Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|394
Gene name
LocationContig_111:3316..4795
Strand+
Gene length (bp)1479
Transcript length (bp)1428
Coding sequence length (bp)1428
Protein length (aa) 476

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 1.1E-02 206 240
PF00400 WD40 WD domain, G-beta repeat 2.2E-06 368 402
PF08154 NLE NLE (NUC135) domain 5.7E-14 8 74

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2I5|YTM1_NEUCR Ribosome biogenesis protein ytm1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ytm1 PE=3 SV=1 4 474 0.0E+00
sp|A7ECP3|YTM1_SCLS1 Ribosome biogenesis protein ytm1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ytm1 PE=3 SV=1 6 472 0.0E+00
sp|Q2GXT0|YTM1_CHAGB Ribosome biogenesis protein YTM1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=YTM1 PE=3 SV=1 1 474 0.0E+00
sp|A6S0T8|YTM1_BOTFB Ribosome biogenesis protein ytm1 OS=Botryotinia fuckeliana (strain B05.10) GN=ytm1 PE=3 SV=1 6 472 0.0E+00
sp|A4R2Q6|YTM1_MAGO7 Ribosome biogenesis protein YTM1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=YTM1 PE=3 SV=2 1 475 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2I5|YTM1_NEUCR Ribosome biogenesis protein ytm1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ytm1 PE=3 SV=1 4 474 0.0E+00
sp|A7ECP3|YTM1_SCLS1 Ribosome biogenesis protein ytm1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ytm1 PE=3 SV=1 6 472 0.0E+00
sp|Q2GXT0|YTM1_CHAGB Ribosome biogenesis protein YTM1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=YTM1 PE=3 SV=1 1 474 0.0E+00
sp|A6S0T8|YTM1_BOTFB Ribosome biogenesis protein ytm1 OS=Botryotinia fuckeliana (strain B05.10) GN=ytm1 PE=3 SV=1 6 472 0.0E+00
sp|A4R2Q6|YTM1_MAGO7 Ribosome biogenesis protein YTM1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=YTM1 PE=3 SV=2 1 475 0.0E+00
sp|B2B5V0|YTM1_PODAN Ribosome biogenesis protein YTM1 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=YTM1 PE=3 SV=1 2 473 7.0E-175
sp|Q2UGK1|YTM1_ASPOR Ribosome biogenesis protein ytm1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ytm1 PE=3 SV=1 7 475 1.0E-157
sp|A1CXL0|YTM1_NEOFI Ribosome biogenesis protein ytm1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ytm1 PE=3 SV=1 3 475 2.0E-157
sp|Q4WP10|YTM1_ASPFU Ribosome biogenesis protein ytm1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ytm1 PE=3 SV=1 3 475 2.0E-156
sp|B0Y5V6|YTM1_ASPFC Ribosome biogenesis protein ytm1 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=ytm1 PE=3 SV=1 3 475 2.0E-156
sp|Q5B4R1|YTM1_EMENI Ribosome biogenesis protein ytm1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ytm1 PE=3 SV=1 3 475 1.0E-155
sp|A1CH75|YTM1_ASPCL Ribosome biogenesis protein ytm1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ytm1 PE=3 SV=1 1 475 9.0E-155
sp|Q0CLJ4|YTM1_ASPTN Ribosome biogenesis protein ytm1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ytm1 PE=3 SV=2 8 475 1.0E-148
sp|A6R3K5|YTM1_AJECN Ribosome biogenesis protein YTM1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=YTM1 PE=3 SV=1 1 473 1.0E-147
sp|A2QI22|YTM1_ASPNC Ribosome biogenesis protein ytm1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ytm1 PE=3 SV=1 7 475 8.0E-147
sp|Q1DJF7|YTM1_COCIM Ribosome biogenesis protein YTM1 OS=Coccidioides immitis (strain RS) GN=YTM1 PE=3 SV=2 7 473 1.0E-139
sp|B2VZH2|YTM1_PYRTR Ribosome biogenesis protein ytm1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=ytm1 PE=3 SV=1 1 471 3.0E-119
sp|Q0UXP3|YTM1_PHANO Ribosome biogenesis protein YTM1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=YTM1 PE=3 SV=1 2 471 1.0E-118
sp|A3LQ86|YTM1_PICST Ribosome biogenesis protein YTM1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=YTM1 PE=3 SV=2 1 469 1.0E-109
sp|Q6BLS5|YTM1_DEBHA Ribosome biogenesis protein YTM1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=YTM1 PE=3 SV=2 7 469 3.0E-102
sp|A5DST9|YTM1_LODEL Ribosome biogenesis protein YTM1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=YTM1 PE=3 SV=1 1 469 3.0E-102
sp|Q756D0|YTM1_ASHGO Ribosome biogenesis protein YTM1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=YTM1 PE=3 SV=2 1 475 1.0E-101
sp|Q5APF0|YTM1_CANAL Ribosome biogenesis protein YTM1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=YTM1 PE=3 SV=1 6 469 3.0E-101
sp|Q6FKK3|YTM1_CANGA Ribosome biogenesis protein YTM1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=YTM1 PE=3 SV=1 1 475 3.0E-101
sp|Q6CU59|YTM1_KLULA Ribosome biogenesis protein YTM1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YTM1 PE=3 SV=1 1 475 1.0E-99
sp|A5DL92|YTM1_PICGU Ribosome biogenesis protein YTM1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=YTM1 PE=3 SV=2 5 468 2.0E-97
sp|A7TMF9|YTM1_VANPO Ribosome biogenesis protein YTM1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=YTM1 PE=3 SV=1 1 475 9.0E-96
sp|Q12024|YTM1_YEAST Ribosome biogenesis protein YTM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTM1 PE=1 SV=1 1 475 6.0E-95
sp|A6ZPA9|YTM1_YEAS7 Ribosome biogenesis protein YTM1 OS=Saccharomyces cerevisiae (strain YJM789) GN=YTM1 PE=3 SV=1 1 475 6.0E-95
sp|Q9URY0|YTM1_SCHPO Ribosome biogenesis protein ytm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ytm1 PE=1 SV=1 1 468 3.0E-90
sp|Q6CEW7|YTM1_YARLI Ribosome biogenesis protein YTM1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=YTM1 PE=3 SV=1 8 468 2.0E-84
sp|A8IR43|WDR12_CHLRE Ribosome biogenesis protein WDR12 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_128420 PE=3 SV=2 3 408 2.0E-44
sp|Q7QJ33|WDR12_ANOGA Ribosome biogenesis protein WDR12 homolog OS=Anopheles gambiae GN=AGAP007244 PE=3 SV=3 3 470 8.0E-37
sp|B0DWM8|YTM1_LACBS Ribosome biogenesis protein YTM1 OS=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) GN=YTM1 PE=3 SV=1 10 466 2.0E-36
sp|Q9JJA4|WDR12_MOUSE Ribosome biogenesis protein WDR12 OS=Mus musculus GN=Wdr12 PE=1 SV=1 30 464 1.0E-35
sp|P61480|WDR12_RAT Ribosome biogenesis protein WDR12 OS=Rattus norvegicus GN=Wdr12 PE=2 SV=1 30 468 3.0E-35
sp|B4JPT9|WDR12_DROGR Ribosome biogenesis protein WDR12 homolog OS=Drosophila grimshawi GN=GH13339 PE=3 SV=1 6 470 3.0E-35
sp|Q29KQ0|WDR12_DROPS Ribosome biogenesis protein WDR12 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA19813 PE=3 SV=1 1 474 1.0E-34
sp|B4MU54|WDR12_DROWI Ribosome biogenesis protein WDR12 homolog OS=Drosophila willistoni GN=GK23981 PE=3 SV=1 1 470 1.0E-34
sp|B4GT01|WDR12_DROPE Ribosome biogenesis protein WDR12 homolog OS=Drosophila persimilis GN=GL26386 PE=3 SV=1 1 474 1.0E-34
sp|Q54W52|WDR12_DICDI Ribosome biogenesis protein WDR12 homolog OS=Dictyostelium discoideum GN=wdr12 PE=2 SV=1 12 408 3.0E-34
sp|Q9VKQ3|WDR12_DROME Ribosome biogenesis protein WDR12 homolog OS=Drosophila melanogaster GN=CG6724 PE=2 SV=1 1 474 1.0E-33
sp|B3MJV8|WDR12_DROAN Ribosome biogenesis protein WDR12 homolog OS=Drosophila ananassae GN=GF14067 PE=3 SV=1 6 470 2.0E-33
sp|B5DG67|WDR12_SALSA Ribosome biogenesis protein wdr12 OS=Salmo salar GN=wdr12 PE=2 SV=1 7 407 2.0E-33
sp|Q17BB0|WDR12_AEDAE Ribosome biogenesis protein WDR12 homolog OS=Aedes aegypti GN=AAEL005041 PE=3 SV=1 4 470 3.0E-33
sp|B3N534|WDR12_DROER Ribosome biogenesis protein WDR12 homolog OS=Drosophila erecta GN=GG10358 PE=3 SV=1 6 474 4.0E-33
sp|A8PD13|YTM1_COPC7 Ribosome biogenesis protein YTM1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=YTM1 PE=3 SV=1 1 407 4.0E-33
sp|Q5BJ90|WDR12_XENTR Ribosome biogenesis protein wdr12 OS=Xenopus tropicalis GN=wdr12 PE=2 SV=1 6 468 6.0E-33
sp|Q0VC24|WDR12_BOVIN Ribosome biogenesis protein WDR12 OS=Bos taurus GN=WDR12 PE=2 SV=1 39 407 6.0E-33
sp|B3RQN1|WDR12_TRIAD Ribosome biogenesis protein WDR12 homolog OS=Trichoplax adhaerens GN=TRIADDRAFT_55049 PE=3 SV=2 36 466 1.0E-32
sp|B4P116|WDR12_DROYA Ribosome biogenesis protein WDR12 homolog OS=Drosophila yakuba GN=GE13328 PE=2 SV=1 6 474 2.0E-32
sp|Q9GZL7|WDR12_HUMAN Ribosome biogenesis protein WDR12 OS=Homo sapiens GN=WDR12 PE=1 SV=2 39 468 2.0E-32
sp|B4KKN1|WDR12_DROMO Ribosome biogenesis protein WDR12 homolog OS=Drosophila mojavensis GN=GI17814 PE=3 SV=1 6 466 2.0E-32
sp|Q5REE6|WDR12_PONAB Ribosome biogenesis protein WDR12 OS=Pongo abelii GN=WDR12 PE=2 SV=1 6 468 2.0E-32
sp|B4HWV6|WDR12_DROSE Ribosome biogenesis protein WDR12 homolog OS=Drosophila sechellia GN=GM11446 PE=3 SV=1 1 474 6.0E-32
sp|B4Q9T6|WDR12_DROSI Ribosome biogenesis protein WDR12 homolog OS=Drosophila simulans GN=GD22226 PE=3 SV=1 1 474 7.0E-32
sp|B4LS78|WDR12_DROVI Ribosome biogenesis protein WDR12 homolog OS=Drosophila virilis GN=GJ17641 PE=3 SV=1 6 468 3.0E-31
sp|Q6NX08|WDR12_DANRE Ribosome biogenesis protein wdr12 OS=Danio rerio GN=wdr12 PE=2 SV=1 55 407 2.0E-30
sp|B0W517|WDR12_CULQU Ribosome biogenesis protein WDR12 homolog OS=Culex quinquefasciatus GN=CPIJ001500 PE=3 SV=2 6 470 4.0E-30
sp|A8PT44|YTM1_MALGO Ribosome biogenesis protein YTM1 OS=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) GN=YTM1 PE=3 SV=1 29 472 7.0E-28
sp|A7RHG8|WDR12_NEMVE Ribosome biogenesis protein WDR12 homolog (Fragment) OS=Nematostella vectensis GN=v1g82024 PE=3 SV=1 3 464 1.0E-27
sp|P0CS54|YTM1_CRYNJ Ribosome biogenesis protein YTM1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=YTM1 PE=3 SV=1 7 471 1.0E-26
sp|P0CS55|YTM1_CRYNB Ribosome biogenesis protein YTM1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=YTM1 PE=3 SV=1 7 471 1.0E-26
sp|B7PY76|WDR12_IXOSC Ribosome biogenesis protein WDR12 homolog OS=Ixodes scapularis GN=ISCW009002 PE=3 SV=1 5 439 5.0E-26
sp|A8QB65|WDR12_BRUMA Ribosome biogenesis protein WDR12 homolog OS=Brugia malayi GN=Bm1_47965 PE=3 SV=1 26 415 4.0E-24
sp|A9UP22|WDR12_MONBE Ribosome biogenesis protein WDR12 homolog OS=Monosiga brevicollis GN=30764 PE=3 SV=1 28 407 2.0E-20
sp|A8XL02|WDR12_CAEBR Ribosome biogenesis protein WDR12 homolog OS=Caenorhabditis briggsae GN=wdr-12 PE=3 SV=2 7 415 2.0E-19
sp|P91343|WDR12_CAEEL Ribosome biogenesis protein WDR12 homolog OS=Caenorhabditis elegans GN=wdr-12 PE=3 SV=1 7 415 3.0E-16
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 126 441 3.0E-13
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 19 413 6.0E-13
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 19 413 1.0E-12
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 19 413 1.0E-12
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 19 413 5.0E-12
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 128 422 2.0E-11
sp|B3MET8|WDR48_DROAN WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 156 407 9.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 130 407 1.0E-10
sp|B4KRQ4|WDR48_DROMO WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 156 407 1.0E-10
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 208 424 1.0E-10
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 173 452 2.0E-10
sp|B4J8H6|WDR48_DROGR WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 147 407 2.0E-10
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 128 424 3.0E-10
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 30 416 3.0E-10
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 173 452 4.0E-10
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 130 401 5.0E-10
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 174 407 5.0E-10
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 174 407 5.0E-10
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 159 452 8.0E-10
sp|Q0P593|DAW1_BOVIN Dynein assembly factor with WDR repeat domains 1 OS=Bos taurus GN=DAW1 PE=2 SV=1 130 401 9.0E-10
sp|Q9USR0|CKN1_SCHPO DNA excision repair protein ckn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ckn1 PE=1 SV=1 285 404 4.0E-09
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 130 312 5.0E-09
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 130 401 6.0E-09
sp|P62882|GBB5_RAT Guanine nucleotide-binding protein subunit beta-5 OS=Rattus norvegicus GN=Gnb5 PE=2 SV=1 171 401 8.0E-09
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 208 406 8.0E-09
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 128 407 8.0E-09
sp|Q5RDY7|GBB5_PONAB Guanine nucleotide-binding protein subunit beta-5 OS=Pongo abelii GN=GNB5 PE=2 SV=1 171 401 8.0E-09
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 128 406 9.0E-09
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 130 401 9.0E-09
sp|B4P6P9|LIS1_DROYA Lissencephaly-1 homolog OS=Drosophila yakuba GN=Lis-1 PE=3 SV=1 130 407 1.0E-08
sp|B3NPW0|LIS1_DROER Lissencephaly-1 homolog OS=Drosophila erecta GN=Lis-1 PE=3 SV=1 130 407 1.0E-08
sp|Q80ZD0|GBB5_TAMST Guanine nucleotide-binding protein subunit beta-5 OS=Tamias striatus GN=GNB5 PE=2 SV=1 171 401 1.0E-08
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 175 405 1.0E-08
sp|B4QHG6|LIS1_DROSI Lissencephaly-1 homolog OS=Drosophila simulans GN=Lis-1 PE=3 SV=1 130 407 1.0E-08
sp|B4HSL3|LIS1_DROSE Lissencephaly-1 homolog OS=Drosophila sechellia GN=Lis-1 PE=3 SV=1 130 407 1.0E-08
sp|Q7KNS3|LIS1_DROME Lissencephaly-1 homolog OS=Drosophila melanogaster GN=Lis-1 PE=1 SV=2 130 407 1.0E-08
sp|P62881|GBB5_MOUSE Guanine nucleotide-binding protein subunit beta-5 OS=Mus musculus GN=Gnb5 PE=1 SV=1 171 401 1.0E-08
sp|Q6PNB6|GBB5_RABIT Guanine nucleotide-binding protein subunit beta-5 OS=Oryctolagus cuniculus GN=GNB5 PE=2 SV=1 171 401 1.0E-08
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 159 408 2.0E-08
sp|O14775|GBB5_HUMAN Guanine nucleotide-binding protein subunit beta-5 OS=Homo sapiens GN=GNB5 PE=2 SV=2 171 401 2.0E-08
sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 160 466 2.0E-08
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 130 312 2.0E-08
sp|Q5BK30|DAW1_RAT Dynein assembly factor with WDR repeat domains 1 OS=Rattus norvegicus GN=Daw1 PE=2 SV=1 130 401 2.0E-08
sp|Q7PS24|CIAO1_ANOGA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Anopheles gambiae GN=Ciao1 PE=3 SV=3 130 312 2.0E-08
sp|P0CS36|HAT2_CRYNJ Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT2 PE=3 SV=1 159 466 3.0E-08
sp|P0CS37|HAT2_CRYNB Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT2 PE=3 SV=1 159 466 3.0E-08
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 196 407 3.0E-08
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 128 424 4.0E-08
sp|Q803D2|LIS1B_DANRE Lissencephaly-1 homolog B OS=Danio rerio GN=pafah1b1b PE=2 SV=3 173 407 4.0E-08
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 208 403 6.0E-08
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 175 407 6.0E-08
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 128 402 7.0E-08
sp|D3TLL6|LIS1_GLOMM Lissencephaly-1 homolog OS=Glossina morsitans morsitans PE=2 SV=1 132 407 9.0E-08
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 159 453 1.0E-07
sp|B5X3C4|LIS1B_SALSA Lissencephaly-1 homolog B OS=Salmo salar GN=pafah1b1-2 PE=2 SV=1 173 407 2.0E-07
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 175 401 2.0E-07
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 120 407 2.0E-07
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 173 407 2.0E-07
sp|Q6NZH4|LIS1_XENTR Lissencephaly-1 homolog OS=Xenopus tropicalis GN=pafah1b1 PE=2 SV=3 173 407 3.0E-07
sp|Q7T394|LIS1A_DANRE Lissencephaly-1 homolog A OS=Danio rerio GN=pafah1b1a PE=2 SV=3 173 407 3.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 104 403 3.0E-07
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 173 407 3.0E-07
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 130 413 3.0E-07
sp|Q6BVZ3|PFS2_DEBHA Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 213 407 4.0E-07
sp|Q8HXX0|LIS1_MACFA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Macaca fascicularis GN=PAFAH1B1 PE=2 SV=3 173 407 5.0E-07
sp|Q4I7X1|PFS2_GIBZE Polyadenylation factor subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PFS2 PE=3 SV=1 198 407 5.0E-07
sp|Q8BG40|KTNB1_MOUSE Katanin p80 WD40 repeat-containing subunit B1 OS=Mus musculus GN=Katnb1 PE=1 SV=1 130 356 5.0E-07
sp|Q4RJN5|LIS1_TETNG Lissencephaly-1 homolog OS=Tetraodon nigroviridis GN=pafah1b1 PE=3 SV=1 173 407 6.0E-07
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40 repeat-containing subunit B1 OS=Homo sapiens GN=KATNB1 PE=1 SV=1 130 356 6.0E-07
sp|Q00664|LIS1_EMENI Nuclear distribution protein nudF OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=nudF PE=1 SV=1 248 403 6.0E-07
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 159 453 7.0E-07
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 173 407 7.0E-07
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 131 401 7.0E-07
sp|A8Q2R5|WDR48_BRUMA WD repeat-containing protein 48 homolog OS=Brugia malayi GN=Bm1_41555 PE=3 SV=2 153 403 9.0E-07
sp|B0X2V9|WDR48_CULQU WD repeat-containing protein 48 homolog OS=Culex quinquefasciatus GN=CPIJ014111 PE=3 SV=1 156 407 1.0E-06
sp|Q7RY68|PFS2_NEUCR Polyadenylation factor subunit 2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=paa-1 PE=3 SV=2 198 407 1.0E-06
sp|C4R6H3|LIS1_PICPG Nuclear distribution protein PAC1 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=PAC1 PE=3 SV=1 278 406 1.0E-06
sp|Q13216|ERCC8_HUMAN DNA excision repair protein ERCC-8 OS=Homo sapiens GN=ERCC8 PE=1 SV=1 211 406 1.0E-06
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 285 466 2.0E-06
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 278 414 2.0E-06
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 211 407 2.0E-06
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 211 407 2.0E-06
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 278 405 2.0E-06
sp|Q05B17|WDR48_XENTR WD repeat-containing protein 48 OS=Xenopus tropicalis GN=wdr48 PE=2 SV=1 151 414 2.0E-06
sp|Q8CFD5|ERCC8_MOUSE DNA excision repair protein ERCC-8 OS=Mus musculus GN=Ercc8 PE=2 SV=2 211 406 2.0E-06
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 175 407 2.0E-06
sp|P49178|GBB_MAIZE Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1 208 406 2.0E-06
sp|B4HND9|WDR48_DROSE WD repeat-containing protein 48 homolog OS=Drosophila sechellia GN=GM20456 PE=3 SV=1 211 407 3.0E-06
sp|B4QB64|WDR48_DROSI WD repeat-containing protein 48 homolog OS=Drosophila simulans GN=GD25924 PE=3 SV=1 211 407 3.0E-06
sp|Q6PFM9|WDR48_DANRE WD repeat-containing protein 48 OS=Danio rerio GN=wdr48 PE=2 SV=2 151 414 3.0E-06
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 210 404 3.0E-06
sp|Q1LZ08|WDR48_DROME WD repeat-containing protein 48 homolog OS=Drosophila melanogaster GN=CG9062 PE=2 SV=1 211 407 3.0E-06
sp|Q9BQ67|GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens GN=GRWD1 PE=1 SV=1 159 321 3.0E-06
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 125 403 4.0E-06
sp|B4MFM2|WDR48_DROVI WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 211 407 4.0E-06
sp|Q5RAW8|WDR48_PONAB WD repeat-containing protein 48 OS=Pongo abelii GN=WDR48 PE=2 SV=1 151 414 4.0E-06
sp|Q8TAF3|WDR48_HUMAN WD repeat-containing protein 48 OS=Homo sapiens GN=WDR48 PE=1 SV=1 151 414 4.0E-06
sp|Q32PG3|WDR48_BOVIN WD repeat-containing protein 48 OS=Bos taurus GN=WDR48 PE=2 SV=1 151 414 4.0E-06
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 173 407 5.0E-06
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 160 414 5.0E-06
sp|Q4R2Z6|WDR48_MACFA WD repeat-containing protein 48 OS=Macaca fascicularis GN=WDR48 PE=2 SV=1 173 414 5.0E-06
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 130 442 6.0E-06
sp|Q5F3K4|WDR48_CHICK WD repeat-containing protein 48 OS=Gallus gallus GN=WDR48 PE=2 SV=1 151 414 6.0E-06
sp|Q2TZG4|PFS2_ASPOR Polyadenylation factor subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pfs2 PE=3 SV=1 198 407 7.0E-06
sp|Q42384|PRL1_ARATH Protein pleiotropic regulatory locus 1 OS=Arabidopsis thaliana GN=PRL1 PE=1 SV=1 200 407 8.0E-06
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 175 407 9.0E-06
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 175 407 9.0E-06
sp|Q4WEI5|HAT2_ASPFU Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1 160 466 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|394
MDASTGQIKVVFTSNEPDLQLPDSKQQLLVPSDIKRYGLSRILNSESMLDTSSPIPLDFLANGTFLRSSIQDYLS
ANGLSSETTLTLQYVRSLLPPAYQATFQHDDWVGGLDVLSPTAPAAEGAHVSEYVATASYDGLVRVWNPSGQIVA
VSPTGRSGGHTRRIDAVRWLSPSKLASAGLDGKIVVWDYKEAADQQQDSAPLKLNMELYGHEKHINAISVNTSNK
RILSASSDGRVGLWSSSKSTAPQAEADSLPSASSAKRAKLSAAASGSIAQRGPLALMPMHDEPVTAAIFHPNDAT
VAYSASQDHTVKTIDLTTQKEVSRLTTLHPVLCAAALPATSLVAAGSSARHITLLDPRESVAATAAMTLRGHVNM
VVSLAPSPENDYSLVSASHDGTCRVWDLRSARPGAADEGGGRVGEPVFTIGREWLKGKKLPPAGDGVKVLDVVWD
TTWGIVSAGEDKKVQVNRGRGLLAS*
Coding >Ophun1|394
ATGGACGCCTCGACGGGTCAGATCAAGGTCGTCTTCACCTCAAATGAACCTGACCTCCAGCTTCCCGATTCCAAA
CAGCAGCTACTCGTTCCATCAGACATCAAGCGCTATGGCCTGTCTCGCATCCTCAACTCCGAGTCCATGCTCGAT
ACCTCGTCTCCGATCCCCCTCGATTTCCTCGCCAATGGCACCTTTCTGCGATCCTCAATTCAAGACTACCTGTCC
GCCAACGGTCTCTCCTCCGAGACAACCCTGACTCTGCAATACGTCCGAAGCCTTCTCCCTCCCGCCTATCAGGCA
ACCTTTCAGCACGACGATTGGGTAGGCGGTCTTGATGTTCTGTCCCCCACCGCCCCCGCCGCCGAGGGCGCCCAT
GTGAGCGAATACGTCGCCACTGCTTCCTACGATGGGCTCGTCCGGGTATGGAACCCCTCTGGCCAGATTGTTGCC
GTCTCTCCCACCGGTAGATCTGGCGGACACACCCGCCGCATCGACGCCGTCCGCTGGTTGTCGCCGTCGAAGCTG
GCCTCGGCCGGTCTTGACGGGAAAATCGTCGTCTGGGATTACAAGGAAGCGGCAGATCAACAGCAAGATTCCGCG
CCTCTGAAGCTCAACATGGAGTTGTATGGCCATGAGAAGCACATCAACGCCATCAGCGTCAACACCTCCAATAAG
CGCATTCTCTCCGCCTCGTCCGATGGCCGCGTCGGACTCTGGTCCTCGTCCAAGAGCACCGCGCCTCAGGCCGAA
GCCGACAGTCTTCCCTCGGCGTCGAGCGCCAAGCGTGCAAAGCTCTCAGCTGCCGCGTCCGGCTCCATTGCCCAG
CGCGGCCCCTTGGCCCTGATGCCCATGCACGACGAGCCCGTCACCGCCGCCATCTTTCACCCCAATGACGCCACC
GTCGCCTACTCGGCCTCGCAGGACCACACCGTCAAGACGATTGACCTGACAACGCAAAAGGAGGTGTCGCGACTG
ACTACCCTGCATCCGGTCCTCTGCGCCGCCGCTTTACCCGCCACGTCACTCGTCGCCGCCGGCTCCTCGGCGAGG
CACATCACCCTACTGGACCCCCGTGAATCCGTCGCGGCTACGGCGGCCATGACACTGCGCGGTCACGTCAACATG
GTCGTTTCCCTGGCCCCCTCGCCGGAAAACGACTACTCTCTAGTTTCCGCCTCCCACGACGGCACATGCCGCGTC
TGGGACCTGCGCAGCGCGCGGCCGGGCGCGGCAGACGAGGGCGGCGGCCGCGTCGGCGAGCCCGTCTTTACCATC
GGCCGAGAGTGGCTCAAGGGCAAGAAGCTTCCGCCGGCGGGCGACGGCGTCAAGGTCTTGGATGTCGTCTGGGAC
ACCACATGGGGGATAGTGAGCGCGGGAGAGGATAAAAAAGTTCAGGTCAATAGGGGTAGAGGTCTGCTAGCTTCA
TGA
Transcript >Ophun1|394
ATGGACGCCTCGACGGGTCAGATCAAGGTCGTCTTCACCTCAAATGAACCTGACCTCCAGCTTCCCGATTCCAAA
CAGCAGCTACTCGTTCCATCAGACATCAAGCGCTATGGCCTGTCTCGCATCCTCAACTCCGAGTCCATGCTCGAT
ACCTCGTCTCCGATCCCCCTCGATTTCCTCGCCAATGGCACCTTTCTGCGATCCTCAATTCAAGACTACCTGTCC
GCCAACGGTCTCTCCTCCGAGACAACCCTGACTCTGCAATACGTCCGAAGCCTTCTCCCTCCCGCCTATCAGGCA
ACCTTTCAGCACGACGATTGGGTAGGCGGTCTTGATGTTCTGTCCCCCACCGCCCCCGCCGCCGAGGGCGCCCAT
GTGAGCGAATACGTCGCCACTGCTTCCTACGATGGGCTCGTCCGGGTATGGAACCCCTCTGGCCAGATTGTTGCC
GTCTCTCCCACCGGTAGATCTGGCGGACACACCCGCCGCATCGACGCCGTCCGCTGGTTGTCGCCGTCGAAGCTG
GCCTCGGCCGGTCTTGACGGGAAAATCGTCGTCTGGGATTACAAGGAAGCGGCAGATCAACAGCAAGATTCCGCG
CCTCTGAAGCTCAACATGGAGTTGTATGGCCATGAGAAGCACATCAACGCCATCAGCGTCAACACCTCCAATAAG
CGCATTCTCTCCGCCTCGTCCGATGGCCGCGTCGGACTCTGGTCCTCGTCCAAGAGCACCGCGCCTCAGGCCGAA
GCCGACAGTCTTCCCTCGGCGTCGAGCGCCAAGCGTGCAAAGCTCTCAGCTGCCGCGTCCGGCTCCATTGCCCAG
CGCGGCCCCTTGGCCCTGATGCCCATGCACGACGAGCCCGTCACCGCCGCCATCTTTCACCCCAATGACGCCACC
GTCGCCTACTCGGCCTCGCAGGACCACACCGTCAAGACGATTGACCTGACAACGCAAAAGGAGGTGTCGCGACTG
ACTACCCTGCATCCGGTCCTCTGCGCCGCCGCTTTACCCGCCACGTCACTCGTCGCCGCCGGCTCCTCGGCGAGG
CACATCACCCTACTGGACCCCCGTGAATCCGTCGCGGCTACGGCGGCCATGACACTGCGCGGTCACGTCAACATG
GTCGTTTCCCTGGCCCCCTCGCCGGAAAACGACTACTCTCTAGTTTCCGCCTCCCACGACGGCACATGCCGCGTC
TGGGACCTGCGCAGCGCGCGGCCGGGCGCGGCAGACGAGGGCGGCGGCCGCGTCGGCGAGCCCGTCTTTACCATC
GGCCGAGAGTGGCTCAAGGGCAAGAAGCTTCCGCCGGCGGGCGACGGCGTCAAGGTCTTGGATGTCGTCTGGGAC
ACCACATGGGGGATAGTGAGCGCGGGAGAGGATAAAAAAGTTCAGGTCAATAGGGGTAGAGGTCTGCTAGCTTCA
TGA
Gene >Ophun1|394
ATGGACGCCTCGACGGGTCAGATCAAGGTCGTCTTCACCTCAAATGAACCTGACCTCCAGCTTCCCGATTCCAAA
CAGCAGCTACTCGTTCCATCAGGTTCTCTCTAACATCTCCCTCACCCGCTCCCCTATAGCTAACGCAGACCAGAC
ATCAAGCGCTATGGCCTGTCTCGCATCCTCAACTCCGAGTCCATGCTCGATACCTCGTCTCCGATCCCCCTCGAT
TTCCTCGCCAATGGCACCTTTCTGCGATCCTCAATTCAAGACTACCTGTCCGCCAACGGTCTCTCCTCCGAGACA
ACCCTGACTCTGCAATACGTCCGAAGCCTTCTCCCTCCCGCCTATCAGGCAACCTTTCAGCACGACGATTGGGTA
GGCGGTCTTGATGTTCTGTCCCCCACCGCCCCCGCCGCCGAGGGCGCCCATGTGAGCGAATACGTCGCCACTGCT
TCCTACGATGGGCTCGTCCGGGTATGGAACCCCTCTGGCCAGATTGTTGCCGTCTCTCCCACCGGTAGATCTGGC
GGACACACCCGCCGCATCGACGCCGTCCGCTGGTTGTCGCCGTCGAAGCTGGCCTCGGCCGGTCTTGACGGGAAA
ATCGTCGTCTGGGATTACAAGGAAGCGGCAGATCAACAGCAAGATTCCGCGCCTCTGAAGCTCAACATGGAGTTG
TATGGCCATGAGAAGCACATCAACGCCATCAGCGTCAACACCTCCAATAAGCGCATTCTCTCCGCCTCGTCCGAT
GGCCGCGTCGGACTCTGGTCCTCGTCCAAGAGCACCGCGCCTCAGGCCGAAGCCGACAGTCTTCCCTCGGCGTCG
AGCGCCAAGCGTGCAAAGCTCTCAGCTGCCGCGTCCGGCTCCATTGCCCAGCGCGGCCCCTTGGCCCTGATGCCC
ATGCACGACGAGCCCGTCACCGCCGCCATCTTTCACCCCAATGACGCCACCGTCGCCTACTCGGCCTCGCAGGAC
CACACCGTCAAGACGATTGACCTGACAACGCAAAAGGAGGTGTCGCGACTGACTACCCTGCATCCGGTCCTCTGC
GCCGCCGCTTTACCCGCCACGTCACTCGTCGCCGCCGGCTCCTCGGCGAGGCACATCACCCTACTGGACCCCCGT
GAATCCGTCGCGGCTACGGCGGCCATGACACTGCGCGGTCACGTCAACATGGTCGTTTCCCTGGCCCCCTCGCCG
GAAAACGACTACTCTCTAGTTTCCGCCTCCCACGACGGCACATGCCGCGTCTGGGACCTGCGCAGCGCGCGGCCG
GGCGCGGCAGACGAGGGCGGCGGCCGCGTCGGCGAGCCCGTCTTTACCATCGGCCGAGAGTGGCTCAAGGGCAAG
AAGCTTCCGCCGGCGGGCGACGGCGTCAAGGTCTTGGATGTCGTCTGGGACACCACATGGGGGATAGTGAGCGCG
GGAGAGGATAAAAAAGTTCAGGTCAATAGGGGTAGAGGTCTGCTAGCTTCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail