Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3950
Gene name
LocationContig_359:6954..9792
Strand-
Gene length (bp)2838
Transcript length (bp)1842
Coding sequence length (bp)1842
Protein length (aa) 614

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04511 DER1 Der1-like family 2.8E-18 3 182

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BNI4|DERL2_MOUSE Derlin-2 OS=Mus musculus GN=Derl2 PE=1 SV=2 2 181 2.0E-13
sp|Q5RC74|DERL2_PONAB Derlin-2 OS=Pongo abelii GN=DERL2 PE=2 SV=1 3 181 4.0E-13
sp|Q9GZP9|DERL2_HUMAN Derlin-2 OS=Homo sapiens GN=DERL2 PE=1 SV=1 3 181 4.0E-13
sp|Q96Q80|DERL3_HUMAN Derlin-3 OS=Homo sapiens GN=DERL3 PE=1 SV=2 3 181 6.0E-10
sp|Q0P5E4|DERL3_BOVIN Derlin-3 OS=Bos taurus GN=DERL3 PE=2 SV=1 4 181 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BNI4|DERL2_MOUSE Derlin-2 OS=Mus musculus GN=Derl2 PE=1 SV=2 2 181 2.0E-13
sp|Q5RC74|DERL2_PONAB Derlin-2 OS=Pongo abelii GN=DERL2 PE=2 SV=1 3 181 4.0E-13
sp|Q9GZP9|DERL2_HUMAN Derlin-2 OS=Homo sapiens GN=DERL2 PE=1 SV=1 3 181 4.0E-13
sp|Q96Q80|DERL3_HUMAN Derlin-3 OS=Homo sapiens GN=DERL3 PE=1 SV=2 3 181 6.0E-10
sp|Q0P5E4|DERL3_BOVIN Derlin-3 OS=Bos taurus GN=DERL3 PE=2 SV=1 4 181 1.0E-09
sp|Q9D8K3|DERL3_MOUSE Derlin-3 OS=Mus musculus GN=Derl3 PE=1 SV=1 4 181 2.0E-09
sp|Q851X7|DERL2_ORYSJ Derlin-2 OS=Oryza sativa subsp. japonica GN=DER2 PE=2 SV=1 3 180 5.0E-06
sp|Q4G2J3|DER22_MAIZE Derlin-2.2 OS=Zea mays GN=DER2.2 PE=2 SV=1 3 180 5.0E-06
sp|Q8VZU9|DERL1_ARATH Derlin-1 OS=Arabidopsis thaliana GN=DER1 PE=2 SV=1 3 189 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 37 59 22
3 79 101 22
4 127 149 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3950
MATAAFLTSVGVYTSLIPGYWVVFHPQFLWRFPPQIWRFLTAFLLTGPELSMLFDTYFVYSYLSQLEAGNPRFSR
KEDLLWYLTFCGGTIMMMNYVSGLGFTTFLQALNLAMCYTVTQDQRGMKANLMFVTIPAPMTPFAMLAFNLLFPN
GVRSMLLQLLGLLSAHLFDFLTRIWPEIKGGHLGCGAKWRLKRAFAGFMEDSGARATVGMRRWLVWNFFSTLHRF
PFLIAGLLPLVSAGESLDFAEDWTLRQVSRTLPSDKEVLLGFLITSEGYDPQWCYLLAQVSPPSRASSWVNEPCI
GTNFTTSWGYRAQEDAGILALLNTRSNRIAWFGWNDINASNGLGDVGPNATKMLRDFDPDDTESDGQDCDESDKA
NDVEASTNKSNDAQEKGPDETKDKEPNDPKDKGPNDPKDKVPNDSKDKGDEDDCKCRNPTIARRSEDDDVVDAQD
NEPDTDVDDEASNDKPIGARDNEADHDKVNEDEDDCKCRNPTISRRKEEDSNKAQDNGADDNEVDEDEAGEDRSI
KARGECRHHSMVNDGAKFHDPTITRRKEDESNDAQVEGPDDNEVNQEKAGEGKPIEAHDECPHHPQVKDGEKFHD
PTITQRRARSFVA*
Coding >Ophun1|3950
ATGGCGACAGCTGCCTTCCTCACATCCGTCGGCGTCTATACCAGTCTCATCCCCGGGTACTGGGTCGTCTTCCAC
CCTCAGTTTCTGTGGCGGTTTCCTCCACAGATCTGGCGCTTCTTGACCGCTTTCCTCCTCACCGGACCCGAGTTG
AGCATGCTGTTTGACACGTACTTTGTCTACTCGTATCTCAGTCAGCTCGAAGCCGGGAACCCGCGCTTTTCTCGC
AAAGAGGACCTGCTTTGGTATCTGACGTTTTGCGGTGGTACCATCATGATGATGAACTATGTCAGCGGTCTCGGC
TTCACCACGTTTCTCCAGGCACTCAACTTGGCCATGTGCTACACCGTGACTCAGGATCAGCGAGGTATGAAGGCG
AACCTCATGTTCGTCACTATTCCCGCACCCATGACCCCTTTCGCCATGCTTGCCTTCAACCTGCTGTTCCCTAAT
GGCGTGCGGAGCATGCTGCTGCAACTCCTGGGCTTGCTGTCCGCGCATCTATTCGACTTCTTGACTCGCATCTGG
CCCGAAATCAAGGGCGGCCACCTCGGCTGCGGCGCCAAGTGGAGGCTCAAGAGGGCCTTTGCCGGATTCATGGAG
GACTCGGGGGCCCGGGCAACGGTTGGGATGAGGCGCTGGCTGGTCTGGAACTTTTTTTCCACCCTCCACCGCTTC
CCCTTCCTCATCGCCGGCCTTCTCCCCCTTGTCTCGGCGGGAGAGTCGTTGGACTTTGCCGAAGACTGGACGCTT
CGCCAGGTCTCCCGCACGCTGCCGTCCGACAAAGAGGTCTTGCTTGGCTTCCTCATCACCAGCGAGGGCTACGAC
CCGCAGTGGTGCTACCTGCTGGCTCAAGTCTCACCCCCATCTCGCGCCTCTTCCTGGGTCAACGAGCCCTGCATC
GGGACCAACTTTACGACGTCGTGGGGTTACAGAGCGCAGGAAGATGCCGGCATCCTGGCTCTCCTCAATACCCGG
AGCAACCGCATCGCCTGGTTCGGATGGAACGACATCAATGCATCGAATGGGCTGGGTGACGTCGGGCCCAATGCC
ACGAAGATGCTGCGAGACTTCGATCCGGATGACACTGAGTCGGATGGACAGGACTGCGACGAGTCGGACAAGGCC
AACGACGTTGAAGCCAGCACGAACAAATCCAACGATGCCCAGGAGAAGGGACCCGACGAAACCAAGGACAAGGAA
CCCAACGATCCCAAGGACAAGGGACCCAACGATCCCAAGGACAAGGTACCCAACGACTCCAAGGACAAGGGAGAC
GAGGACGACTGCAAGTGCCGCAACCCCACCATCGCCCGACGCAGTGAGGATGATGATGTCGTCGACGCCCAGGAC
AATGAGCCTGACACCGATGTCGACGATGAGGCCAGCAATGACAAGCCCATTGGAGCCCGCGACAATGAGGCCGAC
CACGACAAGGTCAACGAAGATGAGGACGACTGCAAGTGCCGCAATCCCACGATCAGCCGACGCAAGGAGGAAGAC
TCCAACAAGGCCCAAGACAATGGCGCCGACGACAACGAGGTTGATGAAGATGAGGCCGGCGAGGACAGATCCATC
AAAGCCCGTGGCGAGTGTCGCCATCACTCCATGGTCAACGACGGCGCCAAGTTCCACGACCCCACCATCACTCGA
CGCAAGGAGGATGAGTCCAACGACGCCCAAGTCGAGGGGCCTGACGACAACGAGGTTAACCAAGAGAAGGCCGGC
GAGGGCAAACCCATCGAAGCCCATGACGAGTGCCCCCATCACCCCCAGGTAAAAGACGGCGAAAAGTTCCACGAC
CCTACCATCACCCAACGCCGAGCCCGATCCTTTGTCGCCTGA
Transcript >Ophun1|3950
ATGGCGACAGCTGCCTTCCTCACATCCGTCGGCGTCTATACCAGTCTCATCCCCGGGTACTGGGTCGTCTTCCAC
CCTCAGTTTCTGTGGCGGTTTCCTCCACAGATCTGGCGCTTCTTGACCGCTTTCCTCCTCACCGGACCCGAGTTG
AGCATGCTGTTTGACACGTACTTTGTCTACTCGTATCTCAGTCAGCTCGAAGCCGGGAACCCGCGCTTTTCTCGC
AAAGAGGACCTGCTTTGGTATCTGACGTTTTGCGGTGGTACCATCATGATGATGAACTATGTCAGCGGTCTCGGC
TTCACCACGTTTCTCCAGGCACTCAACTTGGCCATGTGCTACACCGTGACTCAGGATCAGCGAGGTATGAAGGCG
AACCTCATGTTCGTCACTATTCCCGCACCCATGACCCCTTTCGCCATGCTTGCCTTCAACCTGCTGTTCCCTAAT
GGCGTGCGGAGCATGCTGCTGCAACTCCTGGGCTTGCTGTCCGCGCATCTATTCGACTTCTTGACTCGCATCTGG
CCCGAAATCAAGGGCGGCCACCTCGGCTGCGGCGCCAAGTGGAGGCTCAAGAGGGCCTTTGCCGGATTCATGGAG
GACTCGGGGGCCCGGGCAACGGTTGGGATGAGGCGCTGGCTGGTCTGGAACTTTTTTTCCACCCTCCACCGCTTC
CCCTTCCTCATCGCCGGCCTTCTCCCCCTTGTCTCGGCGGGAGAGTCGTTGGACTTTGCCGAAGACTGGACGCTT
CGCCAGGTCTCCCGCACGCTGCCGTCCGACAAAGAGGTCTTGCTTGGCTTCCTCATCACCAGCGAGGGCTACGAC
CCGCAGTGGTGCTACCTGCTGGCTCAAGTCTCACCCCCATCTCGCGCCTCTTCCTGGGTCAACGAGCCCTGCATC
GGGACCAACTTTACGACGTCGTGGGGTTACAGAGCGCAGGAAGATGCCGGCATCCTGGCTCTCCTCAATACCCGG
AGCAACCGCATCGCCTGGTTCGGATGGAACGACATCAATGCATCGAATGGGCTGGGTGACGTCGGGCCCAATGCC
ACGAAGATGCTGCGAGACTTCGATCCGGATGACACTGAGTCGGATGGACAGGACTGCGACGAGTCGGACAAGGCC
AACGACGTTGAAGCCAGCACGAACAAATCCAACGATGCCCAGGAGAAGGGACCCGACGAAACCAAGGACAAGGAA
CCCAACGATCCCAAGGACAAGGGACCCAACGATCCCAAGGACAAGGTACCCAACGACTCCAAGGACAAGGGAGAC
GAGGACGACTGCAAGTGCCGCAACCCCACCATCGCCCGACGCAGTGAGGATGATGATGTCGTCGACGCCCAGGAC
AATGAGCCTGACACCGATGTCGACGATGAGGCCAGCAATGACAAGCCCATTGGAGCCCGCGACAATGAGGCCGAC
CACGACAAGGTCAACGAAGATGAGGACGACTGCAAGTGCCGCAATCCCACGATCAGCCGACGCAAGGAGGAAGAC
TCCAACAAGGCCCAAGACAATGGCGCCGACGACAACGAGGTTGATGAAGATGAGGCCGGCGAGGACAGATCCATC
AAAGCCCGTGGCGAGTGTCGCCATCACTCCATGGTCAACGACGGCGCCAAGTTCCACGACCCCACCATCACTCGA
CGCAAGGAGGATGAGTCCAACGACGCCCAAGTCGAGGGGCCTGACGACAACGAGGTTAACCAAGAGAAGGCCGGC
GAGGGCAAACCCATCGAAGCCCATGACGAGTGCCCCCATCACCCCCAGGTAAAAGACGGCGAAAAGTTCCACGAC
CCTACCATCACCCAACGCCGAGCCCGATCCTTTGTCGCCTGA
Gene >Ophun1|3950
ATGGCGACAGCTGCCTTCCTCACATCCGTCGGCGTCTATACCAGTCTCATCCCCGGGTACTGGGTCGTCTTCCAC
CCTCAGTTTCTGTGGCGGTTTCCTCCACAGATCTGGCGCTTCTTGACCGCTTTCCTCCTCACCGGACCCGAGTTG
AGCATGCTGTTTGACACGTACTTTGTCTACTCGTATCTCAGTCAGCTCGAAGCCGGGAACCCGCGCTTTTCTCGC
AAAGAGGACCTGCTTTGGTATCTGACGTTTTGCGGTGGTACCATCATGGTAAGCTGCTTCTTTTTACCCGGAAGA
GTTGCGCGACTCGCAATCGCCCCTCATATATCTGCCCGGATAGTGTCGTATCTACTGCTATCACGGTTCCTGGAA
ATGAGGAAGATGACCCCTGTGCTTCGGGCTGGCCCATCATTCGCAATCCGGGCTGGCCTGCGGTGCCGGTATGGT
GGGAGTCTATGGATCACCCGTCTGATGACCTGTTCATTCGAGCGATTCTATAGCTCCCTACATTTCATTGCTTCT
GATACGCGCGCATACTTCCCACGTTGCAAGGTTTCAGAGGCTGACGACTCCCCAGATGATGAACTATGTCAGCGG
TCTCGGCTTCACCACGTTTCTCCAGGCACTCAACTTGGCCATGTGCTACACCGTGACTCAGGATCAGCGAGGTAT
GAAGGCGAACCTCATGTTCGTCACTATTCCCGCACCCATGACCCCTTTCGCCATGCTTGCCTTCAACCTGCTGTT
CCCTAATGGCGTGCGGAGCATGCTGCTGCAACTCCTGGGCTTGCTGTCCGCGCATCTATTCGACTTCTTGACTCG
CATCTGGCCCGAGTACGGGGGTGGCAGAAACCTGATATCTACGCCGGCCTTTTTCTCTACGGCGGTCCGATCTTT
AGAATCAAGGGCGGCCACCTCGGCTGCGGCGCCAAGTGGAGGCTCAAGAGGGCCTTTGCCGGATTCATGGAGGAC
TCGGGGGCCCGGGCAACGGTTGGGATGAGGCGCTGGCTGGTCTGGAACTTTGTGCGTGGCGACTCGCACCTACTT
GTACTTTTTATGTGGCTTCACGACACTGTCAAAGAAAGCGGTAGCGGGATTCTACAATGGAGTTTGTTCTGGAGC
GATGGATATCACAGCGCGTCACAAGCTGGAGATGGACCCACTGCTCGGCTCAGAGCGTGCTCTTTGTTGCCTTGA
TGTCGCTTCACGCGAGAGCTTCTCCTTCTTGCTTCGGCCGACGGAAGCAAGTCTGTCTTTCTTCAAGATCGTCTG
TGAGCCAGTCTCGTCTGGTCTGGGCCTTCGGACCTCTCCTTCTGGCTCTCTCTCACTGACGGTCTTCTTTCCGGA
TGAGCCTGGATGCTTGGATGTTGCCTGCCCAAATGGCGACTTCCCGAACGAAAGTCGTGCCTACCTCGAGACATC
CAGGGGCATCCTTCATATCCTCAGCGGGAGACTCTCCTCTCCTCTCCCCTCTCTCTCCTCTCTTCCTCTCTCATC
TTCTCTCCATTCTATCCCCATCTTCTCAGTCCATCATCATTCTTGATCGAGCTTCACACTTCTTCTATCCATTAC
CATCGCCAGTTTTACTCAACCATGAAGTTTTCCACCCTCCACCGCTTCCCCTTCCTCATCGCCGGCCTTCTCCCC
CTTGTCTCGGCGGGAGAGTCGTTGGACTTTGCCGAAGACTGGACGCTTCGCCAGGTCTCCCGCACGCTGCCGTCC
GACAAAGAGGTCTTGCTTGGCTTCCTCATCACCAGCGAGGGCTACGACCCGCAGTGGTGCTACCTGCTGGCTCAA
GTCTCACCCCCATCTCGCGCCTCTTCCTGGGTCAACGAGCCCTGCATCGGGACCAACTTTACGACGTCGTGGGGT
TACAGAGCGCAGGAAGATGCCGGCATCCTGGCTCTCCTCAAGTATGATCCCTTCTGACTTGTCTGGACGCGGCTG
ACGTTTGTGTGTAGTACCCGGAGCAACCGCATCGCCTGGTTCGGATGGAACGACATCAATGCATCGAATGGGCTG
GGTGACGTCGGGCCCAATGCCACGAAGATGCTGCGAGACTTCGATCCGGATGACACTGAGTCGGATGGACAGGAC
TGCGACGAGTCGGACAAGGCCAACGACGTTGAAGCCAGCACGAACAAATCCAACGATGCCCAGGAGAAGGGACCC
GACGAAACCAAGGACAAGGAACCCAACGATCCCAAGGACAAGGGACCCAACGATCCCAAGGACAAGGTACCCAAC
GACTCCAAGGACAAGGGAGACGAGGACGACTGCAAGTGCCGCAACCCCACCATCGCCCGACGCAGTGAGGATGAT
GATGTCGTCGACGCCCAGGACAATGAGCCTGACACCGATGTCGACGATGAGGCCAGCAATGACAAGCCCATTGGA
GCCCGCGACAATGAGGCCGACCACGACAAGGTCAACGAAGATGAGGACGACTGCAAGTGCCGCAATCCCACGATC
AGCCGACGCAAGGAGGAAGACTCCAACAAGGCCCAAGACAATGGCGCCGACGACAACGAGGTTGATGAAGATGAG
GCCGGCGAGGACAGATCCATCAAAGCCCGTGGCGAGTGTCGCCATCACTCCATGGTCAACGACGGCGCCAAGTTC
CACGACCCCACCATCACTCGACGCAAGGAGGATGAGTCCAACGACGCCCAAGTCGAGGGGCCTGACGACAACGAG
GTTAACCAAGAGAAGGCCGGCGAGGGCAAACCCATCGAAGCCCATGACGAGTGCCCCCATCACCCCCAGGTAAAA
GACGGCGAAAAGTTCCACGACCCTACCATCACCCAACGCCGAGCCCGATCCTTTGTCGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail