Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3943
Gene name
LocationContig_358:12860..13787
Strand-
Gene length (bp)927
Transcript length (bp)927
Coding sequence length (bp)927
Protein length (aa) 309

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup83
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1374
Ophiocordyceps australis 1348a (Ghana) OphauG2|4316
Ophiocordyceps australis map64 (Brazil) OphauB2|1748
Ophiocordyceps australis map64 (Brazil) OphauB2|3388
Ophiocordyceps australis map64 (Brazil) OphauB2|5960
Ophiocordyceps australis map64 (Brazil) OphauB2|7006
Ophiocordyceps camponoti-rufipedis Ophun1|3943 (this protein)
Ophiocordyceps subramaniannii Hirsu2|1949
Ophiocordyceps subramaniannii Hirsu2|556
Ophiocordyceps subramaniannii Hirsu2|7331
Ophiocordyceps subramaniannii Hirsu2|8399
Ophiocordyceps subramaniannii Hirsu2|9233
Ophiocordyceps subramaniannii Hirsu2|9234

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3943
MLSMAQDEASMIRKIKEQASEEIGPVSLQLDAVTSIFNKIKEASFEIMDKIKKGAIDRPTSHKIPQVAPYDDFIW
APVREPYGLAISLEERIVRQQFNLLSETAEVILSESVEVDKLLGKATSKAKAAKEKAEKNAKKLSDNSQSGSWLG
SVLAGAGVGIGSLFGAALGVGINAAGATAGATAGGVGTGTAIAGGVSADTVPILGAAEAIDVSTAELAAVIAEVD
EGMAAEILRDTASGLRAPARAAAPRGPARVAEAPSLAKRGLVFRRENLSRWTFEATGPALERALRAAFALALEEA
KQTMALPL*
Coding >Ophun1|3943
ATGCTCAGCATGGCACAAGACGAGGCTAGCATGATCCGGAAGATCAAGGAGCAAGCTTCTGAGGAGATTGGTCCC
GTGTCGCTCCAACTCGATGCAGTGACCTCAATATTCAACAAGATTAAGGAAGCGTCATTTGAGATAATGGACAAG
ATTAAAAAGGGAGCAATTGATCGTCCTACATCTCATAAGATCCCGCAAGTGGCGCCATACGACGATTTCATCTGG
GCGCCGGTACGCGAACCCTACGGACTTGCCATCTCTTTGGAGGAGCGTATCGTCAGACAGCAGTTTAACCTTCTG
AGTGAGACTGCCGAGGTAATCTTGTCCGAGAGCGTCGAAGTCGACAAGCTGCTGGGCAAGGCCACCTCCAAGGCA
AAAGCGGCAAAGGAGAAGGCAGAGAAAAACGCCAAGAAGCTATCAGACAACTCGCAGAGCGGATCATGGCTAGGC
TCGGTCCTTGCAGGCGCTGGAGTAGGTATCGGCTCGTTGTTCGGCGCCGCCTTGGGTGTGGGCATCAACGCCGCC
GGAGCAACGGCCGGAGCAACGGCCGGAGGAGTCGGCACCGGAACCGCCATAGCTGGCGGAGTTTCTGCCGACACC
GTCCCTATACTCGGAGCAGCGGAGGCTATTGACGTTTCGACGGCCGAGTTGGCGGCCGTCATTGCCGAGGTGGAC
GAGGGCATGGCAGCCGAGATATTGCGCGACACCGCGTCCGGTCTTCGAGCGCCTGCTCGCGCTGCGGCTCCCCGG
GGCCCTGCTCGCGTCGCAGAGGCTCCCTCACTGGCTAAGAGAGGCCTTGTCTTCCGGCGCGAGAATCTCTCCAGG
TGGACCTTTGAAGCTACAGGACCAGCGCTGGAGCGGGCATTGAGAGCGGCCTTTGCATTGGCCCTCGAGGAGGCG
AAACAGACCATGGCGCTGCCGTTGTGA
Transcript >Ophun1|3943
ATGCTCAGCATGGCACAAGACGAGGCTAGCATGATCCGGAAGATCAAGGAGCAAGCTTCTGAGGAGATTGGTCCC
GTGTCGCTCCAACTCGATGCAGTGACCTCAATATTCAACAAGATTAAGGAAGCGTCATTTGAGATAATGGACAAG
ATTAAAAAGGGAGCAATTGATCGTCCTACATCTCATAAGATCCCGCAAGTGGCGCCATACGACGATTTCATCTGG
GCGCCGGTACGCGAACCCTACGGACTTGCCATCTCTTTGGAGGAGCGTATCGTCAGACAGCAGTTTAACCTTCTG
AGTGAGACTGCCGAGGTAATCTTGTCCGAGAGCGTCGAAGTCGACAAGCTGCTGGGCAAGGCCACCTCCAAGGCA
AAAGCGGCAAAGGAGAAGGCAGAGAAAAACGCCAAGAAGCTATCAGACAACTCGCAGAGCGGATCATGGCTAGGC
TCGGTCCTTGCAGGCGCTGGAGTAGGTATCGGCTCGTTGTTCGGCGCCGCCTTGGGTGTGGGCATCAACGCCGCC
GGAGCAACGGCCGGAGCAACGGCCGGAGGAGTCGGCACCGGAACCGCCATAGCTGGCGGAGTTTCTGCCGACACC
GTCCCTATACTCGGAGCAGCGGAGGCTATTGACGTTTCGACGGCCGAGTTGGCGGCCGTCATTGCCGAGGTGGAC
GAGGGCATGGCAGCCGAGATATTGCGCGACACCGCGTCCGGTCTTCGAGCGCCTGCTCGCGCTGCGGCTCCCCGG
GGCCCTGCTCGCGTCGCAGAGGCTCCCTCACTGGCTAAGAGAGGCCTTGTCTTCCGGCGCGAGAATCTCTCCAGG
TGGACCTTTGAAGCTACAGGACCAGCGCTGGAGCGGGCATTGAGAGCGGCCTTTGCATTGGCCCTCGAGGAGGCG
AAACAGACCATGGCGCTGCCGTTGTGA
Gene >Ophun1|3943
ATGCTCAGCATGGCACAAGACGAGGCTAGCATGATCCGGAAGATCAAGGAGCAAGCTTCTGAGGAGATTGGTCCC
GTGTCGCTCCAACTCGATGCAGTGACCTCAATATTCAACAAGATTAAGGAAGCGTCATTTGAGATAATGGACAAG
ATTAAAAAGGGAGCAATTGATCGTCCTACATCTCATAAGATCCCGCAAGTGGCGCCATACGACGATTTCATCTGG
GCGCCGGTACGCGAACCCTACGGACTTGCCATCTCTTTGGAGGAGCGTATCGTCAGACAGCAGTTTAACCTTCTG
AGTGAGACTGCCGAGGTAATCTTGTCCGAGAGCGTCGAAGTCGACAAGCTGCTGGGCAAGGCCACCTCCAAGGCA
AAAGCGGCAAAGGAGAAGGCAGAGAAAAACGCCAAGAAGCTATCAGACAACTCGCAGAGCGGATCATGGCTAGGC
TCGGTCCTTGCAGGCGCTGGAGTAGGTATCGGCTCGTTGTTCGGCGCCGCCTTGGGTGTGGGCATCAACGCCGCC
GGAGCAACGGCCGGAGCAACGGCCGGAGGAGTCGGCACCGGAACCGCCATAGCTGGCGGAGTTTCTGCCGACACC
GTCCCTATACTCGGAGCAGCGGAGGCTATTGACGTTTCGACGGCCGAGTTGGCGGCCGTCATTGCCGAGGTGGAC
GAGGGCATGGCAGCCGAGATATTGCGCGACACCGCGTCCGGTCTTCGAGCGCCTGCTCGCGCTGCGGCTCCCCGG
GGCCCTGCTCGCGTCGCAGAGGCTCCCTCACTGGCTAAGAGAGGCCTTGTCTTCCGGCGCGAGAATCTCTCCAGG
TGGACCTTTGAAGCTACAGGACCAGCGCTGGAGCGGGCATTGAGAGCGGCCTTTGCATTGGCCCTCGAGGAGGCG
AAACAGACCATGGCGCTGCCGTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail