Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3932
Gene name
LocationContig_356:16450..17992
Strand-
Gene length (bp)1542
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1307
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3340
Ophiocordyceps australis map64 (Brazil) OphauB2|7015
Ophiocordyceps camponoti-floridani Ophcf2|01131
Ophiocordyceps camponoti-rufipedis Ophun1|3932 (this protein)
Ophiocordyceps kimflemingae Ophio5|2494
Ophiocordyceps subramaniannii Hirsu2|1063

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3932
MPPEAAPETDYVRLHITPLDADLVNVIIPASVRPRSRNLSFHTIQTFPDRRYGFVELPRMDADRLKSKLNGSLLK
GTRIRVEDARPEERVEPTGDDARPDKKRKMSADEAPDSSKKSRHNKPLDGLLLKDRKVKRGWTETPSAKKKTAKD
GQKRQKSRYTDKEECLLKLKVPPNAAANLPSATKKNKKKSREVVVHEFEKTTKFPSFLKTAAPDTDGKAATEYVE
GKGWVDEDGVVLEEVRDKRAVEAAVSIARGKEDSGDVASSSATSPDEASNDDDTSSSGTSSEDETDNDDAKQSPA
PSREHAQTSPPTKKEAKNKRSTAKDGSPPPTSSPKSLTIKIPQLESHPPVHPLEALYKRPHPASDTTNAHPQPEP
FSFFGGAPGDDDGTTAAAKEKPSTHPVSKMPTTPFTRQDFDLRGIRSAAPTPDTAHPSRRHLFWASQEDADAEED
GGRDDEDEEDFEGAPPPTEGQSDFQSWFWENRRELNRSWMTRRKTVAKERRHRENKARTSRAA*
Coding >Ophun1|3932
ATGCCCCCCGAAGCCGCTCCGGAGACTGATTACGTCCGGCTACACATCACGCCTCTAGACGCAGACCTCGTCAAC
GTCATCATCCCCGCCTCTGTCCGTCCGCGCTCGCGCAACCTCTCCTTCCACACGATCCAGACCTTCCCCGACAGG
CGCTACGGCTTTGTCGAGCTGCCGCGCATGGACGCCGACCGCCTGAAGAGCAAGCTCAACGGCTCACTCCTCAAG
GGCACTCGCATTCGTGTCGAAGACGCTCGTCCGGAAGAGCGCGTTGAGCCGACGGGCGACGACGCTCGTCCTGAC
AAGAAGCGCAAGATGTCAGCAGATGAAGCTCCTGACTCGAGCAAGAAGTCCAGACACAATAAGCCTCTGGACGGC
CTTCTTCTCAAGGACCGAAAGGTCAAGCGCGGCTGGACCGAGACGCCCAGCGCGAAGAAGAAGACGGCAAAAGAC
GGCCAGAAGCGACAAAAATCACGCTACACCGACAAGGAGGAGTGTCTGCTCAAGCTCAAGGTCCCACCCAACGCC
GCCGCCAATCTACCGTCCGCGACCAAGAAGAACAAGAAAAAGTCGCGAGAGGTGGTGGTTCACGAGTTTGAGAAG
ACGACCAAGTTCCCCAGCTTCCTGAAGACGGCTGCCCCCGACACGGACGGCAAGGCAGCAACCGAGTACGTCGAA
GGCAAGGGCTGGGTCGACGAGGATGGTGTAGTGCTTGAGGAGGTCAGGGACAAAAGAGCGGTGGAAGCGGCCGTC
TCTATTGCCCGTGGCAAGGAGGATTCAGGCGACGTTGCAAGCAGCAGCGCTACCTCACCCGACGAAGCATCAAAC
GACGACGACACGAGCAGCAGCGGCACATCCTCTGAAGACGAGACCGACAACGATGACGCCAAACAGTCTCCTGCC
CCAAGCCGTGAGCACGCGCAAACCTCCCCTCCCACCAAAAAGGAAGCGAAAAACAAACGTTCTACCGCAAAAGAC
GGCTCACCCCCCCCCACAAGCTCCCCCAAAAGCCTGACCATCAAAATCCCCCAACTCGAGTCCCATCCCCCCGTC
CACCCGCTGGAAGCACTCTACAAGCGCCCGCATCCCGCCTCCGATACCACCAACGCACACCCCCAGCCCGAACCC
TTCAGCTTCTTCGGCGGAGCCCCAGGCGATGACGACGGTACGACGGCAGCAGCGAAAGAGAAGCCATCCACCCAT
CCCGTCTCCAAGATGCCCACGACGCCCTTTACCAGGCAGGACTTTGACCTCCGGGGCATCCGCAGCGCCGCCCCG
ACGCCCGATACGGCCCACCCGTCGAGGAGACACCTCTTCTGGGCCTCACAGGAAGACGCCGACGCAGAGGAGGAT
GGAGGCCGCGACGATGAAGACGAGGAGGACTTCGAGGGCGCGCCTCCTCCGACAGAGGGTCAGAGCGACTTTCAG
TCGTGGTTCTGGGAGAATAGGCGTGAGCTCAATCGGTCGTGGATGACGCGTCGTAAGACGGTGGCCAAGGAGAGG
CGTCACCGGGAGAATAAGGCGAGGACGTCTAGGGCTGCGTAG
Transcript >Ophun1|3932
ATGCCCCCCGAAGCCGCTCCGGAGACTGATTACGTCCGGCTACACATCACGCCTCTAGACGCAGACCTCGTCAAC
GTCATCATCCCCGCCTCTGTCCGTCCGCGCTCGCGCAACCTCTCCTTCCACACGATCCAGACCTTCCCCGACAGG
CGCTACGGCTTTGTCGAGCTGCCGCGCATGGACGCCGACCGCCTGAAGAGCAAGCTCAACGGCTCACTCCTCAAG
GGCACTCGCATTCGTGTCGAAGACGCTCGTCCGGAAGAGCGCGTTGAGCCGACGGGCGACGACGCTCGTCCTGAC
AAGAAGCGCAAGATGTCAGCAGATGAAGCTCCTGACTCGAGCAAGAAGTCCAGACACAATAAGCCTCTGGACGGC
CTTCTTCTCAAGGACCGAAAGGTCAAGCGCGGCTGGACCGAGACGCCCAGCGCGAAGAAGAAGACGGCAAAAGAC
GGCCAGAAGCGACAAAAATCACGCTACACCGACAAGGAGGAGTGTCTGCTCAAGCTCAAGGTCCCACCCAACGCC
GCCGCCAATCTACCGTCCGCGACCAAGAAGAACAAGAAAAAGTCGCGAGAGGTGGTGGTTCACGAGTTTGAGAAG
ACGACCAAGTTCCCCAGCTTCCTGAAGACGGCTGCCCCCGACACGGACGGCAAGGCAGCAACCGAGTACGTCGAA
GGCAAGGGCTGGGTCGACGAGGATGGTGTAGTGCTTGAGGAGGTCAGGGACAAAAGAGCGGTGGAAGCGGCCGTC
TCTATTGCCCGTGGCAAGGAGGATTCAGGCGACGTTGCAAGCAGCAGCGCTACCTCACCCGACGAAGCATCAAAC
GACGACGACACGAGCAGCAGCGGCACATCCTCTGAAGACGAGACCGACAACGATGACGCCAAACAGTCTCCTGCC
CCAAGCCGTGAGCACGCGCAAACCTCCCCTCCCACCAAAAAGGAAGCGAAAAACAAACGTTCTACCGCAAAAGAC
GGCTCACCCCCCCCCACAAGCTCCCCCAAAAGCCTGACCATCAAAATCCCCCAACTCGAGTCCCATCCCCCCGTC
CACCCGCTGGAAGCACTCTACAAGCGCCCGCATCCCGCCTCCGATACCACCAACGCACACCCCCAGCCCGAACCC
TTCAGCTTCTTCGGCGGAGCCCCAGGCGATGACGACGGTACGACGGCAGCAGCGAAAGAGAAGCCATCCACCCAT
CCCGTCTCCAAGATGCCCACGACGCCCTTTACCAGGCAGGACTTTGACCTCCGGGGCATCCGCAGCGCCGCCCCG
ACGCCCGATACGGCCCACCCGTCGAGGAGACACCTCTTCTGGGCCTCACAGGAAGACGCCGACGCAGAGGAGGAT
GGAGGCCGCGACGATGAAGACGAGGAGGACTTCGAGGGCGCGCCTCCTCCGACAGAGGGTCAGAGCGACTTTCAG
TCGTGGTTCTGGGAGAATAGGCGTGAGCTCAATCGGTCGTGGATGACGCGTCGTAAGACGGTGGCCAAGGAGAGG
CGTCACCGGGAGAATAAGGCGAGGACGTCTAGGGCTGCGTAG
Gene >Ophun1|3932
ATGCCCCCCGAAGCCGCTCCGGAGACTGATTACGTCCGGCTACACATCACGCCTCTAGACGCAGACCTCGTCAAC
GTCATCATCCCCGCCTCTGTCCGTCCGCGCTCGCGCAACCTCTCCTTCCACACGATCCAGACCTTCCCCGACAGG
CGCTACGGCTTTGTCGAGCTGCCGCGCATGGACGCCGACCGCCTGAAGAGCAAGCTCAACGGCTCACTCCTCAAG
GGCACTCGCATTCGTGTCGAAGACGCTCGTCCGGAAGAGCGCGTTGAGCCGACGGGCGACGACGCTCGTCCTGAC
AAGAAGCGCAAGATGTCAGCAGATGAAGCTCCTGACTCGAGCAAGAAGTCCAGACACAATAAGCCTCTGGACGGC
CTTCTTCTCAAGGACCGAAAGGTCAAGCGCGGCTGGACCGAGACGCCCAGCGCGAAGAAGAAGACGGCAAAAGAC
GGCCAGAAGCGACAAAAATCACGCTACACCGACAAGGAGGAGTGTCTGCTCAAGCTCAAGGTCCCACCCAACGCC
GCCGCCAATCTACCGTCCGCGACCAAGAAGAACAAGAAAAAGTCGCGAGAGGTGGTGGTTCACGAGTTTGAGAAG
ACGACCAAGTTCCCCAGCTTCCTGAAGACGGCTGCCCCCGACACGGACGGCAAGGCAGCAACCGAGTACGTCGAA
GGCAAGGGCTGGGTCGACGAGGATGGTGTAGTGCTTGAGGAGGTCAGGGACAAAAGAGCGGTGGAAGCGGCCGTC
TCTATTGCCCGTGGCAAGGAGGATTCAGGCGACGTTGCAAGCAGCAGCGCTACCTCACCCGACGAAGCATCAAAC
GACGACGACACGAGCAGCAGCGGCACATCCTCTGAAGACGAGACCGACAACGATGACGCCAAACAGTCTCCTGCC
CCAAGCCGTGAGCACGCGCAAACCTCCCCTCCCACCAAAAAGGAAGCGAAAAACAAACGTTCTACCGCAAAAGAC
GGCTCACCCCCCCCCACAAGCTCCCCCAAAAGCCTGACCATCAAAATCCCCCAACTCGAGTCCCATCCCCCCGTC
CACCCGCTGGAAGCACTCTACAAGCGCCCGCATCCCGCCTCCGATACCACCAACGCACACCCCCAGCCCGAACCC
TTCAGCTTCTTCGGCGGAGCCCCAGGCGATGACGACGGTACGACGGCAGCAGCGAAAGAGAAGCCATCCACCCAT
CCCGTCTCCAAGATGCCCACGACGCCCTTTACCAGGCAGGACTTTGACCTCCGGGGCATCCGCAGCGCCGCCCCG
ACGCCCGATACGGCCCACCCGTCGAGGAGACACCTCTTCTGGGCCTCACAGGAAGACGCCGACGCAGAGGAGGAT
GGAGGCCGCGACGATGAAGACGAGGAGGACTTCGAGGGCGCGCCTCCTCCGACAGAGGGTCAGAGCGACTTTCAG
TCGTGGTTCTGGGAGAATAGGCGTGAGCTCAATCGGTCGTGGATGACGCGTCGTAAGACGGTGGCCAAGGAGAGG
CGTCACCGGGAGAATAAGGCGAGGACGTCTAGGGCTGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail