCTGC
AAGGAATGTCCAACACCTCGGATTTCATCCTCAACAAGGAAGATCATACCCTGGGAAATCTTCTCTCCGAGCATC
TCAAGAAACATCCCAACGTTTACATGGCCGGCTACAAGCGTATGTTTCGGCCTGCACTTCGCTTCTGTGCCCTCC
GCTGACTGGCATCGCGTTGTCCAGTCGCCCATCCAAATGTTCCGCAACTTTTCATTCGTGTTCAGACGGATGGCA
GCAAGACGCCCCGTGAAGTCTTTTGTGCCGTCTGCGAAAAGCTCATCAACCAGCTTGAGTTGTTGCATCAGGCAT
TCACCCGCGAATGGGAGCTGCGCCGCATCACCAACATTGGTGAGCAGGCCATGCAGGCTAACGGGCATTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail