Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3952
Gene name
LocationContig_359:14692..15858
Strand-
Gene length (bp)1166
Transcript length (bp)1065
Coding sequence length (bp)1065
Protein length (aa) 355

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08542 Rep_fac_C Replication factor C C-terminal domain 2.2E-19 252 338
PF00004 AAA ATPase family associated with various cellular activities (AAA) 4.5E-11 66 183
PF13177 DNA_pol3_delta2 DNA polymerase III, delta subunit 2.3E-06 106 187
PF13173 AAA_14 AAA domain 2.3E-06 65 168

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94449|RFC4_SCHPO Replication factor C subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc4 PE=1 SV=1 16 350 0.0E+00
sp|Q9WUK4|RFC2_MOUSE Replication factor C subunit 2 OS=Mus musculus GN=Rfc2 PE=1 SV=1 9 346 3.0E-164
sp|Q641W4|RFC2_RAT Replication factor C subunit 2 OS=Rattus norvegicus GN=Rfc2 PE=2 SV=1 9 346 4.0E-164
sp|P35250|RFC2_HUMAN Replication factor C subunit 2 OS=Homo sapiens GN=RFC2 PE=1 SV=3 9 346 2.0E-163
sp|Q05B83|RFC2_BOVIN Replication factor C subunit 2 OS=Bos taurus GN=RFC2 PE=2 SV=1 9 346 4.0E-163
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94449|RFC4_SCHPO Replication factor C subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc4 PE=1 SV=1 16 350 0.0E+00
sp|Q9WUK4|RFC2_MOUSE Replication factor C subunit 2 OS=Mus musculus GN=Rfc2 PE=1 SV=1 9 346 3.0E-164
sp|Q641W4|RFC2_RAT Replication factor C subunit 2 OS=Rattus norvegicus GN=Rfc2 PE=2 SV=1 9 346 4.0E-164
sp|P35250|RFC2_HUMAN Replication factor C subunit 2 OS=Homo sapiens GN=RFC2 PE=1 SV=3 9 346 2.0E-163
sp|Q05B83|RFC2_BOVIN Replication factor C subunit 2 OS=Bos taurus GN=RFC2 PE=2 SV=1 9 346 4.0E-163
sp|P53033|RFC2_CHICK Replication factor C subunit 2 OS=Gallus gallus GN=RFC2 PE=2 SV=1 6 346 1.0E-161
sp|P40339|RFC4_YEAST Replication factor C subunit 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC4 PE=1 SV=1 29 343 1.0E-161
sp|Q54E21|RFC2_DICDI Probable replication factor C subunit 2 OS=Dictyostelium discoideum GN=rfc2 PE=3 SV=1 30 347 9.0E-147
sp|Q9CAM7|RFC2_ARATH Replication factor C subunit 2 OS=Arabidopsis thaliana GN=RFC2 PE=1 SV=1 27 339 1.0E-146
sp|P53034|RFC2_DROME Replication factor C subunit 2 OS=Drosophila melanogaster GN=RfC4 PE=2 SV=1 30 340 3.0E-145
sp|Q7XRX1|RFC4_ORYSJ Replication factor C subunit 4 OS=Oryza sativa subsp. japonica GN=RFC4 PE=2 SV=2 25 342 5.0E-145
sp|Q9UXF5|RFCS_SULSO Replication factor C small subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rfcS PE=1 SV=1 29 340 1.0E-83
sp|A3DNV9|RFCS_STAMF Replication factor C small subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rfcS PE=3 SV=1 29 340 6.0E-83
sp|Q975D3|RFCS_SULTO Replication factor C small subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rfcS PE=3 SV=1 29 340 5.0E-82
sp|Q4JAB0|RFCS_SULAC Replication factor C small subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rfcS PE=3 SV=1 29 340 2.0E-81
sp|A6US36|RFCS_METVS Replication factor C small subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rfcS PE=3 SV=1 31 339 9.0E-81
sp|Q9YBS7|RFCS_AERPE Replication factor C small subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcS PE=3 SV=3 25 343 6.0E-78
sp|Q8SQM0|RFC4_ENCCU Replication factor C subunit 4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RFC4 PE=1 SV=1 33 349 6.0E-78
sp|O28219|RFCS_ARCFU Replication factor C small subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rfcS PE=1 SV=1 32 342 1.0E-77
sp|Q9HN27|RFCS_HALSA Replication factor C small subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rfcS PE=3 SV=1 22 340 3.0E-76
sp|B0R7H7|RFCS_HALS3 Replication factor C small subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rfcS PE=3 SV=1 22 340 3.0E-76
sp|A1RWU7|RFCS_THEPD Replication factor C small subunit OS=Thermofilum pendens (strain Hrk 5) GN=rfcS PE=3 SV=1 32 343 4.0E-76
sp|Q6M044|RFCS_METMP Replication factor C small subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=rfcS PE=3 SV=1 31 339 4.0E-76
sp|A9A6K6|RFCS_METM6 Replication factor C small subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rfcS PE=3 SV=1 31 339 4.0E-76
sp|A6VJ61|RFCS_METM7 Replication factor C small subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcS PE=3 SV=1 31 339 6.0E-76
sp|Q46C63|RFCS_METBF Replication factor C small subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcS PE=3 SV=1 32 345 9.0E-76
sp|O26343|RFCS_METTH Replication factor C small subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rfcS PE=1 SV=1 31 341 2.0E-75
sp|Q5UZE5|RFCS_HALMA Replication factor C small subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rfcS PE=3 SV=2 20 341 2.0E-75
sp|A4FZ74|RFCS_METM5 Replication factor C small subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rfcS PE=3 SV=1 31 339 6.0E-75
sp|Q8PVY4|RFCS_METMA Replication factor C small subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rfcS PE=3 SV=1 32 340 2.0E-74
sp|Q3ITJ2|RFCS_NATPD Replication factor C small subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rfcS PE=3 SV=1 20 326 3.0E-74
sp|Q8TSX5|RFCS_METAC Replication factor C small subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rfcS PE=3 SV=1 32 340 3.0E-73
sp|A2SQT3|RFCS_METLZ Replication factor C small subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rfcS PE=3 SV=1 32 345 3.0E-72
sp|Q0W037|RFCS_METAR Replication factor C small subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcS PE=3 SV=1 32 339 1.0E-71
sp|Q2NH89|RFCS_METST Replication factor C small subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rfcS PE=3 SV=1 31 345 3.0E-71
sp|Q9HI47|RFCS_THEAC Replication factor C small subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rfcS PE=3 SV=2 32 342 5.0E-71
sp|A7I8Y0|RFCS_METB6 Replication factor C small subunit OS=Methanoregula boonei (strain 6A8) GN=rfcS PE=3 SV=1 32 339 2.0E-70
sp|A5UMF3|RFCS_METS3 Replication factor C small subunit OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rfcS PE=3 SV=1 31 339 8.0E-70
sp|A3CUX9|RFCS_METMJ Replication factor C small subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rfcS PE=3 SV=1 27 339 6.0E-69
sp|Q977Z9|RFCS_THEVO Replication factor C small subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rfcS PE=3 SV=2 32 342 2.0E-67
sp|P60374|RFCS_NANEQ Replication factor C small subunit OS=Nanoarchaeum equitans (strain Kin4-M) GN=rfcS PE=3 SV=1 32 339 3.0E-67
sp|A1RV38|RFCS2_PYRIL Replication factor C small subunit 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS2 PE=3 SV=1 29 342 1.0E-66
sp|A4WLY0|RFCS2_PYRAR Replication factor C small subunit 2 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcS2 PE=3 SV=1 29 342 5.0E-66
sp|O74111|RFC3_BLAAD Replication factor C subunit 3 OS=Blastobotrys adeninivorans GN=RFC3 PE=3 SV=1 30 273 6.0E-66
sp|Q8ZWS2|RFCS2_PYRAE Replication factor C small subunit 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS2 PE=3 SV=1 29 342 6.0E-66
sp|A4WGV2|RFCS1_PYRAR Replication factor C small subunit 1 OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcS1 PE=3 SV=1 29 325 1.0E-65
sp|Q2FQT9|RFCS_METHJ Replication factor C small subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rfcS PE=3 SV=1 32 340 1.0E-65
sp|Q5UQ47|RFCS1_MIMIV Putative replication factor C small subunit R395 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R395 PE=3 SV=1 30 341 3.0E-65
sp|A1RSA2|RFCS1_PYRIL Replication factor C small subunit 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS1 PE=3 SV=1 29 342 5.0E-65
sp|Q6L1I0|RFCS_PICTO Replication factor C small subunit OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rfcS PE=3 SV=1 32 342 3.0E-64
sp|Q54MD4|RFC4_DICDI Probable replication factor C subunit 4 OS=Dictyostelium discoideum GN=rfc4 PE=3 SV=1 31 332 3.0E-63
sp|Q8ZYK4|RFCS1_PYRAE Replication factor C small subunit 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS1 PE=3 SV=1 29 342 4.0E-63
sp|P40937|RFC5_HUMAN Replication factor C subunit 5 OS=Homo sapiens GN=RFC5 PE=1 SV=1 12 337 5.0E-63
sp|Q9FXM3|RFC2_ORYSJ Replication factor C subunit 2 OS=Oryza sativa subsp. japonica GN=RFC2 PE=2 SV=1 31 332 6.0E-62
sp|Q6YZ54|RFC3_ORYSJ Replication factor C subunit 3 OS=Oryza sativa subsp. japonica GN=RFC3 PE=2 SV=1 22 337 8.0E-62
sp|Q9D0F6|RFC5_MOUSE Replication factor C subunit 5 OS=Mus musculus GN=Rfc5 PE=1 SV=1 30 337 2.0E-61
sp|P38629|RFC3_YEAST Replication factor C subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC3 PE=1 SV=1 18 337 2.0E-61
sp|P35249|RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens GN=RFC4 PE=1 SV=2 20 332 2.0E-61
sp|Q9CAQ8|RFC5_ARATH Replication factor C subunit 5 OS=Arabidopsis thaliana GN=RFC5 PE=1 SV=1 31 337 2.0E-61
sp|A3MS28|RFCS_PYRCJ Replication factor C small subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcS PE=3 SV=1 29 348 3.0E-61
sp|Q93ZX1|RFC4_ARATH Replication factor C subunit 4 OS=Arabidopsis thaliana GN=RFC4 PE=2 SV=1 31 332 4.0E-61
sp|P34429|RFC5_CAEEL Probable replication factor C subunit 5 OS=Caenorhabditis elegans GN=F44B9.8 PE=3 SV=3 25 291 5.0E-61
sp|Q5JHP2|RFCS_THEKO Replication factor C small subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcS PE=1 SV=1 61 340 3.0E-60
sp|O57852|RFCS_PYRHO Replication factor C small subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcS PE=3 SV=1 61 340 8.0E-60
sp|Q8U4J3|RFCS_PYRFU Replication factor C small subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcS PE=1 SV=1 61 342 1.0E-59
sp|Q99J62|RFC4_MOUSE Replication factor C subunit 4 OS=Mus musculus GN=Rfc4 PE=1 SV=1 24 332 2.0E-59
sp|O14003|RFC3_SCHPO Replication factor C subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc3 PE=1 SV=2 30 339 4.0E-58
sp|Q09843|RFC2_SCHPO Replication factor C subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc2 PE=1 SV=1 30 332 6.0E-58
sp|Q54ST4|RFC5_DICDI Probable replication factor C subunit 5 OS=Dictyostelium discoideum GN=rfc5 PE=3 SV=1 30 293 3.0E-57
sp|P40348|RFC2_YEAST Replication factor C subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC2 PE=1 SV=1 11 245 5.0E-54
sp|P0C7N7|RFC2_PHANO Replication factor C subunit 2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RFC2 PE=3 SV=1 31 232 4.0E-52
sp|Q18E75|RFCS_HALWD Replication factor C small subunit OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rfcS PE=3 SV=1 87 340 6.0E-51
sp|Q5UP47|RFCS3_MIMIV Putative replication factor C small subunit L499 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L499 PE=3 SV=1 29 318 3.0E-50
sp|Q8TZC4|RFCS_METKA Replication factor C small subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcS PE=3 SV=1 99 339 7.0E-47
sp|Q5UQ72|RFCS4_MIMIV Putative replication factor C small subunit L510 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R510 PE=3 SV=1 30 239 4.0E-45
sp|P53016|RFC4_CAEEL Replication factor C subunit 4 OS=Caenorhabditis elegans GN=rfc-4 PE=1 SV=1 30 232 4.0E-44
sp|Q9V2G4|RFCS_PYRAB Replication factor C small subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcS PE=1 SV=1 165 342 3.0E-27
sp|A7I781|RFCL_METB6 Replication factor C large subunit OS=Methanoregula boonei (strain 6A8) GN=rfcL PE=3 SV=1 30 245 6.0E-27
sp|Q58817|RFCS_METJA Replication factor C small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcS PE=3 SV=1 165 339 4.0E-26
sp|Q9V2G3|RFCL_PYRAB Replication factor C large subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcL PE=1 SV=3 29 236 1.0E-25
sp|Q5JHP1|RFCL_THEKO Replication factor C large subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcL PE=1 SV=1 29 236 4.0E-25
sp|Q54BN3|RFC3_DICDI Probable replication factor C subunit 3 OS=Dictyostelium discoideum GN=rfc3 PE=3 SV=1 32 342 1.0E-24
sp|A0B6D7|RFCL_METTP Replication factor C large subunit OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rfcL PE=3 SV=1 32 251 1.0E-23
sp|Q9UWR2|RFCL_PYRFU Replication factor C large subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcL PE=1 SV=1 29 250 1.0E-23
sp|O57853|RFCL_PYRHO Replication factor C large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcL PE=3 SV=1 29 250 3.0E-23
sp|Q8VXX4|RFC3_ARATH Replication factor C subunit 3 OS=Arabidopsis thaliana GN=RFC3 PE=2 SV=1 32 250 5.0E-23
sp|Q8TPU4|RFCL_METAC Replication factor C large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rfcL PE=3 SV=1 30 290 2.0E-22
sp|Q8X082|RFC5_NEUCR Replication factor C subunit 5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B14D6.460 PE=3 SV=1 33 342 3.0E-22
sp|Q9V2G4|RFCS_PYRAB Replication factor C small subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcS PE=1 SV=1 61 196 4.0E-22
sp|Q852K3|RFC5_ORYSJ Replication factor C subunit 5 OS=Oryza sativa subsp. japonica GN=RFC5 PE=2 SV=1 32 227 6.0E-22
sp|O94697|RFC5_SCHPO Replication factor C subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc5 PE=1 SV=1 32 235 7.0E-22
sp|Q8Q084|RFCL_METMA Replication factor C large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rfcL PE=3 SV=1 32 290 8.0E-22
sp|Q2TBV1|RFC3_BOVIN Replication factor C subunit 3 OS=Bos taurus GN=RFC3 PE=2 SV=1 32 183 3.0E-21
sp|P04526|DPA44_BPT4 Sliding-clamp-loader gp44 subunit OS=Enterobacteria phage T4 GN=44 PE=1 SV=1 34 232 3.0E-21
sp|P40938|RFC3_HUMAN Replication factor C subunit 3 OS=Homo sapiens GN=RFC3 PE=1 SV=2 32 183 8.0E-21
sp|Q8R323|RFC3_MOUSE Replication factor C subunit 3 OS=Mus musculus GN=Rfc3 PE=1 SV=1 32 183 1.0E-20
sp|A6UWR5|RFCL_META3 Replication factor C large subunit OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rfcL PE=3 SV=1 30 279 2.0E-20
sp|Q5V1F7|RFCL_HALMA Replication factor C large subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rfcL PE=3 SV=1 30 232 2.0E-20
sp|Q2NH88|RFCL_METST Replication factor C large subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rfcL PE=3 SV=1 30 232 3.0E-20
sp|Q46AT6|RFCL_METBF Replication factor C large subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcL PE=3 SV=1 30 320 4.0E-20
sp|A1RWU6|RFCL_THEPD Replication factor C large subunit OS=Thermofilum pendens (strain Hrk 5) GN=rfcL PE=3 SV=1 30 241 5.0E-20
sp|Q2FQR4|RFCL_METHJ Replication factor C large subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rfcL PE=3 SV=1 30 245 5.0E-20
sp|A2SQR6|RFCL_METLZ Replication factor C large subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rfcL PE=3 SV=1 30 250 7.0E-20
sp|Q8TZC4|RFCS_METKA Replication factor C small subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcS PE=3 SV=1 29 102 1.0E-19
sp|A2BL93|RFCL_HYPBU Replication factor C large subunit OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rfcL PE=3 SV=1 29 245 1.0E-19
sp|P38251|RFC5_YEAST Replication factor C subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC5 PE=1 SV=1 32 232 1.0E-19
sp|O64301|DPA44_BPR69 DNA polymerase accessory protein 44 OS=Enterobacteria phage RB69 GN=44 PE=4 SV=1 34 242 2.0E-19
sp|A3CTR4|RFCL_METMJ Replication factor C large subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rfcL PE=3 SV=1 30 245 2.0E-19
sp|Q9HPI4|RFCL_HALSA Replication factor C large subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rfcL PE=3 SV=2 30 232 3.0E-19
sp|B0R601|RFCL_HALS3 Replication factor C large subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rfcL PE=3 SV=1 30 232 3.0E-19
sp|Q8TZC5|RFCL_METKA Replication factor C large subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcL PE=3 SV=1 30 290 5.0E-19
sp|O26342|RFCL_METTH Replication factor C large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rfcL PE=1 SV=1 30 236 6.0E-19
sp|Q975D4|RFCL_SULTO Replication factor C large subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rfcL PE=3 SV=2 30 243 9.0E-19
sp|Q0W3P4|RFCL_METAR Replication factor C large subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcL PE=3 SV=1 32 310 1.0E-18
sp|A5UMF4|RFCL_METS3 Replication factor C large subunit OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rfcL PE=3 SV=1 32 232 2.0E-18
sp|O29072|RFCL_ARCFU Replication factor C large subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rfcL PE=1 SV=1 32 246 2.0E-18
sp|Q3ISA5|RFCL_NATPD Replication factor C large subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rfcL PE=3 SV=1 32 232 3.0E-18
sp|Q9YBS5|RFCL_AERPE Replication factor C large subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcL PE=3 SV=2 30 241 2.0E-17
sp|Q18GQ9|RFCL_HALWD Replication factor C large subunit OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rfcL PE=3 SV=1 32 245 2.0E-17
sp|Q12TX1|RFCL_METBU Replication factor C large subunit OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rfcL PE=3 SV=1 30 236 6.0E-17
sp|P09122|DPO3X_BACSU DNA polymerase III subunit gamma/tau OS=Bacillus subtilis (strain 168) GN=dnaX PE=3 SV=3 36 303 1.0E-16
sp|Q4JAB1|RFCL_SULAC Replication factor C large subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rfcL PE=3 SV=1 30 249 1.0E-16
sp|Q2R2B4|RFC1_ORYSJ Replication factor C subunit 1 OS=Oryza sativa subsp. japonica GN=RFC1 PE=2 SV=2 30 251 2.0E-16
sp|B9LPV1|RFCL_HALLT Replication factor C large subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rfcL PE=3 SV=1 32 245 3.0E-16
sp|Q5UQE8|RFCS2_MIMIV Putative replication factor C small subunit L478 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L478 PE=3 SV=1 32 179 4.0E-16
sp|C3NE95|RFCL_SULIY Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rfcL PE=3 SV=1 30 245 6.0E-16
sp|C3MQ13|RFCL_SULIL Replication factor C large subunit OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rfcL PE=3 SV=1 30 245 6.0E-16
sp|Q9C587|RFC1_ARATH Replication factor C subunit 1 OS=Arabidopsis thaliana GN=RFC1 PE=2 SV=1 30 245 8.0E-16
sp|Q9UXF6|RFCL_SULSO Replication factor C large subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rfcL PE=1 SV=1 30 241 1.0E-15
sp|C3NHF4|RFCL_SULIN Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rfcL PE=3 SV=1 30 245 1.0E-15
sp|A9A6N2|RFCL_METM6 Replication factor C large subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rfcL PE=3 SV=1 32 236 1.0E-15
sp|A3DNV8|RFCL_STAMF Replication factor C large subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rfcL PE=3 SV=1 30 273 2.0E-15
sp|Q6M0E9|RFCL_METMP Replication factor C large subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=rfcL PE=3 SV=1 32 236 2.0E-15
sp|Q58294|RFCL_METJA Replication factor C large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcL PE=1 SV=1 30 232 2.0E-15
sp|C3MVD2|RFCL_SULIM Replication factor C large subunit OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rfcL PE=3 SV=1 30 245 3.0E-15
sp|C3N5N1|RFCL_SULIA Replication factor C large subunit OS=Sulfolobus islandicus (strain M.16.27) GN=rfcL PE=3 SV=1 30 245 3.0E-15
sp|A6VIW1|RFCL_METM7 Replication factor C large subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcL PE=3 SV=1 32 236 3.0E-15
sp|C4KHA7|RFCL_SULIK Replication factor C large subunit OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rfcL PE=3 SV=1 30 245 4.0E-15
sp|B1YC69|RFCL_PYRNV Replication factor C large subunit OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rfcL PE=3 SV=1 30 236 5.0E-15
sp|A1RSA3|RFCL_PYRIL Replication factor C large subunit OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcL PE=3 SV=1 30 248 8.0E-15
sp|A3MS27|RFCL_PYRCJ Replication factor C large subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcL PE=3 SV=1 30 245 1.0E-14
sp|A8AC24|RFCL_IGNH4 Replication factor C large subunit OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rfcL PE=3 SV=1 30 243 1.0E-14
sp|Q8ZYK3|RFCL_PYRAE Replication factor C large subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcL PE=3 SV=1 30 236 1.0E-14
sp|A6URV8|RFCL_METVS Replication factor C large subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rfcL PE=3 SV=1 32 236 2.0E-14
sp|P75177|DPO3X_MYCPN DNA polymerase III subunit gamma/tau OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaX PE=3 SV=1 34 230 4.0E-14
sp|A4WGV3|RFCL_PYRAR Replication factor C large subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcL PE=3 SV=1 30 236 9.0E-14
sp|Q54MH9|RFC1_DICDI Probable replication factor C subunit 1 OS=Dictyostelium discoideum GN=rfc1 PE=3 SV=1 27 245 9.0E-14
sp|F4HW65|STIL1_ARATH Protein STICHEL-like 1 OS=Arabidopsis thaliana GN=At1g14460 PE=1 SV=1 34 226 1.0E-13
sp|A4FZL6|RFCL_METM5 Replication factor C large subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rfcL PE=3 SV=1 32 236 1.0E-13
sp|O60182|RFC1_SCHPO Replication factor C subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc1 PE=1 SV=1 32 234 4.0E-13
sp|Q58817|RFCS_METJA Replication factor C small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcS PE=3 SV=1 99 197 5.0E-13
sp|P60373|RFCL_NANEQ Replication factor C large subunit OS=Nanoarchaeum equitans (strain Kin4-M) GN=rfcL PE=3 SV=1 29 232 3.0E-12
sp|Q9WYX8|Y508_THEMA Uncharacterized protein TM_0508 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=TM_0508 PE=3 SV=1 29 237 1.0E-11
sp|P38630|RFC1_YEAST Replication factor C subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC1 PE=1 SV=1 32 230 5.0E-11
sp|P57553|DPO3X_BUCAI DNA polymerase III subunit gamma OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=dnaX PE=3 SV=1 35 302 2.0E-10
sp|Q58817|RFCS_METJA Replication factor C small subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcS PE=3 SV=1 29 76 4.0E-10
sp|P43746|DPO3X_HAEIN DNA polymerase III subunit tau/gamma OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaX PE=3 SV=1 35 228 4.0E-10
sp|Q8U4J3|RFCS_PYRFU Replication factor C small subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcS PE=1 SV=1 29 76 5.0E-10
sp|O64728|STI_ARATH Protein STICHEL OS=Arabidopsis thaliana GN=STI PE=1 SV=2 34 226 1.0E-09
sp|Q5JHP2|RFCS_THEKO Replication factor C small subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcS PE=1 SV=1 29 76 2.0E-09
sp|O57852|RFCS_PYRHO Replication factor C small subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcS PE=3 SV=1 29 76 2.0E-09
sp|P47658|DPO3X_MYCGE DNA polymerase III subunit gamma/tau OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaX PE=3 SV=3 32 326 3.0E-09
sp|P06710|DPO3X_ECOLI DNA polymerase III subunit tau OS=Escherichia coli (strain K12) GN=dnaX PE=1 SV=1 35 294 4.0E-09
sp|Q9V2G4|RFCS_PYRAB Replication factor C small subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcS PE=1 SV=1 29 76 9.0E-09
sp|Q8K983|DPO3X_BUCAP DNA polymerase III subunit gamma OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=dnaX PE=3 SV=1 35 309 9.0E-09
sp|Q9HIP7|RFCL_THEAC Replication factor C large subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rfcL PE=3 SV=1 30 281 1.0E-08
sp|P35251|RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens GN=RFC1 PE=1 SV=4 6 230 3.0E-08
sp|P74876|DPO3X_SALTY DNA polymerase III subunit tau OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaX PE=3 SV=2 35 294 4.0E-08
sp|P35600|RFC1_DROME Replication factor C subunit 1 OS=Drosophila melanogaster GN=Gnf1 PE=1 SV=2 30 230 8.0E-08
sp|P35601|RFC1_MOUSE Replication factor C subunit 1 OS=Mus musculus GN=Rfc1 PE=1 SV=2 3 230 1.0E-07
sp|P9WNT9|DPO3X_MYCTU DNA polymerase III subunit gamma/tau OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dnaX PE=1 SV=1 35 236 2.0E-07
sp|P9WNT8|DPO3X_MYCTO DNA polymerase III subunit gamma/tau OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dnaX PE=3 SV=1 35 236 2.0E-07
sp|P63976|DPO3X_MYCBO DNA polymerase III subunit gamma/tau OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaX PE=3 SV=1 35 236 2.0E-07
sp|Q8CG07|WRIP1_RAT ATPase WRNIP1 OS=Rattus norvegicus GN=Wrnip1 PE=1 SV=1 31 231 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2552
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7604
Ophiocordyceps australis map64 (Brazil) OphauB2|3635
Ophiocordyceps camponoti-floridani Ophcf2|05058
Ophiocordyceps camponoti-rufipedis Ophun1|3952 (this protein)
Ophiocordyceps kimflemingae Ophio5|4583
Ophiocordyceps subramaniannii Hirsu2|3779

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3952
MPPKKAVEERGESSKAALAAQSNGSSGYELPWVEKYRPLFLDDVVGNTETIERLKIIAREGNMPHVIISGMPGIG
KTTSVLCLARQMLGDCYKEAVLELNASDERGIDVVRNRIKGFAQKKVTLPPGRHKLVILDEADSMTSGAQQALRR
TMEIYSNTTRFAFACNQSNKIIEPLQSRCAILRYAKLTDGQVVKRLMQIIEAEKVEYSDEGLAALVFSAEGDMRQ
AINNLQSTYAGFGFVSGDNVFKVVDSPHPIKVQAMLKACYETNVDSALDVLRELWGLGYSSHDIISTMFRVTKTM
PTLSEHTKLEFIKEIGFTHMKILEGVQTLLQLSGCVARLCKINMDPKRFIPPSR*
Coding >Ophun1|3952
ATGCCGCCCAAAAAGGCCGTCGAGGAACGAGGCGAATCGTCCAAGGCAGCTCTCGCCGCGCAATCCAACGGCTCA
TCAGGTTACGAGCTACCATGGGTGGAAAAATACCGGCCGCTGTTCCTCGACGATGTCGTCGGCAATACGGAGACG
ATTGAGCGCCTCAAGATCATCGCTCGTGAGGGCAACATGCCGCACGTCATCATCTCCGGCATGCCGGGCATCGGG
AAGACGACGAGCGTGCTATGCCTGGCGCGCCAGATGCTAGGCGATTGCTACAAGGAGGCCGTGCTGGAGCTCAAT
GCTAGTGACGAACGCGGCATCGACGTTGTTCGGAATAGGATCAAGGGCTTCGCGCAGAAAAAGGTGACGCTGCCG
CCGGGCAGACACAAGCTCGTCATCCTCGACGAGGCAGACAGCATGACATCCGGCGCGCAACAGGCATTACGGCGC
ACCATGGAAATCTACTCCAACACCACTCGCTTCGCCTTCGCCTGCAACCAGTCAAACAAGATCATCGAGCCGCTC
CAATCCCGCTGCGCCATCCTCCGCTACGCCAAGCTCACCGACGGCCAGGTCGTCAAACGGCTTATGCAAATCATC
GAAGCCGAAAAAGTCGAGTACAGCGACGAAGGGCTGGCTGCCCTCGTCTTCAGCGCAGAGGGCGACATGCGACAA
GCCATCAACAACCTGCAGTCCACATACGCCGGCTTCGGCTTCGTCTCGGGCGACAACGTCTTCAAGGTGGTTGAC
TCGCCGCACCCCATCAAGGTGCAAGCCATGCTCAAGGCCTGCTACGAGACAAACGTCGACTCTGCTCTCGACGTG
CTGCGCGAGCTCTGGGGGCTGGGCTACTCGAGTCACGATATCATCAGCACCATGTTCCGCGTCACCAAGACGATG
CCGACGCTGAGCGAGCACACCAAGCTCGAGTTCATCAAGGAGATTGGCTTCACGCACATGAAGATTCTCGAGGGG
GTTCAGACGCTGTTGCAGCTTAGCGGCTGTGTAGCTCGTCTCTGTAAGATCAATATGGACCCGAAGCGGTTCATC
CCGCCTTCGCGATGA
Transcript >Ophun1|3952
ATGCCGCCCAAAAAGGCCGTCGAGGAACGAGGCGAATCGTCCAAGGCAGCTCTCGCCGCGCAATCCAACGGCTCA
TCAGGTTACGAGCTACCATGGGTGGAAAAATACCGGCCGCTGTTCCTCGACGATGTCGTCGGCAATACGGAGACG
ATTGAGCGCCTCAAGATCATCGCTCGTGAGGGCAACATGCCGCACGTCATCATCTCCGGCATGCCGGGCATCGGG
AAGACGACGAGCGTGCTATGCCTGGCGCGCCAGATGCTAGGCGATTGCTACAAGGAGGCCGTGCTGGAGCTCAAT
GCTAGTGACGAACGCGGCATCGACGTTGTTCGGAATAGGATCAAGGGCTTCGCGCAGAAAAAGGTGACGCTGCCG
CCGGGCAGACACAAGCTCGTCATCCTCGACGAGGCAGACAGCATGACATCCGGCGCGCAACAGGCATTACGGCGC
ACCATGGAAATCTACTCCAACACCACTCGCTTCGCCTTCGCCTGCAACCAGTCAAACAAGATCATCGAGCCGCTC
CAATCCCGCTGCGCCATCCTCCGCTACGCCAAGCTCACCGACGGCCAGGTCGTCAAACGGCTTATGCAAATCATC
GAAGCCGAAAAAGTCGAGTACAGCGACGAAGGGCTGGCTGCCCTCGTCTTCAGCGCAGAGGGCGACATGCGACAA
GCCATCAACAACCTGCAGTCCACATACGCCGGCTTCGGCTTCGTCTCGGGCGACAACGTCTTCAAGGTGGTTGAC
TCGCCGCACCCCATCAAGGTGCAAGCCATGCTCAAGGCCTGCTACGAGACAAACGTCGACTCTGCTCTCGACGTG
CTGCGCGAGCTCTGGGGGCTGGGCTACTCGAGTCACGATATCATCAGCACCATGTTCCGCGTCACCAAGACGATG
CCGACGCTGAGCGAGCACACCAAGCTCGAGTTCATCAAGGAGATTGGCTTCACGCACATGAAGATTCTCGAGGGG
GTTCAGACGCTGTTGCAGCTTAGCGGCTGTGTAGCTCGTCTCTGTAAGATCAATATGGACCCGAAGCGGTTCATC
CCGCCTTCGCGATGA
Gene >Ophun1|3952
ATGCCGCCCAAAAAGGCCGTCGAGGAACGAGGCGAATCGTCCAAGGCAGCTCTCGCCGCGCAATCCAACGGCTCA
TCAGGTTACGAGCTACCATGGTGAGTGTCTTCGATACATCGAGACCAACGACGGAGTTGACGCGCGCAACAGGGT
GGAAAAATACCGGCCGCTGTTCCTCGACGATGTCGTCGGCAATACGGAGACGATTGAGCGCCTCAAGATCATCGC
TCGTGAGGGCAACATGCCGCACGTCATCATCTCCGGCATGCCGGGCATCGGGAAGACGACGAGCGTGCTATGCCT
GGCGCGCCAGATGCTAGGCGATTGCTACAAGGAGGCCGTGCTGGAGCTCAATGCTAGTGACGAACGCGGTGCGTC
TCGAGATTTTTCTCTTTCTGAGCATCTACTAATTCCAACTAGGCATCGACGTTGTTCGGAATAGGATCAAGGGCT
TCGCGCAGAAAAAGGTGACGCTGCCGCCGGGCAGACACAAGCTCGTCATCCTCGACGAGGCAGACAGCATGACAT
CCGGCGCGCAACAGGCATTACGGCGCACCATGGAAATCTACTCCAACACCACTCGCTTCGCCTTCGCCTGCAACC
AGTCAAACAAGATCATCGAGCCGCTCCAATCCCGCTGCGCCATCCTCCGCTACGCCAAGCTCACCGACGGCCAGG
TCGTCAAACGGCTTATGCAAATCATCGAAGCCGAAAAAGTCGAGTACAGCGACGAAGGGCTGGCTGCCCTCGTCT
TCAGCGCAGAGGGCGACATGCGACAAGCCATCAACAACCTGCAGTCCACATACGCCGGCTTCGGCTTCGTCTCGG
GCGACAACGTCTTCAAGGTGGTTGACTCGCCGCACCCCATCAAGGTGCAAGCCATGCTCAAGGCCTGCTACGAGA
CAAACGTCGACTCTGCTCTCGACGTGCTGCGCGAGCTCTGGGGGCTGGGCTACTCGAGTCACGATATCATCAGCA
CCATGTTCCGCGTCACCAAGACGATGCCGACGCTGAGCGAGCACACCAAGCTCGAGTTCATCAAGGAGATTGGCT
TCACGCACATGAAGATTCTCGAGGGGGTTCAGACGCTGTTGCAGCTTAGCGGCTGTGTAGCTCGTCTCTGTAAGA
TCAATATGGACCCGAAGCGGTTCATCCCGCCTTCGCGATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail