Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3928
Gene name
LocationContig_356:5662..8167
Strand-
Gene length (bp)2505
Transcript length (bp)2448
Coding sequence length (bp)2448
Protein length (aa) 816

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03835 Rad4 Rad4 transglutaminase-like domain 5.2E-30 412 526
PF10405 BHD_3 Rad4 beta-hairpin domain 3 3.1E-26 660 731
PF10403 BHD_1 Rad4 beta-hairpin domain 1 8.3E-23 532 587
PF10404 BHD_2 Rad4 beta-hairpin domain 2 2.1E-17 591 653

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 171 771 5.0E-92
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 417 813 2.0E-56
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 417 770 7.0E-53
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 421 770 2.0E-47
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 421 811 9.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q10445|RHP41_SCHPO DNA repair protein rhp41 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp41 PE=3 SV=1 171 771 5.0E-92
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 417 813 2.0E-56
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 417 770 7.0E-53
sp|P51612|XPC_MOUSE DNA repair protein complementing XP-C cells homolog OS=Mus musculus GN=Xpc PE=1 SV=2 421 770 2.0E-47
sp|Q01831|XPC_HUMAN DNA repair protein complementing XP-C cells OS=Homo sapiens GN=XPC PE=1 SV=4 421 811 9.0E-46
sp|Q24595|XPC_DROME DNA repair protein complementing XP-C cells homolog OS=Drosophila melanogaster GN=Xpc PE=1 SV=2 421 770 4.0E-39
sp|Q8W489|RAD4_ARATH DNA repair protein RAD4 OS=Arabidopsis thaliana GN=RAD4 PE=1 SV=1 418 770 2.0E-29
sp|P14736|RAD4_YEAST DNA repair protein RAD4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD4 PE=1 SV=3 78 329 7.0E-15
sp|Q06665|RAD34_YEAST DNA repair protein RAD34 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD34 PE=1 SV=1 535 770 5.0E-11
sp|P87235|RHP42_SCHPO DNA repair protein rhp42 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp42 PE=3 SV=1 149 336 7.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3928
MRNISATWHSSAPDFAMVGQKRAAATRGRRRAGVSADDEEPDVYRQMLDEAGVTAQGPAEETERPLKRRRPGSRQ
LNRSPLRKGEESRPLATDTEVEDDDDDEGVEFQDVILPEPTVQTMERESDDEEDDDMAFENEFAKLSNDAQPPEA
KDLELNLTVPTTPTKGPAERRRPMTKEEKARRIDIHRTHLLCLLSHLSRRNHWCNDAKVHQTLRPLLSDKTIRYL
TPGAHLPQFGQAESLKTGLQQAADIWKTKFEIRERGLRRSLWADDPGQLDGYDPPGDMESCLDRADFRDAARKLQ
GSRDVGAQLYCALLRSVGVRARLVCSLQPLACVSGAPSMAKPKEKLRTPSKDKSQEALAKYEAMASRITASSPSG
ATARRRLGHPNAAAHDYKPVGRPSPSVGPAFEAPIKIRESHHPVYWVEVLDTGHQKWQPADPLVTDSFWKPRLLE
PPSTDKENCLCYVVAMEADGTAKDVTRRYAKAYTAKTRKLRIESTLDDGEKWWSRVMKLYKQRRTTDLDQIEDGE
LAGVEAREPMPRNVQDFKDHPVFALQRHLRRNEVLVPEAKPSGTVSAGSRGPLEKIYRRRDVRVARSVDKWFRLG
RLVKANEIPAKWLPKKARPRRSLAGDGEPEATDEDDPGTPIYRMDQTELYEPPAVCDGRVPKNKFGNIEVYVPSM
IPKGAVHVVGQDVTRAALIAGIDYAPALTGFQFQGRHGTAVLSGVVVAAEFEEALRVLMEGLAQQEQERISEERR
LGLLAGWRRLLMGLRIRERIWSGVDSDERREAEKQAELEAGLGSSETTEEMDMEMDDEGGGFLVE*
Coding >Ophun1|3928
ATGCGCAATATTTCGGCCACTTGGCATTCATCAGCTCCCGACTTTGCCATGGTTGGACAGAAACGCGCTGCTGCT
ACGAGAGGTCGAAGACGAGCAGGCGTCTCTGCCGACGACGAAGAGCCCGATGTCTACCGCCAGATGCTCGACGAA
GCCGGCGTCACAGCCCAAGGCCCTGCCGAGGAGACGGAGAGGCCGCTGAAGCGAAGGCGGCCTGGCTCTCGGCAG
TTGAACAGATCGCCACTGCGTAAAGGCGAAGAATCTCGACCGCTCGCGACCGACACCGAGGTCGAAGACGACGAC
GACGATGAGGGGGTCGAGTTTCAAGACGTCATCCTGCCGGAGCCTACCGTCCAGACCATGGAGCGCGAATCAGAC
GATGAGGAAGACGATGATATGGCGTTTGAGAACGAATTCGCCAAGTTAAGCAACGATGCTCAACCGCCAGAAGCC
AAAGACCTCGAGCTCAATCTCACTGTTCCCACGACGCCGACCAAGGGGCCAGCAGAGCGACGGCGACCCATGACC
AAGGAGGAAAAGGCACGACGCATAGACATACATCGGACGCATCTCTTGTGCTTGCTGTCGCATCTCTCGCGACGG
AATCACTGGTGCAATGACGCCAAGGTGCACCAGACTCTTCGCCCGCTGCTCTCGGACAAGACGATACGCTACCTG
ACTCCCGGGGCCCATCTGCCGCAGTTCGGACAGGCCGAGAGCCTCAAAACAGGGCTGCAGCAAGCGGCAGACATA
TGGAAGACCAAGTTTGAGATTCGCGAGCGCGGTTTGAGGAGATCGCTATGGGCAGATGATCCCGGGCAACTCGAC
GGCTACGATCCGCCCGGCGATATGGAGTCTTGTCTGGACCGTGCCGACTTTCGAGATGCGGCTAGGAAGCTTCAG
GGATCCAGAGACGTCGGCGCGCAGCTGTATTGTGCTCTCCTTCGCAGTGTCGGGGTTCGCGCGAGGCTCGTCTGT
TCCCTACAGCCTCTTGCCTGCGTATCGGGGGCGCCGTCCATGGCCAAGCCGAAAGAGAAGCTGCGTACGCCAAGC
AAAGACAAGTCGCAAGAAGCATTGGCCAAGTACGAGGCCATGGCTAGCAGGATAACCGCGTCGTCTCCGAGCGGA
GCCACGGCCAGACGCCGGCTCGGCCATCCGAACGCAGCAGCTCACGACTACAAGCCGGTTGGCCGGCCCTCGCCG
TCAGTAGGGCCAGCTTTTGAGGCGCCCATCAAGATACGCGAGTCGCACCATCCCGTCTATTGGGTCGAGGTGCTG
GATACAGGCCACCAAAAGTGGCAGCCGGCCGACCCCTTGGTCACGGATAGTTTCTGGAAGCCCAGATTGTTGGAG
CCCCCATCCACGGACAAGGAGAATTGTCTCTGCTACGTGGTAGCGATGGAAGCTGATGGGACGGCCAAAGACGTG
ACGAGAAGATATGCAAAAGCATACACGGCCAAGACGCGCAAGCTGCGCATCGAGAGCACGCTCGACGACGGAGAA
AAGTGGTGGAGCCGAGTCATGAAGCTATATAAGCAAAGACGGACGACGGACCTGGACCAGATCGAGGACGGGGAA
CTCGCCGGGGTCGAGGCTCGAGAACCTATGCCGCGGAACGTGCAGGACTTTAAAGACCATCCGGTCTTTGCTCTT
CAAAGACACCTGCGGCGCAACGAAGTGCTGGTCCCGGAAGCCAAACCGTCCGGGACCGTCAGCGCCGGGAGCCGG
GGTCCTTTGGAGAAGATATACCGGCGCCGGGATGTACGCGTCGCTCGAAGCGTCGACAAGTGGTTCCGTCTGGGA
CGGCTGGTCAAGGCCAACGAGATACCGGCCAAGTGGTTGCCCAAGAAAGCTCGGCCCAGACGTTCCTTGGCGGGA
GACGGCGAGCCAGAAGCAACGGACGAAGACGACCCTGGAACGCCCATCTACAGGATGGACCAGACGGAGCTGTAC
GAGCCACCGGCAGTGTGCGACGGGCGAGTGCCGAAGAACAAGTTTGGCAACATCGAGGTCTACGTGCCCAGCATG
ATCCCCAAGGGAGCCGTACATGTTGTCGGACAAGACGTCACGAGGGCGGCCCTGATAGCAGGTATCGATTACGCG
CCGGCGCTGACGGGATTCCAGTTCCAGGGCCGCCACGGGACCGCGGTATTGAGCGGAGTTGTGGTGGCGGCGGAG
TTTGAAGAGGCGCTGCGGGTGCTGATGGAGGGCCTGGCTCAGCAGGAGCAGGAGCGCATTTCGGAGGAGCGGCGT
CTTGGGCTGCTGGCTGGGTGGCGCAGGCTGCTGATGGGGCTGCGGATCCGCGAGAGGATCTGGAGCGGCGTCGAT
TCGGACGAGAGGCGCGAAGCCGAGAAGCAGGCCGAACTGGAGGCCGGCTTGGGCTCGAGCGAGACGACGGAAGAG
ATGGACATGGAGATGGATGACGAGGGAGGCGGCTTCTTGGTCGAGTAG
Transcript >Ophun1|3928
ATGCGCAATATTTCGGCCACTTGGCATTCATCAGCTCCCGACTTTGCCATGGTTGGACAGAAACGCGCTGCTGCT
ACGAGAGGTCGAAGACGAGCAGGCGTCTCTGCCGACGACGAAGAGCCCGATGTCTACCGCCAGATGCTCGACGAA
GCCGGCGTCACAGCCCAAGGCCCTGCCGAGGAGACGGAGAGGCCGCTGAAGCGAAGGCGGCCTGGCTCTCGGCAG
TTGAACAGATCGCCACTGCGTAAAGGCGAAGAATCTCGACCGCTCGCGACCGACACCGAGGTCGAAGACGACGAC
GACGATGAGGGGGTCGAGTTTCAAGACGTCATCCTGCCGGAGCCTACCGTCCAGACCATGGAGCGCGAATCAGAC
GATGAGGAAGACGATGATATGGCGTTTGAGAACGAATTCGCCAAGTTAAGCAACGATGCTCAACCGCCAGAAGCC
AAAGACCTCGAGCTCAATCTCACTGTTCCCACGACGCCGACCAAGGGGCCAGCAGAGCGACGGCGACCCATGACC
AAGGAGGAAAAGGCACGACGCATAGACATACATCGGACGCATCTCTTGTGCTTGCTGTCGCATCTCTCGCGACGG
AATCACTGGTGCAATGACGCCAAGGTGCACCAGACTCTTCGCCCGCTGCTCTCGGACAAGACGATACGCTACCTG
ACTCCCGGGGCCCATCTGCCGCAGTTCGGACAGGCCGAGAGCCTCAAAACAGGGCTGCAGCAAGCGGCAGACATA
TGGAAGACCAAGTTTGAGATTCGCGAGCGCGGTTTGAGGAGATCGCTATGGGCAGATGATCCCGGGCAACTCGAC
GGCTACGATCCGCCCGGCGATATGGAGTCTTGTCTGGACCGTGCCGACTTTCGAGATGCGGCTAGGAAGCTTCAG
GGATCCAGAGACGTCGGCGCGCAGCTGTATTGTGCTCTCCTTCGCAGTGTCGGGGTTCGCGCGAGGCTCGTCTGT
TCCCTACAGCCTCTTGCCTGCGTATCGGGGGCGCCGTCCATGGCCAAGCCGAAAGAGAAGCTGCGTACGCCAAGC
AAAGACAAGTCGCAAGAAGCATTGGCCAAGTACGAGGCCATGGCTAGCAGGATAACCGCGTCGTCTCCGAGCGGA
GCCACGGCCAGACGCCGGCTCGGCCATCCGAACGCAGCAGCTCACGACTACAAGCCGGTTGGCCGGCCCTCGCCG
TCAGTAGGGCCAGCTTTTGAGGCGCCCATCAAGATACGCGAGTCGCACCATCCCGTCTATTGGGTCGAGGTGCTG
GATACAGGCCACCAAAAGTGGCAGCCGGCCGACCCCTTGGTCACGGATAGTTTCTGGAAGCCCAGATTGTTGGAG
CCCCCATCCACGGACAAGGAGAATTGTCTCTGCTACGTGGTAGCGATGGAAGCTGATGGGACGGCCAAAGACGTG
ACGAGAAGATATGCAAAAGCATACACGGCCAAGACGCGCAAGCTGCGCATCGAGAGCACGCTCGACGACGGAGAA
AAGTGGTGGAGCCGAGTCATGAAGCTATATAAGCAAAGACGGACGACGGACCTGGACCAGATCGAGGACGGGGAA
CTCGCCGGGGTCGAGGCTCGAGAACCTATGCCGCGGAACGTGCAGGACTTTAAAGACCATCCGGTCTTTGCTCTT
CAAAGACACCTGCGGCGCAACGAAGTGCTGGTCCCGGAAGCCAAACCGTCCGGGACCGTCAGCGCCGGGAGCCGG
GGTCCTTTGGAGAAGATATACCGGCGCCGGGATGTACGCGTCGCTCGAAGCGTCGACAAGTGGTTCCGTCTGGGA
CGGCTGGTCAAGGCCAACGAGATACCGGCCAAGTGGTTGCCCAAGAAAGCTCGGCCCAGACGTTCCTTGGCGGGA
GACGGCGAGCCAGAAGCAACGGACGAAGACGACCCTGGAACGCCCATCTACAGGATGGACCAGACGGAGCTGTAC
GAGCCACCGGCAGTGTGCGACGGGCGAGTGCCGAAGAACAAGTTTGGCAACATCGAGGTCTACGTGCCCAGCATG
ATCCCCAAGGGAGCCGTACATGTTGTCGGACAAGACGTCACGAGGGCGGCCCTGATAGCAGGTATCGATTACGCG
CCGGCGCTGACGGGATTCCAGTTCCAGGGCCGCCACGGGACCGCGGTATTGAGCGGAGTTGTGGTGGCGGCGGAG
TTTGAAGAGGCGCTGCGGGTGCTGATGGAGGGCCTGGCTCAGCAGGAGCAGGAGCGCATTTCGGAGGAGCGGCGT
CTTGGGCTGCTGGCTGGGTGGCGCAGGCTGCTGATGGGGCTGCGGATCCGCGAGAGGATCTGGAGCGGCGTCGAT
TCGGACGAGAGGCGCGAAGCCGAGAAGCAGGCCGAACTGGAGGCCGGCTTGGGCTCGAGCGAGACGACGGAAGAG
ATGGACATGGAGATGGATGACGAGGGAGGCGGCTTCTTGGTCGAGTAG
Gene >Ophun1|3928
ATGCGCAATATTTCGGCCACTTGGCATTCATCAGCTCCCGACTTTGCCATGGTTGGACAGAAACGCGCTGCTGCT
ACGAGAGGTCGAAGACGAGCAGGCGTCTCTGCCGACGACGAAGAGCCCGATGTCTACCGCCAGATGCTCGACGAA
GCCGGCGTCACAGCCCAAGGCCCTGCCGAGGAGACGGAGAGGCCGCTGAAGCGAAGGCGGCCTGGCTCTCGGCAG
TTGAACAGATCGCCACTGCGTAAAGGCGAAGAATCTCGACCGCTCGCGACCGACACCGAGGTCGAAGACGACGAC
GACGATGAGGGGGTCGAGTTTCAAGACGTCATCCTGCCGGAGCCTACCGTCCAGACCATGGAGCGCGAATCAGAC
GATGAGGAAGACGATGATATGGCGTTTGAGAACGAATTCGCCAAGTTAAGCAACGATGCTCAACCGCCAGAAGCC
AAAGACCTCGAGCTCAATCTCACTGTTCCCACGACGCCGACCAAGGGGCCAGCAGAGCGACGGCGACCCATGACC
AAGGAGGAAAAGGCACGACGCATAGACATACATCGGACGCATCTCTTGTGCTTGCTGTCGCATCTCTCGCGACGG
AATCACTGGTGCAATGACGCCAAGGTGCACCAGACTCTTCGCCCGCTGCTCTCGGACAAGACGATACGCTACCTG
ACTCCCGGGGCCCATCTGCCGCAGTTCGGACAGGCCGAGAGCCTCAAAACAGGGCTGCAGCAAGCGGCAGACATA
TGGAAGACCAAGTTTGAGATTCGCGAGCGCGGTTTGAGGAGATCGCTATGGGCAGATGATCCCGGGCAACTCGAC
GGCGTGAGCGTCTGCGCAATCCCCCACCCTACTGAAAAGAAGCGCTGACGCAACCGCCAGTACGATCCGCCCGGC
GATATGGAGTCTTGTCTGGACCGTGCCGACTTTCGAGATGCGGCTAGGAAGCTTCAGGGATCCAGAGACGTCGGC
GCGCAGCTGTATTGTGCTCTCCTTCGCAGTGTCGGGGTTCGCGCGAGGCTCGTCTGTTCCCTACAGCCTCTTGCC
TGCGTATCGGGGGCGCCGTCCATGGCCAAGCCGAAAGAGAAGCTGCGTACGCCAAGCAAAGACAAGTCGCAAGAA
GCATTGGCCAAGTACGAGGCCATGGCTAGCAGGATAACCGCGTCGTCTCCGAGCGGAGCCACGGCCAGACGCCGG
CTCGGCCATCCGAACGCAGCAGCTCACGACTACAAGCCGGTTGGCCGGCCCTCGCCGTCAGTAGGGCCAGCTTTT
GAGGCGCCCATCAAGATACGCGAGTCGCACCATCCCGTCTATTGGGTCGAGGTGCTGGATACAGGCCACCAAAAG
TGGCAGCCGGCCGACCCCTTGGTCACGGATAGTTTCTGGAAGCCCAGATTGTTGGAGCCCCCATCCACGGACAAG
GAGAATTGTCTCTGCTACGTGGTAGCGATGGAAGCTGATGGGACGGCCAAAGACGTGACGAGAAGATATGCAAAA
GCATACACGGCCAAGACGCGCAAGCTGCGCATCGAGAGCACGCTCGACGACGGAGAAAAGTGGTGGAGCCGAGTC
ATGAAGCTATATAAGCAAAGACGGACGACGGACCTGGACCAGATCGAGGACGGGGAACTCGCCGGGGTCGAGGCT
CGAGAACCTATGCCGCGGAACGTGCAGGACTTTAAAGACCATCCGGTCTTTGCTCTTCAAAGACACCTGCGGCGC
AACGAAGTGCTGGTCCCGGAAGCCAAACCGTCCGGGACCGTCAGCGCCGGGAGCCGGGGTCCTTTGGAGAAGATA
TACCGGCGCCGGGATGTACGCGTCGCTCGAAGCGTCGACAAGTGGTTCCGTCTGGGACGGCTGGTCAAGGCCAAC
GAGATACCGGCCAAGTGGTTGCCCAAGAAAGCTCGGCCCAGACGTTCCTTGGCGGGAGACGGCGAGCCAGAAGCA
ACGGACGAAGACGACCCTGGAACGCCCATCTACAGGATGGACCAGACGGAGCTGTACGAGCCACCGGCAGTGTGC
GACGGGCGAGTGCCGAAGAACAAGTTTGGCAACATCGAGGTCTACGTGCCCAGCATGATCCCCAAGGGAGCCGTA
CATGTTGTCGGACAAGACGTCACGAGGGCGGCCCTGATAGCAGGTATCGATTACGCGCCGGCGCTGACGGGATTC
CAGTTCCAGGGCCGCCACGGGACCGCGGTATTGAGCGGAGTTGTGGTGGCGGCGGAGTTTGAAGAGGCGCTGCGG
GTGCTGATGGAGGGCCTGGCTCAGCAGGAGCAGGAGCGCATTTCGGAGGAGCGGCGTCTTGGGCTGCTGGCTGGG
TGGCGCAGGCTGCTGATGGGGCTGCGGATCCGCGAGAGGATCTGGAGCGGCGTCGATTCGGACGAGAGGCGCGAA
GCCGAGAAGCAGGCCGAACTGGAGGCCGGCTTGGGCTCGAGCGAGACGACGGAAGAGATGGACATGGAGATGGAT
GACGAGGGAGGCGGCTTCTTGGTCGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail