Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3961
Gene name
LocationContig_36:14226..16266
Strand+
Gene length (bp)2040
Transcript length (bp)1578
Coding sequence length (bp)1578
Protein length (aa) 526

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 6.9E-44 242 492

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U4X9|LCPS_ASPOR Bifunctional lycopene cyclase/phytoene synthase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090020000159 PE=3 SV=1 5 517 1.0E-126
sp|B2WAQ3|LCPS_PYRTR Bifunctional lycopene cyclase/phytoene synthase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_07366 PE=3 SV=1 1 489 2.0E-99
sp|E4UPP6|LCPS_ARTGP Bifunctional lycopene cyclase/phytoene synthase OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02096 PE=3 SV=1 120 510 2.0E-98
sp|D4D802|LCPS_TRIVH Bifunctional lycopene cyclase/phytoene synthase OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03236 PE=3 SV=1 120 510 2.0E-94
sp|B2ATB0|LCPS_PODAN Bifunctional lycopene cyclase/phytoene synthase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_15240 PE=3 SV=1 5 520 7.0E-92
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U4X9|LCPS_ASPOR Bifunctional lycopene cyclase/phytoene synthase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090020000159 PE=3 SV=1 5 517 1.0E-126
sp|B2WAQ3|LCPS_PYRTR Bifunctional lycopene cyclase/phytoene synthase OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=PTRG_07366 PE=3 SV=1 1 489 2.0E-99
sp|E4UPP6|LCPS_ARTGP Bifunctional lycopene cyclase/phytoene synthase OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02096 PE=3 SV=1 120 510 2.0E-98
sp|D4D802|LCPS_TRIVH Bifunctional lycopene cyclase/phytoene synthase OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03236 PE=3 SV=1 120 510 2.0E-94
sp|B2ATB0|LCPS_PODAN Bifunctional lycopene cyclase/phytoene synthase OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PODANS_1_15240 PE=3 SV=1 5 520 7.0E-92
sp|Q8X0Z1|LCPS_GIBFU Bifunctional lycopene cyclase/phytoene synthase OS=Gibberella fujikuroi GN=carRA PE=2 SV=1 5 519 5.0E-90
sp|E3Q717|LCPS_COLGM Bifunctional lycopene cyclase/phytoene synthase OS=Colletotrichum graminicola (strain M1.001 / M2 / FGSC 10212) GN=GLRG_02475 PE=3 SV=1 5 488 3.0E-77
sp|D1Z4K7|LCPS_SORMK Bifunctional lycopene cyclase/phytoene synthase OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=putative al2 PE=3 SV=1 2 489 1.0E-73
sp|A2QM49|LCPS_ASPNC Bifunctional lycopene cyclase/phytoene synthase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An07g00800 PE=3 SV=1 4 395 1.0E-71
sp|E4ZUB5|LCPS_LEPMJ Bifunctional lycopene cyclase/phytoene synthase OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P114090.1 PE=3 SV=1 30 489 9.0E-67
sp|Q0V6M5|LCPS_PHANO Bifunctional lycopene cyclase/phytoene synthase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_00339 PE=3 SV=1 127 489 7.0E-66
sp|P37295|LCPS_NEUCR Bifunctional lycopene cyclase/phytoene synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-2 PE=1 SV=1 127 489 5.0E-62
sp|E4UPP6|LCPS_ARTGP Bifunctional lycopene cyclase/phytoene synthase OS=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) GN=MGYG_02096 PE=3 SV=1 5 111 9.0E-34
sp|D4D802|LCPS_TRIVH Bifunctional lycopene cyclase/phytoene synthase OS=Trichophyton verrucosum (strain HKI 0517) GN=TRV_03236 PE=3 SV=1 5 103 5.0E-32
sp|Q0V6M5|LCPS_PHANO Bifunctional lycopene cyclase/phytoene synthase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=SNOG_00339 PE=3 SV=1 1 109 6.0E-32
sp|E4ZUB5|LCPS_LEPMJ Bifunctional lycopene cyclase/phytoene synthase OS=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) GN=Lema_P114090.1 PE=3 SV=1 1 103 6.0E-29
sp|Q9UUQ6|LCPS_MUCCL Bifunctional lycopene cyclase/phytoene synthase OS=Mucor circinelloides f. lusitanicus GN=CARRP PE=2 SV=1 5 489 1.0E-28
sp|Q67GH9|LCPS_BLATR Bifunctional lycopene cyclase/phytoene synthase OS=Blakeslea trispora GN=carRA PE=1 SV=1 5 489 1.0E-26
sp|Q7Z859|LCPS_PHARH Bifunctional lycopene cyclase/phytoene synthase OS=Phaffia rhodozyma GN=crtYB PE=2 SV=1 127 491 2.0E-26
sp|P37295|LCPS_NEUCR Bifunctional lycopene cyclase/phytoene synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=al-2 PE=1 SV=1 2 123 2.0E-25
sp|Q7Z859|LCPS_PHARH Bifunctional lycopene cyclase/phytoene synthase OS=Phaffia rhodozyma GN=crtYB PE=2 SV=1 5 120 3.0E-15
sp|Q4P0S6|LCPS_USTMA Bifunctional lycopene cyclase/phytoene synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_06287 PE=3 SV=1 125 511 3.0E-15
sp|Q9P854|LCPS_PHYB8 Bifunctional lycopene cyclase/phytoene synthase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=carRA PE=1 SV=1 102 512 6.0E-15
sp|P22872|CRTB_ESCVU Phytoene synthase OS=Escherichia vulneris GN=crtB PE=3 SV=1 319 501 7.0E-14
sp|P17056|CRTB_RHOCB Phytoene synthase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=crtB PE=3 SV=1 243 520 4.0E-12
sp|D5KXJ0|CRTB_ENTAG All-trans-phytoene synthase OS=Enterobacter agglomerans GN=crtB PE=1 SV=1 336 501 8.0E-12
sp|Q4P0S6|LCPS_USTMA Bifunctional lycopene cyclase/phytoene synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_06287 PE=3 SV=1 5 124 1.0E-11
sp|E6ZZ11|LCPS_SPORE Bifunctional lycopene cyclase/phytoene synthase OS=Sporisorium reilianum (strain SRZ2) GN=sr13176 PE=3 SV=1 120 504 1.0E-11
sp|P21683|CRTB_PANAN All-trans-phytoene synthase/15-cis-phytoene synthase OS=Pantoea ananas GN=crtB PE=1 SV=2 218 501 7.0E-11
sp|E6ZZ11|LCPS_SPORE Bifunctional lycopene cyclase/phytoene synthase OS=Sporisorium reilianum (strain SRZ2) GN=sr13176 PE=3 SV=1 5 127 1.0E-10
sp|P54905|CRTB_RHOS4 Phytoene synthase OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=crtB PE=3 SV=2 243 488 2.0E-10
sp|P53797|PSY_NARPS Phytoene synthase, chloroplastic OS=Narcissus pseudonarcissus GN=PSY PE=2 SV=1 243 474 3.0E-10
sp|Q9P854|LCPS_PHYB8 Bifunctional lycopene cyclase/phytoene synthase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=carRA PE=1 SV=1 5 105 4.0E-10
sp|P37273|PSY2_SOLLC Phytoene synthase 2, chloroplastic (Fragment) OS=Solanum lycopersicum GN=PSY2 PE=2 SV=1 292 475 4.0E-10
sp|P37272|PSY_CAPAN Bifunctional 15-cis-phytoene synthase, chromoplastic OS=Capsicum annuum GN=PSY1 PE=1 SV=1 292 475 5.0E-10
sp|P49085|PSY_MAIZE Phytoene synthase, chloroplastic OS=Zea mays GN=Y1 PE=3 SV=1 292 474 2.0E-09
sp|P08196|PSY1_SOLLC Phytoene synthase 1, chloroplastic OS=Solanum lycopersicum GN=PSY1 PE=1 SV=2 292 474 4.0E-09
sp|Q9SSU8|PSY_DAUCA Phytoene synthase, chloroplastic OS=Daucus carota GN=PSY PE=2 SV=1 322 454 4.0E-09
sp|Q52QW5|PSY_ONCHC Phytoene synthase, chloroplastic OS=Oncidium hybrid cultivar GN=PSY PE=2 SV=1 292 475 1.0E-08
sp|P37271|PSY_ARATH Phytoene synthase, chloroplastic OS=Arabidopsis thaliana GN=PSY1 PE=2 SV=2 301 474 2.0E-08
sp|P49293|PSY_CUCME Phytoene synthase, chloroplastic OS=Cucumis melo GN=PSY PE=2 SV=1 292 454 9.0E-08
sp|O07333|CRTY_ARTPT Phytoene synthase OS=Arthrospira platensis GN=crtB PE=3 SV=1 290 484 2.0E-07
sp|P55350|Y4AC_RHISN Putative phytoene synthase OS=Rhizobium sp. (strain NGR234) GN=NGR_a00440 PE=3 SV=1 237 431 3.0E-07
sp|Q9HNE5|CRTY_HALSA Lycopene beta-cyclase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=crtY PE=3 SV=2 35 180 4.0E-07
sp|B0R753|CRTY_HALS3 Lycopene beta-cyclase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=crtY PE=1 SV=1 35 180 4.0E-07
sp|P37269|CRTB_SYNE7 All-trans-phytoene synthase OS=Synechococcus elongatus (strain PCC 7942) GN=crtB PE=1 SV=2 215 520 7.0E-07
sp|P54975|CRTB_PARSN 15-cis-phytoene synthase OS=Paracoccus sp. (strain N81106 / MBIC 01143) GN=crtB PE=1 SV=2 335 489 2.0E-06
sp|P37270|CRTB_THET2 Phytoene synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=crtB PE=3 SV=1 322 520 2.0E-06
sp|P37294|CRTB_SYNY3 All-trans-phytoene synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crtB PE=1 SV=1 322 520 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 29 51 22
3 109 128 19
4 154 176 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3961
MGFAHLTWTVPPAVLMTGLYWPFLTRLELYKILTLIGIAIVATTPWDSYLIRSSIWTYPPDAIAGPTLFSIPLEE
FFFFIVQTYNTSLLYVLSTKPLVLPTYLRRRPRALAVDCVVLAVVFVAAVAAVRRGTWVIEKNTKLDFQVMGSLD
IEEAFFFLITNVLIVMGLVAIDHAVALAEYDAAASPADKLHLPSYGSIMISYLRGRREPLDLVFLQSLADAVDLT
SKKSQSMFIGSAIFEGAYSFYRTVDDLVDEAPDHDAARFAIQQCSEAIKARFGSRWKQADGLQYNWQESVSGLKE
EQLPPCLRSSVAQLPASRLTPEPLSYLLDGMQTDLAFSAPTKNYPIETEKDLERYAYNVAGSVAAAILGLVSHYY
PSTCPELQQRVLQAGEAMGCALQYVNIARDVGRDAAIGRVYMPTSWLRSEGLTAAEVVTDPCRSQVVKLRRRMLE
KAEKTYEANVGAIHELPREIRGPMLTVVDSYLAIGKTVRVLPVESLGWTRKTRLPLLRRLVVVRQALIKAGKRRE
*
Coding >Ophun1|3961
ATGGGATTCGCCCACTTGACGTGGACGGTGCCGCCGGCGGTGCTGATGACGGGCTTATACTGGCCCTTTCTGACC
CGTTTGGAGCTATACAAGATATTGACGCTCATCGGTATTGCAATAGTGGCCACGACGCCGTGGGATTCATATCTC
ATACGAAGCAGCATCTGGACTTACCCCCCCGACGCCATAGCCGGTCCAACGCTCTTCTCCATCCCGCTGGAAGAG
TTCTTCTTCTTCATCGTGCAGACCTACAACACCTCACTTCTCTACGTTCTGTCGACGAAGCCCTTGGTCTTGCCC
ACGTATCTCCGCCGACGGCCGAGGGCGCTGGCAGTCGACTGCGTCGTCTTGGCTGTTGTCTTCGTTGCTGCTGTT
GCGGCTGTGAGGCGCGGAACATGGGTCATCGAGAAGAACACCAAGTTGGATTTCCAAGTAATGGGATCCCTCGAT
ATCGAAGAGGCCTTCTTCTTCCTCATCACAAACGTTCTCATTGTCATGGGCCTCGTCGCCATCGATCACGCCGTA
GCCCTGGCCGAGTACGACGCTGCAGCCTCGCCAGCTGATAAGCTACATCTCCCTTCATACGGAAGCATCATGATT
TCCTACCTCCGAGGCCGAAGAGAACCGCTCGACCTTGTGTTTCTGCAGTCGTTGGCTGACGCTGTTGATCTGACG
TCCAAGAAGAGCCAGAGCATGTTCATCGGAAGCGCCATATTCGAGGGCGCATACTCCTTTTACCGCACCGTCGAT
GATCTCGTCGACGAGGCCCCCGATCACGATGCCGCCAGATTCGCCATCCAGCAGTGCTCCGAGGCCATCAAAGCC
CGCTTCGGCTCTAGATGGAAACAGGCAGACGGCTTGCAGTATAACTGGCAGGAGAGCGTCTCAGGTCTCAAGGAA
GAGCAGCTTCCCCCTTGTCTCCGCTCATCCGTCGCCCAACTCCCAGCTTCGCGTCTTACCCCTGAGCCCCTTTCT
TACCTCTTAGACGGCATGCAGACCGATCTCGCCTTCTCGGCTCCGACGAAGAACTACCCGATTGAGACGGAGAAA
GACTTGGAGAGATACGCCTACAATGTAGCTGGTTCCGTCGCAGCCGCCATCCTCGGCCTCGTCTCTCACTACTAC
CCATCGACCTGTCCGGAACTTCAGCAGCGTGTGCTCCAAGCGGGCGAGGCTATGGGCTGCGCGTTGCAATACGTC
AATATCGCGAGGGACGTCGGTCGTGATGCCGCCATCGGACGCGTCTACATGCCGACCTCGTGGCTTCGCAGCGAG
GGTCTGACGGCAGCCGAGGTCGTGACCGATCCATGCCGGTCACAGGTGGTGAAGCTGAGGCGTAGGATGCTGGAA
AAGGCTGAGAAGACGTACGAGGCTAATGTCGGCGCTATACATGAGCTTCCACGGGAGATTCGTGGGCCTATGTTG
ACGGTTGTGGACAGTTACTTGGCTATTGGAAAGACGGTGAGGGTGTTGCCGGTTGAGTCGTTGGGATGGACGAGG
AAGACGAGGCTGCCTTTGTTGCGGAGGTTGGTTGTTGTGAGGCAGGCCTTGATCAAGGCGGGCAAGAGACGGGAG
TAG
Transcript >Ophun1|3961
ATGGGATTCGCCCACTTGACGTGGACGGTGCCGCCGGCGGTGCTGATGACGGGCTTATACTGGCCCTTTCTGACC
CGTTTGGAGCTATACAAGATATTGACGCTCATCGGTATTGCAATAGTGGCCACGACGCCGTGGGATTCATATCTC
ATACGAAGCAGCATCTGGACTTACCCCCCCGACGCCATAGCCGGTCCAACGCTCTTCTCCATCCCGCTGGAAGAG
TTCTTCTTCTTCATCGTGCAGACCTACAACACCTCACTTCTCTACGTTCTGTCGACGAAGCCCTTGGTCTTGCCC
ACGTATCTCCGCCGACGGCCGAGGGCGCTGGCAGTCGACTGCGTCGTCTTGGCTGTTGTCTTCGTTGCTGCTGTT
GCGGCTGTGAGGCGCGGAACATGGGTCATCGAGAAGAACACCAAGTTGGATTTCCAAGTAATGGGATCCCTCGAT
ATCGAAGAGGCCTTCTTCTTCCTCATCACAAACGTTCTCATTGTCATGGGCCTCGTCGCCATCGATCACGCCGTA
GCCCTGGCCGAGTACGACGCTGCAGCCTCGCCAGCTGATAAGCTACATCTCCCTTCATACGGAAGCATCATGATT
TCCTACCTCCGAGGCCGAAGAGAACCGCTCGACCTTGTGTTTCTGCAGTCGTTGGCTGACGCTGTTGATCTGACG
TCCAAGAAGAGCCAGAGCATGTTCATCGGAAGCGCCATATTCGAGGGCGCATACTCCTTTTACCGCACCGTCGAT
GATCTCGTCGACGAGGCCCCCGATCACGATGCCGCCAGATTCGCCATCCAGCAGTGCTCCGAGGCCATCAAAGCC
CGCTTCGGCTCTAGATGGAAACAGGCAGACGGCTTGCAGTATAACTGGCAGGAGAGCGTCTCAGGTCTCAAGGAA
GAGCAGCTTCCCCCTTGTCTCCGCTCATCCGTCGCCCAACTCCCAGCTTCGCGTCTTACCCCTGAGCCCCTTTCT
TACCTCTTAGACGGCATGCAGACCGATCTCGCCTTCTCGGCTCCGACGAAGAACTACCCGATTGAGACGGAGAAA
GACTTGGAGAGATACGCCTACAATGTAGCTGGTTCCGTCGCAGCCGCCATCCTCGGCCTCGTCTCTCACTACTAC
CCATCGACCTGTCCGGAACTTCAGCAGCGTGTGCTCCAAGCGGGCGAGGCTATGGGCTGCGCGTTGCAATACGTC
AATATCGCGAGGGACGTCGGTCGTGATGCCGCCATCGGACGCGTCTACATGCCGACCTCGTGGCTTCGCAGCGAG
GGTCTGACGGCAGCCGAGGTCGTGACCGATCCATGCCGGTCACAGGTGGTGAAGCTGAGGCGTAGGATGCTGGAA
AAGGCTGAGAAGACGTACGAGGCTAATGTCGGCGCTATACATGAGCTTCCACGGGAGATTCGTGGGCCTATGTTG
ACGGTTGTGGACAGTTACTTGGCTATTGGAAAGACGGTGAGGGTGTTGCCGGTTGAGTCGTTGGGATGGACGAGG
AAGACGAGGCTGCCTTTGTTGCGGAGGTTGGTTGTTGTGAGGCAGGCCTTGATCAAGGCGGGCAAGAGACGGGAG
TAG
Gene >Ophun1|3961
ATGGGATTCGCGTACTGGCTTGTGTAGGTGGCCCCGATTCGTCGTCACAGCTGCGTCTGACCTCGACTAGCCACT
TGACGTGGACGGTGCCGCCGGCGGTGCTGATGACGGGCTTATACTGGCCCTTTCTGACCCGTTTGGAGCTATACA
AGATATTGACGCTCATCGGTGTACGTCGTTGATGCGGCGGATTCTCGCTCGGACGTTGAACTCACGTAGCCATTG
ATAGATTGCAATAGTGGCCACGACGCCGTGGGATTCATATCTCATACGAAGCAGCATCTGGACTTACCCCCCCGA
CGCCATAGCCGGTCCAACGCTCTTCTCCATCCCGCTGGAAGAGTTCTTCTTCTTCATCGTGCAGACCTACAACAC
CTCACTTCTCTACGTTCTGTCGACGAAGCCCTTGGTCTTGCCCACGTATCTCCGCCGACGGCCGAGGGCGCTGGC
AGTCGACTGCGTCGTCTTGGCTGTTGTCTTCGTTGCTGCTGTTGCGGCTGTGAGGGTGGGAGGAAGTGGCACGTA
TATGGGCTTGATTATTGCTTGGGCCACGCCTTTTATTGCGCTTCTTTGGTGAGTAAGTCGTGTGTTGGTTATGGC
TTGTTGGAAGCTGACGATGAAAGGGTTTTTTCTCATCGGTTTTTGCTGGCTCTGCCGAGGAAGACGATTCTCTTC
GTCATCTTGGCTCCCTTTGTTTACCTCTGCTTCGTAGATAATCTTTCCCTACAGCGCGGAACATGGGTCATCGAG
AAGAACACCAAGTTGGATTTCCAAGTAATGGGATCCCTCGATATCGAGTGCGTACAGACTGCTACCTCGTCTCTC
AACCACACTGCTAACACGATACAGAGAGGCCTTCTTCTTCCTCATCACAAACGTTCTCATTGTCATGGGCCTCGT
CGCCATCGATCACGCCGTAGCCCTGGCCGAGTACGACGCTGCAGCCTCGCCAGCTGATAAGCTACATCTCCCTTC
ATACGGAAGCATCATGATTTCCTACCTCCGAGGCCGAAGAGAACCGCTCGACCTTGTGTTTCTGCAGTCGTTGGC
TGACGCTGTTGATCTGACGTCCAAGAAGAGCCAGAGCATGTTCATCGGAAGCGCCATATTCGAGGGCGCGTTACG
TATTGATCTTCTCCGACTGTATGTACGTTCTGACTCGTTTATGTATACTTCTGACGAGGCAGATACTCCTTTTAC
CGCACCGTCGATGATCTCGTCGACGAGGCCCCCGATCACGATGCCGCCAGATTCGCCATCCAGCAGTGCTCCGAG
GCCATCAAAGCCCGCTTCGGCTCTAGATGGAAACAGGCAGACGGCTTGCAGTATAACTGGCAGGAGAGCGTCTCA
GGTCTCAAGGAAGAGCAGCTTCCCCCTTGTCTCCGCTCATCCGTCGCCCAACTCCCAGCTTCGCGTCTTACCCCT
GAGCCCCTTTCTTACCTCTTAGACGGCATGCAGACCGATCTCGCCTTCTCGGCTCCGACGAAGAACTACCCGATT
GAGACGGAGAAAGACTTGGAGAGATACGCCTACAATGTAGCTGGTTCCGTCGCAGCCGCCATCCTCGGCCTCGTC
TCTCACTACTACCCATCGACCTGTCCGGAACTTCAGCAGCGTGTGCTCCAAGCGGGCGAGGCTATGGGCTGCGCG
TTGCAATACGTCAATATCGCGAGGGACGTCGGTCGTGATGCCGCCATCGGACGCGTCTACATGCCGACCTCGTGG
CTTCGCAGCGAGGGTCTGACGGCAGCCGAGGTCGTGACCGATCCATGCCGGTCACAGGTGGTGAAGCTGAGGCGT
AGGATGCTGGAAAAGGCTGAGAAGACGTACGAGGCTAATGTCGGCGCTATACATGAGCTTCCACGGGAGATTCGT
GGGCCTATGTTGACGGTTGTGGACAGTTACTTGGCTATTGGAAAGACGGTGAGGGTGTTGCCGGTTGAGTCGTTG
GGATGGACGAGGAAGACGAGGCTGCCTTTGTTGCGGAGGTTGGTTGTTGTGAGGCAGGCCTTGATCAAGGCGGGC
AAGAGACGGGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail