Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|3927
Gene name
LocationContig_356:36..4901
Strand-
Gene length (bp)4865
Transcript length (bp)4806
Coding sequence length (bp)4806
Protein length (aa) 1602

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00005 ABC_tran ABC transporter 6.7E-19 508 637
PF00005 ABC_tran ABC transporter 3.6E-26 1263 1406
PF13304 AAA_21 AAA domain, putative AbiEii toxin, Type IV TA system 2.3E-06 1376 1438
PF12698 ABC2_membrane_3 ABC-2 family transporter protein 2.3E-14 957 1210

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 325 1526 2.0E-100
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 505 1468 3.0E-100
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 505 1504 1.0E-93
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 325 791 4.0E-51
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 1010 1576 1.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 325 1526 2.0E-100
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 505 1468 3.0E-100
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 505 1504 1.0E-93
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 325 791 4.0E-51
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 1010 1576 1.0E-49
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 998 1533 5.0E-49
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 1006 1495 5.0E-49
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 998 1510 2.0E-48
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 1010 1576 2.0E-48
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 1010 1517 2.0E-48
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 999 1525 3.0E-48
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 999 1525 5.0E-48
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 999 1525 7.0E-48
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 474 786 2.0E-47
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 998 1533 8.0E-47
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 1010 1517 1.0E-46
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 474 744 2.0E-46
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 269 847 2.0E-46
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 320 822 3.0E-46
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 474 744 4.0E-46
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 505 835 9.0E-46
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 244 814 3.0E-45
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 334 835 4.0E-45
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 1010 1539 5.0E-45
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 266 775 9.0E-45
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 326 706 2.0E-44
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 505 839 5.0E-44
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 244 782 6.0E-44
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 504 776 1.0E-43
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 327 706 4.0E-43
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 293 775 5.0E-43
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 327 706 6.0E-43
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 327 774 7.0E-43
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 256 776 8.0E-43
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 297 706 1.0E-42
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 1248 1510 2.0E-42
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 506 809 2.0E-42
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 293 782 2.0E-42
sp|Q54DT1|ABCA9_DICDI ABC transporter A family member 9 OS=Dictyostelium discoideum GN=abcA9 PE=3 SV=1 457 776 6.0E-42
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 326 725 7.0E-42
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 317 789 5.0E-41
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 1224 1475 6.0E-41
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 507 703 6.0E-41
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 1004 1475 8.0E-41
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 295 768 2.0E-40
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 1224 1475 2.0E-40
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 504 775 3.0E-40
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 297 706 5.0E-40
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 930 1525 5.0E-40
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 469 790 6.0E-40
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 1026 1468 2.0E-39
sp|Q8T6J0|ABCA7_DICDI ABC transporter A family member 7 OS=Dictyostelium discoideum GN=abcA7 PE=3 SV=1 483 778 3.0E-39
sp|Q9FKF2|AB11A_ARATH ABC transporter A family member 11 OS=Arabidopsis thaliana GN=ABCA11 PE=3 SV=1 473 777 3.0E-39
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 1232 1504 1.0E-38
sp|Q9FLT5|AB9A_ARATH ABC transporter A family member 9 OS=Arabidopsis thaliana GN=ABCA9 PE=1 SV=1 473 781 1.0E-38
sp|Q84K47|AB2A_ARATH ABC transporter A family member 2 OS=Arabidopsis thaliana GN=ABCA2 PE=2 SV=1 473 786 2.0E-38
sp|Q8T6J2|ABCA5_DICDI ABC transporter A family member 5 OS=Dictyostelium discoideum GN=abcA5 PE=3 SV=1 1248 1502 3.0E-38
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 1252 1450 4.0E-38
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 311 780 4.0E-38
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 962 1475 5.0E-38
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 1050 1468 6.0E-38
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 496 794 6.0E-38
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 1232 1505 1.0E-37
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 1262 1486 1.0E-37
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 1235 1468 2.0E-37
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 1014 1508 2.0E-37
sp|Q84K47|AB2A_ARATH ABC transporter A family member 2 OS=Arabidopsis thaliana GN=ABCA2 PE=2 SV=1 1039 1468 2.0E-37
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 506 708 2.0E-37
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 1246 1506 3.0E-37
sp|Q9FLT4|AB10A_ARATH ABC transporter A family member 10 OS=Arabidopsis thaliana GN=ABCA10 PE=1 SV=2 1262 1522 4.0E-37
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 1262 1522 5.0E-37
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 1262 1547 5.0E-37
sp|Q9FLT5|AB9A_ARATH ABC transporter A family member 9 OS=Arabidopsis thaliana GN=ABCA9 PE=1 SV=1 1262 1468 6.0E-37
sp|Q9STT8|AB4A_ARATH ABC transporter A family member 4 OS=Arabidopsis thaliana GN=ABCA4 PE=3 SV=2 1262 1525 6.0E-37
sp|Q9STT7|AB5A_ARATH ABC transporter A family member 5 OS=Arabidopsis thaliana GN=ABCA5 PE=3 SV=2 1224 1522 6.0E-37
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 999 1504 7.0E-37
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 505 783 7.0E-37
sp|Q9FKF2|AB11A_ARATH ABC transporter A family member 11 OS=Arabidopsis thaliana GN=ABCA11 PE=3 SV=1 1262 1468 8.0E-37
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 1010 1475 8.0E-37
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 1238 1476 1.0E-36
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 1247 1476 2.0E-36
sp|Q8CF82|ABCA5_RAT ATP-binding cassette sub-family A member 5 OS=Rattus norvegicus GN=Abca5 PE=2 SV=1 1008 1531 2.0E-36
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 1228 1504 3.0E-36
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 505 783 4.0E-36
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 453 790 4.0E-36
sp|Q9FLT8|AB12A_ARATH ABC transporter A family member 12 OS=Arabidopsis thaliana GN=ABCA12 PE=3 SV=1 473 768 4.0E-36
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 467 770 5.0E-36
sp|Q8WWZ4|ABCAA_HUMAN ATP-binding cassette sub-family A member 10 OS=Homo sapiens GN=ABCA10 PE=2 SV=3 1259 1468 5.0E-36
sp|Q8T5Z7|ABCA1_DICDI ABC transporter A family member 1 OS=Dictyostelium discoideum GN=abcA1 PE=2 SV=1 493 769 6.0E-36
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 1248 1478 6.0E-36
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 1014 1517 7.0E-36
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 976 1468 8.0E-36
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 467 770 9.0E-36
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 1038 1557 1.0E-35
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 459 790 1.0E-35
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 497 790 1.0E-35
sp|Q54R52|ABCAA_DICDI ABC transporter A family member 10 OS=Dictyostelium discoideum GN=abcA10 PE=3 SV=1 466 708 1.0E-35
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 1242 1504 2.0E-35
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 1251 1468 3.0E-35
sp|Q54DT1|ABCA9_DICDI ABC transporter A family member 9 OS=Dictyostelium discoideum GN=abcA9 PE=3 SV=1 1213 1475 3.0E-35
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 1236 1487 4.0E-35
sp|Q8WWZ7|ABCA5_HUMAN ATP-binding cassette sub-family A member 5 OS=Homo sapiens GN=ABCA5 PE=2 SV=2 1008 1531 4.0E-35
sp|Q9STT6|AB6A_ARATH ABC transporter A family member 6 OS=Arabidopsis thaliana GN=ABCA6 PE=3 SV=2 1247 1468 4.0E-35
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 1247 1476 5.0E-35
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 467 770 6.0E-35
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 497 770 6.0E-35
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 1247 1508 6.0E-35
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 1248 1479 7.0E-35
sp|Q8K442|ABC8A_MOUSE ATP-binding cassette sub-family A member 8-A OS=Mus musculus GN=Abca8a PE=1 SV=2 1039 1515 7.0E-35
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 1262 1468 8.0E-35
sp|Q8K448|ABCA5_MOUSE ATP-binding cassette sub-family A member 5 OS=Mus musculus GN=Abca5 PE=1 SV=2 1008 1531 9.0E-35
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 1247 1476 1.0E-34
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 496 770 1.0E-34
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 1246 1459 1.0E-34
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 1243 1451 1.0E-34
sp|Q8LPK0|AB8A_ARATH ABC transporter A family member 8 OS=Arabidopsis thaliana GN=ABCA8 PE=2 SV=3 471 769 1.0E-34
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 1204 1479 2.0E-34
sp|Q8LPK0|AB8A_ARATH ABC transporter A family member 8 OS=Arabidopsis thaliana GN=ABCA8 PE=2 SV=3 1262 1488 2.0E-34
sp|Q9STT7|AB5A_ARATH ABC transporter A family member 5 OS=Arabidopsis thaliana GN=ABCA5 PE=3 SV=2 473 768 3.0E-34
sp|Q8T6J0|ABCA7_DICDI ABC transporter A family member 7 OS=Dictyostelium discoideum GN=abcA7 PE=3 SV=1 1248 1541 4.0E-34
sp|Q9STT5|AB7A_ARATH ABC transporter A family member 7 OS=Arabidopsis thaliana GN=ABCA7 PE=3 SV=2 473 767 4.0E-34
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 1248 1463 4.0E-34
sp|P55476|NODI_RHISN Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain NGR234) GN=nodI PE=3 SV=1 1244 1451 4.0E-34
sp|P72335|NODI_RHIS3 Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain N33) GN=nodI PE=3 SV=1 1243 1459 5.0E-34
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 1248 1451 5.0E-34
sp|Q8R420|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=1 SV=3 503 769 6.0E-34
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 1247 1506 6.0E-34
sp|Q99758|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2 503 768 9.0E-34
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 1195 1500 9.0E-34
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 1204 1479 1.0E-33
sp|Q9STT6|AB6A_ARATH ABC transporter A family member 6 OS=Arabidopsis thaliana GN=ABCA6 PE=3 SV=2 503 769 1.0E-33
sp|Q8K440|ABC8B_MOUSE ATP-binding cassette sub-family A member 8-B OS=Mus musculus GN=Abca8b PE=1 SV=2 1246 1468 2.0E-33
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 1246 1463 2.0E-33
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 1243 1459 2.0E-33
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 1243 1459 2.0E-33
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 1252 1451 3.0E-33
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 1243 1459 3.0E-33
sp|Q9STT8|AB4A_ARATH ABC transporter A family member 4 OS=Arabidopsis thaliana GN=ABCA4 PE=3 SV=2 473 768 4.0E-33
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 1243 1459 4.0E-33
sp|Q8K449|ABCA9_MOUSE ATP-binding cassette sub-family A member 9 OS=Mus musculus GN=Abca9 PE=1 SV=2 1225 1468 5.0E-33
sp|Q1PEH6|AB3A_ARATH ABC transporter A family member 3 OS=Arabidopsis thaliana GN=ABCA3 PE=2 SV=3 503 768 5.0E-33
sp|Q552P3|ABCAB_DICDI ABC transporter A family member 11 OS=Dictyostelium discoideum GN=abcA11 PE=3 SV=1 1254 1493 5.0E-33
sp|P23703|NODI_RHILO Nod factor export ATP-binding protein I OS=Rhizobium loti (strain MAFF303099) GN=nodI PE=3 SV=2 1253 1458 6.0E-33
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 1243 1459 8.0E-33
sp|Q1M7W6|NODI_RHIL3 Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nodI PE=3 SV=2 1236 1451 9.0E-33
sp|Q9FLT4|AB10A_ARATH ABC transporter A family member 10 OS=Arabidopsis thaliana GN=ABCA10 PE=1 SV=2 503 768 1.0E-32
sp|P08720|NODI_RHILV Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae GN=nodI PE=3 SV=1 1236 1451 1.0E-32
sp|Q9Z3I3|NODI_BRASS Nod factor export ATP-binding protein I OS=Bradyrhizobium sp. (strain SNU001) GN=nodI PE=3 SV=1 1243 1444 1.0E-32
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 1259 1469 2.0E-32
sp|Q8IUA7|ABCA9_HUMAN ATP-binding cassette sub-family A member 9 OS=Homo sapiens GN=ABCA9 PE=1 SV=1 1247 1508 3.0E-32
sp|Q9ESR9|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1 1238 1487 9.0E-32
sp|Q55BC0|ABCA8_DICDI ABC transporter A family member 8 OS=Dictyostelium discoideum GN=abcA8 PE=3 SV=1 499 712 1.0E-31
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 1246 1459 1.0E-31
sp|P41234|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4 1238 1487 2.0E-31
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 1082 1508 2.0E-31
sp|Q8N139|ABCA6_HUMAN ATP-binding cassette sub-family A member 6 OS=Homo sapiens GN=ABCA6 PE=1 SV=2 1259 1484 2.0E-31
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 1227 1507 3.0E-31
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 1252 1451 9.0E-31
sp|Q9BZC7|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3 1238 1480 1.0E-30
sp|Q54BT5|ABCA3_DICDI ABC transporter A family member 3 OS=Dictyostelium discoideum GN=abcA3 PE=3 SV=1 428 769 1.0E-30
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 1246 1512 2.0E-30
sp|Q552P3|ABCAB_DICDI ABC transporter A family member 11 OS=Dictyostelium discoideum GN=abcA11 PE=3 SV=1 455 784 2.0E-30
sp|Q54R52|ABCAA_DICDI ABC transporter A family member 10 OS=Dictyostelium discoideum GN=abcA10 PE=3 SV=1 1232 1466 3.0E-30
sp|Q91V24|ABCA7_MOUSE ATP-binding cassette sub-family A member 7 OS=Mus musculus GN=Abca7 PE=1 SV=1 506 792 4.0E-30
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 1222 1458 5.0E-30
sp|P34358|CED7_CAEEL ABC transporter ced-7 OS=Caenorhabditis elegans GN=ced-7 PE=1 SV=6 506 785 7.0E-30
sp|Q84M24|AB1A_ARATH ABC transporter A family member 1 OS=Arabidopsis thaliana GN=ABCA1 PE=2 SV=2 470 717 8.0E-30
sp|Q7TNJ2|ABCA7_RAT ATP-binding cassette sub-family A member 7 OS=Rattus norvegicus GN=Abca7 PE=1 SV=1 463 770 9.0E-30
sp|Q555Z5|ABCA4_DICDI ABC transporter A family member 4 OS=Dictyostelium discoideum GN=abcA4 PE=3 SV=1 463 770 2.0E-29
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 1248 1469 3.0E-29
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 1248 1469 3.0E-29
sp|Q86UK0|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3 502 708 4.0E-29
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 247 776 1.0E-28
sp|Q5SSE9|ABCAD_MOUSE ATP-binding cassette sub-family A member 13 OS=Mus musculus GN=Abca13 PE=2 SV=1 506 770 2.0E-28
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 1247 1466 2.0E-28
sp|Q8K441|ABCA6_MOUSE ATP-binding cassette sub-family A member 6 OS=Mus musculus GN=Abca6 PE=1 SV=2 497 790 5.0E-28
sp|Q8IZY2|ABCA7_HUMAN ATP-binding cassette sub-family A member 7 OS=Homo sapiens GN=ABCA7 PE=1 SV=3 466 783 6.0E-28
sp|Q46YX6|NODI_CUPPJ Nod factor export ATP-binding protein I OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nodI PE=3 SV=1 1248 1444 7.0E-28
sp|P72335|NODI_RHIS3 Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain N33) GN=nodI PE=3 SV=1 505 767 1.0E-27
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 1247 1452 2.0E-27
sp|Q39GT7|NODI_BURL3 Nod factor export ATP-binding protein I OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=nodI PE=3 SV=2 505 767 3.0E-27
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 1247 1452 4.0E-27
sp|Q1BWI2|NODI_BURCA Nod factor export ATP-binding protein I OS=Burkholderia cenocepacia (strain AU 1054) GN=nodI PE=3 SV=1 505 767 5.0E-27
sp|P41233|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4 506 775 8.0E-27
sp|Q8XXY9|NODI_RALSO Nod factor export ATP-binding protein I OS=Ralstonia solanacearum (strain GMI1000) GN=nodI PE=3 SV=1 507 767 1.0E-26
sp|O95477|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3 506 775 3.0E-26
sp|P9WQL9|DRRA_MYCTU Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=drrA PE=1 SV=1 1250 1468 4.0E-26
sp|P9WQL8|DRRA_MYCTO Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=drrA PE=3 SV=1 1250 1468 4.0E-26
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 1248 1468 7.0E-26
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 1248 1450 8.0E-26
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 1248 1471 9.0E-26
sp|Q86UQ4|ABCAD_HUMAN ATP-binding cassette sub-family A member 13 OS=Homo sapiens GN=ABCA13 PE=2 SV=3 487 708 1.0E-25
sp|P32010|DRRA_STRPE Daunorubicin/doxorubicin resistance ATP-binding protein DrrA OS=Streptomyces peucetius GN=drrA PE=1 SV=1 1253 1480 1.0E-25
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 1247 1452 3.0E-25
sp|P31134|POTG_ECOLI Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2 1248 1478 3.0E-25
sp|O35600|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1 474 770 5.0E-25
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 1248 1463 5.0E-25
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 1248 1487 5.0E-25
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 1247 1452 6.0E-25
sp|P32010|DRRA_STRPE Daunorubicin/doxorubicin resistance ATP-binding protein DrrA OS=Streptomyces peucetius GN=drrA PE=1 SV=1 473 701 8.0E-25
sp|P94440|YFIL_BACSU Uncharacterized ABC transporter ATP-binding protein YfiL OS=Bacillus subtilis (strain 168) GN=yfiL PE=3 SV=2 507 702 1.0E-24
sp|Q8KLG1|NODI_RHIEC Nod factor export ATP-binding protein I OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=nodI PE=3 SV=3 507 767 1.0E-24
sp|P78363|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3 506 770 2.0E-24
sp|Q1LKJ2|NODI_CUPMC Nod factor export ATP-binding protein I OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=nodI PE=3 SV=1 505 696 2.0E-24
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 1248 1466 2.0E-24
sp|P23703|NODI_RHILO Nod factor export ATP-binding protein I OS=Rhizobium loti (strain MAFF303099) GN=nodI PE=3 SV=2 505 767 3.0E-24
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 1248 1463 3.0E-24
sp|Q110U3|POTA_TRIEI Spermidine/putrescine import ATP-binding protein PotA OS=Trichodesmium erythraeum (strain IMS101) GN=potA PE=3 SV=1 1248 1465 3.0E-24
sp|P54592|YHCH_BACSU Uncharacterized ABC transporter ATP-binding protein YhcH OS=Bacillus subtilis (strain 168) GN=yhcH PE=3 SV=1 1248 1455 4.0E-24
sp|Q8U3E0|Y528_PYRFU Putative ABC transporter ATP-binding protein PF0528 OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=PF0528 PE=3 SV=1 1250 1438 5.0E-24
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 1240 1466 6.0E-24
sp|Q2SVP3|NODI_BURTA Nod factor export ATP-binding protein I OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=nodI PE=3 SV=2 505 767 7.0E-24
sp|Q28K97|TAUB_JANSC Taurine import ATP-binding protein TauB OS=Jannaschia sp. (strain CCS1) GN=tauB PE=3 SV=1 1247 1453 7.0E-24
sp|Q8GNH6|NODI_RHIML Nod factor export ATP-binding protein I OS=Rhizobium meliloti GN=nodI PE=3 SV=1 507 767 8.0E-24
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 1247 1463 8.0E-24
sp|O52618|NODI_RHIME Nod factor export ATP-binding protein I OS=Rhizobium meliloti (strain 1021) GN=nodI PE=3 SV=3 459 767 1.0E-23
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 1248 1460 1.0E-23
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 1248 1459 1.0E-23
sp|Q3MAR5|POTA_ANAVT Spermidine/putrescine import ATP-binding protein PotA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=potA PE=3 SV=1 1245 1466 1.0E-23
sp|Q8T6J5|ABCA2_DICDI ABC transporter A family member 2 OS=Dictyostelium discoideum GN=abcA2 PE=3 SV=1 498 786 2.0E-23
sp|P50332|NODI_RHIGA Nod factor export ATP-binding protein I OS=Rhizobium galegae GN=nodI PE=3 SV=1 507 767 2.0E-23
sp|O94911|ABCA8_HUMAN ATP-binding cassette sub-family A member 8 OS=Homo sapiens GN=ABCA8 PE=1 SV=3 1006 1517 3.0E-23
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 1248 1471 3.0E-23
sp|Q8YM92|POTA_NOSS1 Spermidine/putrescine import ATP-binding protein PotA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=potA PE=3 SV=1 1245 1466 3.0E-23
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 1248 1440 3.0E-23
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 1250 1463 3.0E-23
sp|Q1AS06|POTA_RUBXD Spermidine/putrescine import ATP-binding protein PotA OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=potA PE=3 SV=1 1245 1451 3.0E-23
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 1247 1477 7.0E-23
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 1247 1477 7.0E-23
sp|P26050|NODI_BRADU Nod factor export ATP-binding protein I OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=nodI PE=3 SV=2 505 767 8.0E-23
sp|Q3JSQ0|NODI_BURP1 Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain 1710b) GN=nodI PE=3 SV=2 505 774 8.0E-23
sp|Q62K72|NODI_BURMA Nod factor export ATP-binding protein I OS=Burkholderia mallei (strain ATCC 23344) GN=nodI PE=3 SV=2 505 774 8.0E-23
sp|P36879|YADG_ECOLI Uncharacterized ABC transporter ATP-binding protein YadG OS=Escherichia coli (strain K12) GN=yadG PE=3 SV=1 1247 1450 8.0E-23
sp|Q63TX3|NODI_BURPS Nod factor export ATP-binding protein I OS=Burkholderia pseudomallei (strain K96243) GN=nodI PE=3 SV=2 505 698 1.0E-22
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 1246 1478 1.0E-22
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 1247 1466 1.0E-22
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 1250 1463 1.0E-22
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 1247 1466 1.0E-22
sp|Q98K23|CYSA_RHILO Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhizobium loti (strain MAFF303099) GN=cysA PE=3 SV=1 1248 1463 1.0E-22
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 1248 1459 1.0E-22
sp|Q9Z3I3|NODI_BRASS Nod factor export ATP-binding protein I OS=Bradyrhizobium sp. (strain SNU001) GN=nodI PE=3 SV=1 505 767 2.0E-22
sp|Q65UE1|POTA_MANSM Spermidine/putrescine import ATP-binding protein PotA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=potA PE=3 SV=1 1248 1452 2.0E-22
sp|Q2YAD6|POTA_NITMU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=potA PE=3 SV=1 1248 1452 2.0E-22
sp|Q02R79|POTA_PSEAB Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1 1243 1452 2.0E-22
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 1248 1452 2.0E-22
sp|Q9HY19|POTA2_PSEAE Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1 1243 1452 2.0E-22
sp|Q8T6J1|ABCA6_DICDI ABC transporter A family member 6 OS=Dictyostelium discoideum GN=abcA6 PE=3 SV=1 358 708 3.0E-22
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 1247 1453 3.0E-22
sp|O31427|SKFE_BACSU SkfA peptide export ATP-binding protein SkfE OS=Bacillus subtilis (strain 168) GN=skfE PE=1 SV=1 1248 1438 3.0E-22
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 1250 1465 3.0E-22
sp|P9WQL9|DRRA_MYCTU Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=drrA PE=1 SV=1 469 709 4.0E-22
sp|P9WQL8|DRRA_MYCTO Doxorubicin resistance ATP-binding protein DrrA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=drrA PE=3 SV=1 469 709 4.0E-22
sp|Q62K82|CYSA_BURMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia mallei (strain ATCC 23344) GN=cysA PE=3 SV=1 1247 1459 4.0E-22
sp|Q63TY1|CYSA_BURPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia pseudomallei (strain K96243) GN=cysA PE=3 SV=1 1247 1459 4.0E-22
sp|Q3JKX3|TAUB_BURP1 Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain 1710b) GN=tauB PE=3 SV=1 1258 1496 4.0E-22
sp|Q62AW4|TAUB_BURMA Taurine import ATP-binding protein TauB OS=Burkholderia mallei (strain ATCC 23344) GN=tauB PE=3 SV=1 1258 1496 4.0E-22
sp|P42332|BCRA_BACLI Bacitracin transport ATP-binding protein BcrA OS=Bacillus licheniformis GN=bcrA PE=3 SV=1 1248 1475 4.0E-22
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 1248 1450 5.0E-22
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 1248 1450 5.0E-22
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 1248 1542 5.0E-22
sp|Q9A7X1|CYSA_CAUCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cysA PE=3 SV=2 1248 1463 6.0E-22
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 1227 1438 6.0E-22
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 1227 1438 6.0E-22
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 1248 1466 7.0E-22
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 1248 1452 7.0E-22
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 1248 1463 9.0E-22
sp|Q63JZ3|TAUB_BURPS Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain K96243) GN=tauB PE=3 SV=1 1258 1496 9.0E-22
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 1248 1452 1.0E-21
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 1250 1466 1.0E-21
sp|O07016|YVFR_BACSU Uncharacterized ABC transporter ATP-binding protein YvfR OS=Bacillus subtilis (strain 168) GN=yvfR PE=3 SV=1 506 699 2.0E-21
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 1248 1446 2.0E-21
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 1248 1456 2.0E-21
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 1248 1463 2.0E-21
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 1248 1463 2.0E-21
sp|Q13ZJ1|NODI_BURXL Nod factor export ATP-binding protein I OS=Burkholderia xenovorans (strain LB400) GN=nodI PE=3 SV=1 507 692 3.0E-21
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 1248 1463 3.0E-21
sp|Q0AGF4|POTA_NITEC Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas eutropha (strain C91) GN=potA PE=3 SV=1 1248 1451 3.0E-21
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 1248 1463 3.0E-21
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 1248 1463 3.0E-21
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 1248 1505 4.0E-21
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 1248 1446 4.0E-21
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 1248 1455 4.0E-21
sp|Q72FW5|POTA_DESVH Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=potA PE=3 SV=1 1248 1465 4.0E-21
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 1248 1452 4.0E-21
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 1248 1479 5.0E-21
sp|Q5WDP1|METN3_BACSK Methionine import ATP-binding protein MetN 3 OS=Bacillus clausii (strain KSM-K16) GN=metN3 PE=3 SV=1 1248 1450 6.0E-21
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 1248 1452 6.0E-21
sp|Q30V33|POTA_DESAG Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio alaskensis (strain G20) GN=potA PE=3 SV=1 1248 1466 6.0E-21
sp|Q1M7W6|NODI_RHIL3 Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=nodI PE=3 SV=2 505 767 7.0E-21
sp|Q82TL6|POTA_NITEU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=potA PE=3 SV=1 1248 1452 8.0E-21
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 1248 1452 9.0E-21
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 1248 1452 9.0E-21
sp|Q3KBH4|POTA_PSEPF Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf0-1) GN=potA PE=3 SV=1 1244 1471 9.0E-21
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 1248 1452 9.0E-21
sp|P08720|NODI_RHILV Nod factor export ATP-binding protein I OS=Rhizobium leguminosarum bv. viciae GN=nodI PE=3 SV=1 505 767 1.0E-20
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 1248 1459 1.0E-20
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 1246 1465 1.0E-20
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 1246 1465 1.0E-20
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 1246 1465 1.0E-20
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 1246 1465 1.0E-20
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 1248 1452 1.0E-20
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 1248 1463 1.0E-20
sp|Q578K3|FBPC_BRUAB Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus biovar 1 (strain 9-941) GN=fbpC PE=3 SV=1 1243 1444 1.0E-20
sp|Q2YKX3|FBPC_BRUA2 Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus (strain 2308) GN=fbpC PE=3 SV=1 1243 1444 1.0E-20
sp|P55476|NODI_RHISN Nod factor export ATP-binding protein I OS=Rhizobium sp. (strain NGR234) GN=nodI PE=3 SV=1 505 768 2.0E-20
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 506 702 2.0E-20
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 506 702 2.0E-20
sp|Q97KS6|POTA_CLOAB Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=potA PE=3 SV=1 1248 1452 2.0E-20
sp|C0SPB4|YHAQ_BACSU Uncharacterized ABC transporter ATP-binding protein YhaQ OS=Bacillus subtilis (strain 168) GN=yhaQ PE=3 SV=1 1248 1470 2.0E-20
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 1248 1452 2.0E-20
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 1248 1452 2.0E-20
sp|Q8FVV5|FBPC_BRUSU Fe(3+) ions import ATP-binding protein FbpC OS=Brucella suis biovar 1 (strain 1330) GN=fbpC PE=3 SV=1 1243 1415 2.0E-20
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 1248 1452 2.0E-20
sp|Q58429|Y1023_METJA Uncharacterized ABC transporter ATP-binding protein MJ1023 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1023 PE=3 SV=1 1248 1469 2.0E-20
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 1248 1456 3.0E-20
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 1248 1463 3.0E-20
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 1262 1504 3.0E-20
sp|Q0SRL2|POTA_CLOPS Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2 1248 1440 3.0E-20
sp|O34977|YTHP_BACSU Uncharacterized ABC transporter ATP-binding protein YthP OS=Bacillus subtilis (strain 168) GN=ythP PE=3 SV=1 512 701 3.0E-20
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 1238 1463 3.0E-20
sp|Q7NWX3|CYSA2_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA2 PE=3 SV=1 1248 1522 3.0E-20
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 1247 1463 3.0E-20
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 1248 1452 3.0E-20
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 1248 1456 3.0E-20
sp|A1TAI4|POTA_MYCVP Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=potA PE=3 SV=1 1248 1451 3.0E-20
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 1248 1446 3.0E-20
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 1250 1463 3.0E-20
sp|P54591|YHCG_BACSU Uncharacterized ABC transporter ATP-binding protein YhcG OS=Bacillus subtilis (strain 168) GN=yhcG PE=3 SV=1 1248 1468 4.0E-20
sp|Q07756|NODI_AZOC5 Nod factor export ATP-binding protein I OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodI PE=3 SV=1 1270 1446 4.0E-20
sp|Q89UD2|CYSA_BRADU Sulfate/thiosulfate import ATP-binding protein CysA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysA PE=3 SV=1 1248 1463 5.0E-20
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 1248 1522 5.0E-20
sp|Q2K8C8|FBPC_RHIEC Fe(3+) ions import ATP-binding protein FbpC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fbpC PE=3 SV=1 1243 1446 6.0E-20
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 1250 1459 6.0E-20
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 1259 1450 6.0E-20
sp|Q8XIZ5|POTA_CLOPE Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain 13 / Type A) GN=potA PE=3 SV=1 1248 1440 7.0E-20
sp|Q0TNZ3|POTA_CLOP1 Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=potA PE=3 SV=1 1248 1440 7.0E-20
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 1248 1459 7.0E-20
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 1248 1459 7.0E-20
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 1248 1459 7.0E-20
sp|Q46YX6|NODI_CUPPJ Nod factor export ATP-binding protein I OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=nodI PE=3 SV=1 505 696 8.0E-20
sp|Q815Y7|METN3_BACCR Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN3 PE=3 SV=1 1258 1452 8.0E-20
sp|Q72Y96|METN3_BACC1 Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN3 PE=3 SV=1 1258 1452 8.0E-20
sp|Q92WJ0|FBPC1_RHIME Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhizobium meliloti (strain 1021) GN=fbpC1 PE=3 SV=1 1242 1446 8.0E-20
sp|Q13LD8|METN2_BURXL Methionine import ATP-binding protein MetN 2 OS=Burkholderia xenovorans (strain LB400) GN=metN2 PE=3 SV=1 1231 1438 9.0E-20
sp|Q9K789|METN_BACHD Methionine import ATP-binding protein MetN OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metN PE=3 SV=1 1258 1488 9.0E-20
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 1262 1453 9.0E-20
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 1248 1459 9.0E-20
sp|Q9MUN1|CYSA_MESVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1 1250 1444 1.0E-19
sp|Q39AT4|METN2_BURL3 Methionine import ATP-binding protein MetN 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN2 PE=3 SV=1 1248 1438 1.0E-19
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 1248 1479 1.0E-19
sp|Q631Y4|METN3_BACCZ Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ZK / E33L) GN=metN3 PE=3 SV=1 1258 1452 1.0E-19
sp|Q81XL3|METN3_BACAN Methionine import ATP-binding protein MetN 3 OS=Bacillus anthracis GN=metN3 PE=3 SV=1 1258 1452 1.0E-19
sp|A1TXH7|POTA_MARHV Spermidine/putrescine import ATP-binding protein PotA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=potA PE=3 SV=1 1248 1479 1.0E-19
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 1246 1438 1.0E-19
sp|Q6HBS0|METN2_BACHK Methionine import ATP-binding protein MetN 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metN2 PE=3 SV=1 1258 1452 1.0E-19
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 1248 1466 1.0E-19
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 1248 1451 1.0E-19
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 1248 1479 1.0E-19
sp|Q8Y8T6|POTA_LISMO Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2 1242 1452 1.0E-19
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 1248 1463 1.0E-19
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 1239 1441 2.0E-19
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 1239 1441 2.0E-19
sp|P42246|YCBN_BACSU Uncharacterized ABC transporter ATP-binding protein YcbN OS=Bacillus subtilis (strain 168) GN=ycbN PE=3 SV=4 1253 1464 2.0E-19
sp|Q92DL6|POTA_LISIN Spermidine/putrescine import ATP-binding protein PotA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=potA PE=3 SV=2 1242 1452 2.0E-19
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 504 709 2.0E-19
sp|Q9KS33|POTA_VIBCH Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1 1236 1446 2.0E-19
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 1248 1451 2.0E-19
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 504 709 2.0E-19
sp|P19844|NOSF_PSEST Copper transport ATP-binding protein NosF OS=Pseudomonas stutzeri GN=nosF PE=3 SV=1 1248 1468 2.0E-19
sp|Q722B1|POTA_LISMF Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=potA PE=3 SV=2 1242 1452 2.0E-19
sp|Q6NBT1|CYSA_RHOPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysA PE=3 SV=1 1248 1466 2.0E-19
sp|Q8YCG3|FBPC_BRUME Fe(3+) ions import ATP-binding protein FbpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fbpC PE=3 SV=1 1243 1444 2.0E-19
sp|Q57855|Y412_METJA Uncharacterized ABC transporter ATP-binding protein MJ0412 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0412 PE=3 SV=1 1248 1453 2.0E-19
sp|A0AGP9|POTA_LISW6 Spermidine/putrescine import ATP-binding protein PotA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=potA PE=3 SV=1 1242 1452 2.0E-19
sp|O83658|POTA_TREPA Spermidine/putrescine import ATP-binding protein PotA OS=Treponema pallidum (strain Nichols) GN=potA PE=3 SV=1 1243 1466 2.0E-19
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 1248 1499 2.0E-19
sp|P9WQL6|FLQE1_MYCTO Fluoroquinolones export ATP-binding protein MT2762 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2762 PE=3 SV=1 1248 1486 2.0E-19
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 1248 1499 3.0E-19
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 1248 1499 3.0E-19
sp|Q6AM16|PSTB_DESPS Phosphate import ATP-binding protein PstB OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pstB PE=3 SV=1 1229 1471 3.0E-19
sp|Q8FV85|METN_BRUSU Methionine import ATP-binding protein MetN OS=Brucella suis biovar 1 (strain 1330) GN=metN PE=3 SV=2 1222 1456 3.0E-19
sp|Q8YD40|METN_BRUME Methionine import ATP-binding protein MetN OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=metN PE=3 SV=1 1222 1456 3.0E-19
sp|Q579H8|METN_BRUAB Methionine import ATP-binding protein MetN OS=Brucella abortus biovar 1 (strain 9-941) GN=metN PE=3 SV=2 1222 1456 3.0E-19
sp|Q2YIV5|METN_BRUA2 Methionine import ATP-binding protein MetN OS=Brucella abortus (strain 2308) GN=metN PE=3 SV=2 1222 1456 3.0E-19
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 1248 1463 3.0E-19
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 1248 1479 3.0E-19
sp|Q1B677|METN_MYCSS Methionine import ATP-binding protein MetN OS=Mycobacterium sp. (strain MCS) GN=metN PE=3 SV=2 1248 1463 3.0E-19
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 1248 1461 3.0E-19
sp|O32169|METN_BACSU Methionine import ATP-binding protein MetN OS=Bacillus subtilis (strain 168) GN=metN PE=1 SV=1 1258 1450 4.0E-19
sp|Q65F80|METN2_BACLD Methionine import ATP-binding protein MetN 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN2 PE=3 SV=1 1248 1450 4.0E-19
sp|P9WQL7|FLQE1_MYCTU Fluoroquinolones export ATP-binding protein Rv2688c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2688c PE=1 SV=1 1248 1486 4.0E-19
sp|Q98HF7|POTA_RHILO Spermidine/putrescine import ATP-binding protein PotA OS=Rhizobium loti (strain MAFF303099) GN=potA PE=3 SV=1 1248 1485 4.0E-19
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 1248 1466 5.0E-19
sp|Q2T751|TAUB_BURTA Taurine import ATP-binding protein TauB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tauB PE=3 SV=1 1258 1496 5.0E-19
sp|Q9Z3R9|AGLK_RHIME Alpha-glucoside transport ATP-binding protein AglK OS=Rhizobium meliloti (strain 1021) GN=aglK PE=3 SV=2 504 699 5.0E-19
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 1246 1441 5.0E-19
sp|Q5PJL1|UGPC_SALPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ugpC PE=3 SV=1 1246 1480 5.0E-19
sp|Q8Z245|UGPC_SALTI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhi GN=ugpC PE=3 SV=1 1246 1480 5.0E-19
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 1248 1452 5.0E-19
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 500 709 5.0E-19
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 500 692 6.0E-19
sp|Q6ME20|METN_PARUW Methionine import ATP-binding protein MetN OS=Protochlamydia amoebophila (strain UWE25) GN=metN PE=3 SV=1 1248 1451 6.0E-19
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 1250 1463 6.0E-19
sp|Q63H29|METN1_BACCZ Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ZK / E33L) GN=metN1 PE=3 SV=1 1248 1547 6.0E-19
sp|Q8Z1U0|MALK_SALTI Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhi GN=malK PE=3 SV=1 1246 1503 7.0E-19
sp|Q8ZLF4|UGPC_SALTY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ugpC PE=1 SV=1 1246 1480 7.0E-19
sp|Q14Q07|POTA_SPICI Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1 1248 1451 7.0E-19
sp|Q9CP06|POTA_PASMU Spermidine/putrescine import ATP-binding protein PotA OS=Pasteurella multocida (strain Pm70) GN=potA PE=3 SV=2 1248 1452 7.0E-19
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 1250 1463 8.0E-19
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 1248 1421 8.0E-19
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 506 696 8.0E-19
sp|P19566|MALK_SALTY Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=malK PE=1 SV=3 1246 1503 9.0E-19
sp|Q57GZ7|MALK_SALCH Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella choleraesuis (strain SC-B67) GN=malK PE=3 SV=1 1246 1503 9.0E-19
sp|P36879|YADG_ECOLI Uncharacterized ABC transporter ATP-binding protein YadG OS=Escherichia coli (strain K12) GN=yadG PE=3 SV=1 504 687 1.0E-18
sp|Q9Z3R9|AGLK_RHIME Alpha-glucoside transport ATP-binding protein AglK OS=Rhizobium meliloti (strain 1021) GN=aglK PE=3 SV=2 1247 1528 1.0E-18
sp|Q65QT6|MALK_MANSM Maltose/maltodextrin import ATP-binding protein MalK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=malK PE=3 SV=1 1246 1502 1.0E-18
sp|Q57IS3|UGPC_SALCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella choleraesuis (strain SC-B67) GN=ugpC PE=3 SV=1 1246 1480 1.0E-18
sp|Q4K681|POTA_PSEF5 Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=potA PE=3 SV=1 1248 1479 1.0E-18
sp|Q1GIE5|POTA_RUEST Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria sp. (strain TM1040) GN=potA PE=3 SV=1 1248 1451 1.0E-18
sp|Q13KX9|TAUB2_BURXL Taurine import ATP-binding protein TauB 2 OS=Burkholderia xenovorans (strain LB400) GN=tauB2 PE=3 SV=1 1248 1453 1.0E-18
sp|Q8RGC8|FBPC_FUSNN Fe(3+) ions import ATP-binding protein FbpC OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fbpC PE=3 SV=1 1248 1450 1.0E-18
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 1248 1451 1.0E-18
sp|Q62B84|METN2_BURMA Methionine import ATP-binding protein MetN 2 OS=Burkholderia mallei (strain ATCC 23344) GN=metN2 PE=3 SV=2 1258 1438 1.0E-18
sp|Q8U6M1|FBPC_AGRFC Fe(3+) ions import ATP-binding protein FbpC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fbpC PE=3 SV=1 1243 1456 1.0E-18
sp|Q63NI4|METN2_BURPS Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain K96243) GN=metN2 PE=3 SV=2 1258 1438 1.0E-18
sp|Q3JHC9|METN2_BURP1 Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain 1710b) GN=metN2 PE=3 SV=2 1258 1438 1.0E-18
sp|Q9JZW0|CYSA_NEIMB Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysA PE=3 SV=1 1248 1440 1.0E-18
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 1248 1466 1.0E-18
sp|P33982|Y3926_AZOC5 Probable ABC transporter ATP-binding protein AZC_3926 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_3926 PE=3 SV=1 1237 1450 1.0E-18
sp|Q2KVK2|METN_BORA1 Methionine import ATP-binding protein MetN OS=Bordetella avium (strain 197N) GN=metN PE=3 SV=1 1248 1451 1.0E-18
sp|Q5LVM5|TAUB_RUEPO Taurine import ATP-binding protein TauB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tauB PE=3 SV=1 1246 1453 1.0E-18
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 1248 1421 2.0E-18
sp|Q1RGL1|ZNUC_RICBR Zinc import ATP-binding protein ZnuC OS=Rickettsia bellii (strain RML369-C) GN=znuC PE=3 SV=1 1248 1422 2.0E-18
sp|Q81VM2|METN1_BACAN Methionine import ATP-binding protein MetN 1 OS=Bacillus anthracis GN=metN1 PE=3 SV=1 1248 1545 2.0E-18
sp|Q04G50|POTA_OENOB Spermidine/putrescine import ATP-binding protein PotA OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=potA PE=3 SV=2 1240 1444 2.0E-18
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 1248 1451 2.0E-18
sp|Q0TA26|MALK_ECOL5 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=malK PE=3 SV=1 1246 1478 2.0E-18
sp|Q58488|ECFA_METJA Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ecfA PE=3 SV=1 1248 1438 2.0E-18
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 1246 1463 2.0E-18
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 1248 1459 2.0E-18
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 1246 1478 2.0E-18
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 1248 1466 2.0E-18
sp|Q5PKZ8|MALK_SALPA Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=malK PE=3 SV=1 1246 1503 2.0E-18
sp|Q9I6T2|POTA1_PSEAE Spermidine/putrescine import ATP-binding protein PotA 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA1 PE=3 SV=1 1248 1479 2.0E-18
sp|Q6HLQ9|POTA_BACHK Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=potA PE=3 SV=2 1248 1452 2.0E-18
sp|Q63E84|POTA_BACCZ Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ZK / E33L) GN=potA PE=3 SV=2 1248 1452 2.0E-18
sp|Q73BM0|POTA_BACC1 Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=potA PE=3 SV=1 1248 1452 2.0E-18
sp|A0RBB0|POTA_BACAH Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis (strain Al Hakam) GN=potA PE=3 SV=1 1248 1452 2.0E-18
sp|Q7VV72|METN_BORPE Methionine import ATP-binding protein MetN OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metN PE=3 SV=1 1248 1463 2.0E-18
sp|Q7W4E1|METN_BORPA Methionine import ATP-binding protein MetN OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metN PE=3 SV=1 1248 1463 2.0E-18
sp|Q7WFU9|METN_BORBR Methionine import ATP-binding protein MetN OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metN PE=3 SV=1 1248 1463 2.0E-18
sp|Q68Y13|ZNUC_RICTY Zinc import ATP-binding protein ZnuC OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=znuC PE=3 SV=1 1248 1421 2.0E-18
sp|Q8UBB7|UGPC2_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC2 PE=3 SV=2 1246 1474 2.0E-18
sp|Q58429|Y1023_METJA Uncharacterized ABC transporter ATP-binding protein MJ1023 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1023 PE=3 SV=1 510 685 3.0E-18
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 1246 1478 3.0E-18
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 1258 1451 3.0E-18
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 1246 1478 3.0E-18
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 1246 1478 3.0E-18
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 1246 1478 3.0E-18
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 1246 1478 3.0E-18
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 1246 1478 3.0E-18
sp|Q9JUX4|CYSA_NEIMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysA PE=3 SV=1 1248 1440 3.0E-18
sp|Q576E0|Y3423_BRUAB Putative ATP-binding protein BruAb2_1123 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_1123 PE=3 SV=1 1248 1512 3.0E-18
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 1248 1465 3.0E-18
sp|Q81TH8|POTA_BACAN Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus anthracis GN=potA PE=3 SV=2 1248 1452 3.0E-18
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 499 692 3.0E-18
sp|Q8FUN3|Y4187_BRUSU Putative ATP-binding protein BRA1187/BS1330_II1178 OS=Brucella suis biovar 1 (strain 1330) GN=BRA1187 PE=3 SV=1 1248 1512 3.0E-18
sp|Q2YJB5|Y3647_BRUA2 Putative ATP-binding protein BAB2_1147 OS=Brucella abortus (strain 2308) GN=BAB2_1147 PE=3 SV=1 1248 1512 3.0E-18
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 1246 1463 3.0E-18
sp|Q9CK97|METN_PASMU Methionine import ATP-binding protein MetN OS=Pasteurella multocida (strain Pm70) GN=metN PE=3 SV=1 1261 1498 4.0E-18
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 1262 1465 4.0E-18
sp|Q98QH5|ECFA1_MYCPU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ecfA1 PE=3 SV=1 506 696 4.0E-18
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 1248 1466 4.0E-18
sp|Q9ZCC4|ZNUC_RICPR Zinc import ATP-binding protein ZnuC OS=Rickettsia prowazekii (strain Madrid E) GN=znuC PE=3 SV=1 1248 1421 4.0E-18
sp|Q87PH3|POTA_VIBPA Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=potA PE=3 SV=1 1248 1446 4.0E-18
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 1248 1479 4.0E-18
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 1248 1451 4.0E-18
sp|P30769|MKL_MYCLE Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium leprae (strain TN) GN=mkl PE=3 SV=2 1248 1457 4.0E-18
sp|Q81IZ6|METN1_BACCR Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN1 PE=3 SV=1 1248 1545 4.0E-18
sp|Q7VM95|METN_HAEDU Methionine import ATP-binding protein MetN OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=metN PE=3 SV=1 504 709 5.0E-18
sp|Q8D653|CYSA_VIBVU Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio vulnificus (strain CMCP6) GN=cysA PE=3 SV=1 1248 1463 5.0E-18
sp|Q8UB29|UGPC3_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC3 PE=3 SV=1 1246 1466 5.0E-18
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 1248 1456 5.0E-18
sp|Q67SV5|METN_SYMTH Methionine import ATP-binding protein MetN OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metN PE=3 SV=1 1248 1472 5.0E-18
sp|Q928L8|METN2_LISIN Methionine import ATP-binding protein MetN 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN2 PE=3 SV=1 1248 1456 5.0E-18
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 1258 1451 5.0E-18
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 1246 1480 6.0E-18
sp|Q66FU4|UGPC_YERPS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ugpC PE=3 SV=1 1246 1480 6.0E-18
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 1265 1435 6.0E-18
sp|Q8Y4L8|METN2_LISMO Methionine import ATP-binding protein MetN 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN2 PE=3 SV=1 1248 1450 6.0E-18
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 1248 1466 6.0E-18
sp|P45073|LPTB_HAEIN Lipopolysaccharide export system ATP-binding protein LptB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lptB PE=1 SV=1 507 692 7.0E-18
sp|Q81GC1|POTA_BACCR Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=potA PE=3 SV=1 1248 1452 7.0E-18
sp|Q71X09|METN2_LISMF Methionine import ATP-binding protein MetN 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN2 PE=3 SV=1 1248 1450 7.0E-18
sp|Q31VH5|UGPC_SHIBS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella boydii serotype 4 (strain Sb227) GN=ugpC PE=3 SV=2 1246 1451 7.0E-18
sp|Q7N986|MALK_PHOLL Maltose/maltodextrin import ATP-binding protein MalK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=malK PE=3 SV=1 1246 1450 7.0E-18
sp|Q8X6U5|UGPC_ECO57 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O157:H7 GN=ugpC PE=3 SV=2 1246 1451 7.0E-18
sp|Q7MKU3|POTA_VIBVY Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain YJ016) GN=potA PE=3 SV=2 1248 1446 7.0E-18
sp|Q8D9J4|POTA_VIBVU Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain CMCP6) GN=potA PE=3 SV=1 1248 1446 7.0E-18
sp|Q3YW77|UGPC_SHISS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella sonnei (strain Ss046) GN=ugpC PE=3 SV=2 1246 1451 7.0E-18
sp|P10907|UGPC_ECOLI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain K12) GN=ugpC PE=1 SV=3 1246 1451 8.0E-18
sp|Q18AM3|POTA_PEPD6 Spermidine/putrescine import ATP-binding protein PotA OS=Peptoclostridium difficile (strain 630) GN=potA PE=3 SV=1 1248 1440 8.0E-18
sp|Q5E586|POTA_VIBF1 Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=potA PE=3 SV=1 1238 1446 8.0E-18
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 1260 1451 8.0E-18
sp|Q6GIH9|METN2_STAAR Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MRSA252) GN=metN2 PE=3 SV=1 504 698 8.0E-18
sp|P0A9U2|YBHF_SHIFL Uncharacterized ABC transporter ATP-binding protein YbhF OS=Shigella flexneri GN=ybhF PE=3 SV=1 506 697 9.0E-18
sp|P0A9U1|YBHF_ECOLI Uncharacterized ABC transporter ATP-binding protein YbhF OS=Escherichia coli (strain K12) GN=ybhF PE=1 SV=1 506 697 9.0E-18
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 1244 1459 9.0E-18
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 1244 1459 9.0E-18
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 1248 1450 9.0E-18
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 505 701 1.0E-17
sp|Q88AS5|CYSA_PSESM Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=cysA PE=3 SV=1 506 698 1.0E-17
sp|Q4QMH4|METN_HAEI8 Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain 86-028NP) GN=metN PE=3 SV=1 1248 1508 1.0E-17
sp|Q6CZ34|UGPC_PECAS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ugpC PE=3 SV=1 1246 1452 1.0E-17
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 1248 1471 1.0E-17
sp|O34641|YTRB_BACSU ABC transporter ATP-binding protein YtrB OS=Bacillus subtilis (strain 168) GN=ytrB PE=2 SV=1 1248 1465 1.0E-17
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 1235 1451 1.0E-17
sp|Q8NXH5|METN2_STAAW Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MW2) GN=metN2 PE=3 SV=1 504 698 1.0E-17
sp|Q6GB18|METN2_STAAS Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MSSA476) GN=metN2 PE=3 SV=1 504 698 1.0E-17
sp|Q5HHK4|METN2_STAAC Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain COL) GN=metN2 PE=3 SV=1 504 698 1.0E-17
sp|Q2FZZ2|METN2_STAA8 Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN2 PE=3 SV=1 504 698 1.0E-17
sp|Q2FII2|METN2_STAA3 Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain USA300) GN=metN2 PE=3 SV=1 504 698 1.0E-17
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 1246 1471 1.0E-17
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 1248 1451 1.0E-17
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 1258 1451 1.0E-17
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 1248 1451 1.0E-17
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 1248 1451 1.0E-17
sp|Q5FKL2|METN_LACAC Methionine import ATP-binding protein MetN OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=metN PE=3 SV=1 504 745 1.0E-17
sp|Q32JQ8|METN_SHIDS Methionine import ATP-binding protein MetN OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metN PE=3 SV=1 474 687 1.0E-17
sp|Q0TLD2|METN_ECOL5 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metN PE=3 SV=1 474 687 1.0E-17
sp|P30750|METN_ECOLI Methionine import ATP-binding protein MetN OS=Escherichia coli (strain K12) GN=metN PE=1 SV=4 474 687 1.0E-17
sp|Q7N3S7|HMUV_PHOLL Hemin import ATP-binding protein HmuV OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hmuV PE=3 SV=1 1241 1463 1.0E-17
sp|Q0AU85|METN_SYNWW Methionine import ATP-binding protein MetN OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=metN PE=3 SV=1 1248 1437 1.0E-17
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 500 696 1.0E-17
sp|Q55281|MNTA_SYNY3 Manganese transport system ATP-binding protein MntA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mntA PE=3 SV=1 1241 1493 1.0E-17
sp|Q3Z5F8|METN_SHISS Methionine import ATP-binding protein MetN OS=Shigella sonnei (strain Ss046) GN=metN PE=3 SV=1 474 687 1.0E-17
sp|Q1RFY9|METN_ECOUT Methionine import ATP-binding protein MetN OS=Escherichia coli (strain UTI89 / UPEC) GN=metN PE=3 SV=1 474 687 1.0E-17
sp|P63355|METN_ECOL6 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metN PE=3 SV=1 474 687 1.0E-17
sp|P63356|METN_ECO57 Methionine import ATP-binding protein MetN OS=Escherichia coli O157:H7 GN=metN PE=3 SV=1 474 687 1.0E-17
sp|Q5LT05|POTA_RUEPO Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=potA PE=3 SV=1 1262 1451 1.0E-17
sp|Q73F11|METN1_BACC1 Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN1 PE=3 SV=1 1248 1545 1.0E-17
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 1248 1453 1.0E-17
sp|Q7A6M2|METN2_STAAN Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain N315) GN=metN2 PE=1 SV=1 504 698 1.0E-17
sp|Q99VG8|METN2_STAAM Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN2 PE=1 SV=1 504 698 1.0E-17
sp|Q2YWP2|METN2_STAAB Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metN2 PE=3 SV=1 504 698 1.0E-17
sp|Q160M2|POTA_ROSDO Spermidine/putrescine import ATP-binding protein PotA OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=potA PE=3 SV=1 1245 1451 1.0E-17
sp|Q5HV18|METN_CAMJR Methionine import ATP-binding protein MetN OS=Campylobacter jejuni (strain RM1221) GN=metN PE=3 SV=1 1248 1471 1.0E-17
sp|Q0PAB6|METN_CAMJE Methionine import ATP-binding protein MetN OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=metN PE=3 SV=1 1248 1471 1.0E-17
sp|Q6AE21|METN_LEIXX Methionine import ATP-binding protein MetN OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=metN PE=3 SV=1 1246 1463 1.0E-17
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 1248 1465 2.0E-17
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 1259 1436 2.0E-17
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 1259 1436 2.0E-17
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 1248 1495 2.0E-17
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 1248 1463 2.0E-17
sp|P77509|YPHE_ECOLI Uncharacterized ABC transporter ATP-binding protein YphE OS=Escherichia coli (strain K12) GN=yphE PE=3 SV=1 1262 1450 2.0E-17
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 1259 1444 2.0E-17
sp|Q1CNC6|UGPC_YERPN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ugpC PE=3 SV=1 1246 1480 2.0E-17
sp|Q74R28|UGPC_YERPE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis GN=ugpC PE=3 SV=1 1246 1480 2.0E-17
sp|Q1CBH2|UGPC_YERPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ugpC PE=3 SV=1 1246 1480 2.0E-17
sp|Q325U1|METN_SHIBS Methionine import ATP-binding protein MetN OS=Shigella boydii serotype 4 (strain Sb227) GN=metN PE=3 SV=1 474 687 2.0E-17
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 1261 1459 2.0E-17
sp|Q831K6|METN2_ENTFA Methionine import ATP-binding protein MetN 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metN2 PE=1 SV=1 1246 1512 2.0E-17
sp|Q49W48|METN_STAS1 Methionine import ATP-binding protein MetN OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metN PE=3 SV=1 502 691 2.0E-17
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 1246 1471 2.0E-17
sp|Q87SV4|THIQ_VIBPA Thiamine import ATP-binding protein ThiQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thiQ PE=3 SV=1 1267 1463 2.0E-17
sp|Q47T99|POTA_THEFY Spermidine/putrescine import ATP-binding protein PotA OS=Thermobifida fusca (strain YX) GN=potA PE=3 SV=1 1248 1479 2.0E-17
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 1248 1463 2.0E-17
sp|P25885|Y382_RHIME Uncharacterized ABC transporter ATP-binding protein R00382 OS=Rhizobium meliloti (strain 1021) GN=R00382 PE=3 SV=1 1248 1450 2.0E-17
sp|Q81IZ6|METN1_BACCR Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN1 PE=3 SV=1 504 706 3.0E-17
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 1248 1451 3.0E-17
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 1248 1451 3.0E-17
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 1248 1451 3.0E-17
sp|Q659V4|HMUV_PHODD Hemin import ATP-binding protein HmuV OS=Photobacterium damselae subsp. damselae GN=hmuV PE=3 SV=1 1248 1452 3.0E-17
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 1246 1451 3.0E-17
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 1246 1451 3.0E-17
sp|Q1R5H8|UGPC_ECOUT sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain UTI89 / UPEC) GN=ugpC PE=3 SV=2 1246 1451 3.0E-17
sp|A1AGY1|UGPC_ECOK1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O1:K1 / APEC GN=ugpC PE=3 SV=1 1246 1451 3.0E-17
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 1248 1451 3.0E-17
sp|P77795|YDCT_ECOLI Uncharacterized ABC transporter ATP-binding protein YdcT OS=Escherichia coli (strain K12) GN=ydcT PE=3 SV=1 1252 1511 3.0E-17
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 1248 1459 3.0E-17
sp|Q8FCQ2|UGPC_ECOL6 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ugpC PE=3 SV=2 1246 1451 3.0E-17
sp|A1JIE0|UGPC_YERE8 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ugpC PE=3 SV=1 1246 1480 3.0E-17
sp|Q0TC10|UGPC_ECOL5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ugpC PE=3 SV=1 1246 1451 3.0E-17
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 1248 1440 3.0E-17
sp|Q45460|OPUBA_BACSU Choline transport ATP-binding protein OpuBA OS=Bacillus subtilis (strain 168) GN=opuBA PE=2 SV=2 1248 1514 3.0E-17
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 1248 1446 3.0E-17
sp|C0SPB4|YHAQ_BACSU Uncharacterized ABC transporter ATP-binding protein YhaQ OS=Bacillus subtilis (strain 168) GN=yhaQ PE=3 SV=1 506 765 4.0E-17
sp|P44785|METN_HAEIN Methionine import ATP-binding protein MetN OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metN PE=3 SV=1 1248 1508 4.0E-17
sp|Q73F11|METN1_BACC1 Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN1 PE=3 SV=1 504 706 4.0E-17
sp|Q63S19|METN1_BURPS Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain K96243) GN=metN1 PE=3 SV=1 1248 1477 4.0E-17
sp|Q3JPZ4|METN1_BURP1 Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain 1710b) GN=metN1 PE=3 SV=1 1248 1477 4.0E-17
sp|Q62M41|METN1_BURMA Methionine import ATP-binding protein MetN 1 OS=Burkholderia mallei (strain ATCC 23344) GN=metN1 PE=3 SV=1 1248 1477 4.0E-17
sp|A3DDF6|POTA_CLOTH Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=potA PE=3 SV=1 1248 1440 4.0E-17
sp|Q8G5P8|METN_BIFLO Methionine import ATP-binding protein MetN OS=Bifidobacterium longum (strain NCC 2705) GN=metN PE=3 SV=1 1262 1451 4.0E-17
sp|Q87AL9|METN_XYLFT Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metN PE=3 SV=1 1248 1458 4.0E-17
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 1253 1452 4.0E-17
sp|Q18C09|METN_PEPD6 Methionine import ATP-binding protein MetN OS=Peptoclostridium difficile (strain 630) GN=metN PE=3 SV=1 1248 1470 4.0E-17
sp|Q9A502|METN_CAUCR Methionine import ATP-binding protein MetN OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metN PE=3 SV=1 1248 1450 4.0E-17
sp|Q88UV2|METN2_LACPL Methionine import ATP-binding protein MetN 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN2 PE=3 SV=1 504 699 5.0E-17
sp|O05779|FTSE_MYCTU Cell division ATP-binding protein FtsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsE PE=1 SV=2 1248 1451 5.0E-17
sp|P22040|Y415_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0415 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0415 PE=3 SV=2 1257 1463 5.0E-17
sp|A5U7B7|FTSE_MYCTA Cell division ATP-binding protein FtsE OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ftsE PE=1 SV=1 1248 1451 5.0E-17
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 1243 1435 5.0E-17
sp|Q8UH62|CYSA1_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA1 PE=3 SV=2 506 693 6.0E-17
sp|Q63H29|METN1_BACCZ Methionine import ATP-binding protein MetN 1 OS=Bacillus cereus (strain ZK / E33L) GN=metN1 PE=3 SV=1 504 706 6.0E-17
sp|Q45460|OPUBA_BACSU Choline transport ATP-binding protein OpuBA OS=Bacillus subtilis (strain 168) GN=opuBA PE=2 SV=2 506 719 6.0E-17
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 1259 1444 6.0E-17
sp|Q6D1C4|METN3_PECAS Methionine import ATP-binding protein MetN 3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN3 PE=3 SV=1 1248 1451 6.0E-17
sp|Q70GD4|HMUV_PHODP Hemin import ATP-binding protein HmuV OS=Photobacterium damsela subsp. piscicida GN=hmuV PE=3 SV=1 1248 1452 6.0E-17
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 499 696 6.0E-17
sp|Q1B8V9|POTA_MYCSS Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium sp. (strain MCS) GN=potA PE=3 SV=1 1248 1451 6.0E-17
sp|A1UG51|POTA_MYCSK Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium sp. (strain KMS) GN=potA PE=3 SV=1 1248 1451 6.0E-17
sp|Q87J32|HMUV_VIBPA Hemin import ATP-binding protein HmuV OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hmuV PE=3 SV=2 1248 1450 6.0E-17
sp|Q18KE1|PHNC1_HALWD Phosphonates import ATP-binding protein PhnC 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=phnC1 PE=3 SV=1 1248 1430 6.0E-17
sp|P55339|ECSA_BACSU ABC-type transporter ATP-binding protein EcsA OS=Bacillus subtilis (strain 168) GN=ecsA PE=1 SV=1 1248 1470 6.0E-17
sp|Q88ZJ6|POTA_LACPL Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=potA PE=3 SV=1 1241 1444 7.0E-17
sp|P44662|Y361_HAEIN Probable iron transport system ATP-binding protein HI_0361 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0361 PE=3 SV=1 1260 1462 7.0E-17
sp|Q8YA75|METN1_LISMO Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN1 PE=3 SV=1 1248 1497 7.0E-17
sp|Q8ENU2|METN2_OCEIH Methionine import ATP-binding protein MetN 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN2 PE=3 SV=1 1248 1452 7.0E-17
sp|Q724C0|METN1_LISMF Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN1 PE=3 SV=1 1248 1497 7.0E-17
sp|P55339|ECSA_BACSU ABC-type transporter ATP-binding protein EcsA OS=Bacillus subtilis (strain 168) GN=ecsA PE=1 SV=1 495 701 8.0E-17
sp|P70970|ECFA2_BACSU Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus subtilis (strain 168) GN=ecfAB PE=3 SV=1 505 696 8.0E-17
sp|Q0SFW6|METN2_RHOJR Methionine import ATP-binding protein MetN 2 OS=Rhodococcus jostii (strain RHA1) GN=metN2 PE=3 SV=1 1252 1460 8.0E-17
sp|Q4L4R9|METN_STAHJ Methionine import ATP-binding protein MetN OS=Staphylococcus haemolyticus (strain JCSC1435) GN=metN PE=3 SV=1 504 698 8.0E-17
sp|Q21BU8|METN_RHOPB Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB18) GN=metN PE=3 SV=1 499 693 8.0E-17
sp|Q8Z990|METN1_SALTI Methionine import ATP-binding protein MetN 1 OS=Salmonella typhi GN=metN1 PE=3 SV=1 474 687 8.0E-17
sp|Q890D1|Y100_LACPL Putative ABC transporter ATP-binding protein lp_0100 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_0100 PE=3 SV=2 1252 1451 9.0E-17
sp|Q83MC5|METN_SHIFL Methionine import ATP-binding protein MetN OS=Shigella flexneri GN=metN PE=3 SV=1 474 687 9.0E-17
sp|Q0T810|METN_SHIF8 Methionine import ATP-binding protein MetN OS=Shigella flexneri serotype 5b (strain 8401) GN=metN PE=3 SV=1 474 687 9.0E-17
sp|P24693|LPTB_ACIFR Lipopolysaccharide export system ATP-binding protein LptB OS=Acidithiobacillus ferrooxidans GN=lptB PE=3 SV=1 1248 1463 9.0E-17
sp|Q67SV5|METN_SYMTH Methionine import ATP-binding protein MetN OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metN PE=3 SV=1 474 701 1.0E-16
sp|Q65VG9|METN_MANSM Methionine import ATP-binding protein MetN OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metN PE=3 SV=1 1248 1493 1.0E-16
sp|Q55EH8|ABCGN_DICDI ABC transporter G family member 23 OS=Dictyostelium discoideum GN=abcG23 PE=3 SV=2 499 691 1.0E-16
sp|Q92EZ6|METN1_LISIN Methionine import ATP-binding protein MetN 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN1 PE=3 SV=1 1248 1480 1.0E-16
sp|Q9KUI0|CYSA_VIBCH Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysA PE=3 SV=1 1248 1451 1.0E-16
sp|Q5WJP0|METN2_BACSK Methionine import ATP-binding protein MetN 2 OS=Bacillus clausii (strain KSM-K16) GN=metN2 PE=3 SV=1 1259 1450 1.0E-16
sp|A3CVD3|ECFA_METMJ Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ecfA PE=3 SV=1 1248 1466 1.0E-16
sp|P9WQL5|MKL_MYCTU Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mkl PE=1 SV=1 1245 1457 1.0E-16
sp|P9WQL4|MKL_MYCTO Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mkl PE=3 SV=1 1245 1457 1.0E-16
sp|P63358|MKL_MYCBO Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mkl PE=3 SV=1 1245 1457 1.0E-16
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 1248 1451 1.0E-16
sp|O34992|OPUCA_BACSU Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA OS=Bacillus subtilis (strain 168) GN=opuCA PE=1 SV=1 506 696 1.0E-16
sp|Q830W6|POTA_ENTFA Spermidine/putrescine import ATP-binding protein PotA OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=potA PE=3 SV=1 1248 1452 1.0E-16
sp|Q8ZPK4|OSMV_SALTY Osmoprotectant import ATP-binding protein OsmV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=osmV PE=1 SV=1 1248 1463 1.0E-16
sp|Q5PID0|METN1_SALPA Methionine import ATP-binding protein MetN 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN1 PE=3 SV=1 474 687 1.0E-16
sp|Q9RKC6|Y3161_STRCO Putative ABC transporter ATP-binding protein SCO3161 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3161 PE=3 SV=1 1260 1451 1.0E-16
sp|Q9RR46|GBUA_LISM4 Glycine betaine/carnitine transport ATP-binding protein GbuA OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=gbuA PE=1 SV=1 472 696 1.0E-16
sp|Q07LQ4|SSUB_RHOP5 Aliphatic sulfonates import ATP-binding protein SsuB OS=Rhodopseudomonas palustris (strain BisA53) GN=ssuB PE=3 SV=1 1248 1446 1.0E-16
sp|Q6LR20|POTA_PHOPR Spermidine/putrescine import ATP-binding protein PotA OS=Photobacterium profundum GN=potA PE=3 SV=1 1248 1582 1.0E-16
sp|P40790|POTA_SALTY Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=potA PE=3 SV=2 1253 1450 1.0E-16
sp|Q8Z7H7|POTA_SALTI Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella typhi GN=potA PE=3 SV=1 1253 1450 1.0E-16
sp|Q57QC8|POTA_SALCH Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella choleraesuis (strain SC-B67) GN=potA PE=3 SV=1 1253 1450 1.0E-16
sp|Q2FRT7|ECFA2_METHJ Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=ecfA2 PE=3 SV=1 1262 1516 1.0E-16
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 1248 1451 1.0E-16
sp|Q3IM36|PSTB3_NATPD Phosphate import ATP-binding protein PstB 3 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pstB3 PE=3 SV=1 1237 1450 1.0E-16
sp|Q5PMK1|POTA_SALPA Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=potA PE=3 SV=1 1253 1450 1.0E-16
sp|Q6G2E2|METN_BARHE Methionine import ATP-binding protein MetN OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=metN PE=3 SV=1 1244 1463 1.0E-16
sp|Q9KP42|THIQ_VIBCH Thiamine import ATP-binding protein ThiQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thiQ PE=3 SV=2 510 688 1.0E-16
sp|P94374|YXLF_BACSU Uncharacterized ABC transporter ATP-binding protein YxlF OS=Bacillus subtilis (strain 168) GN=yxlF PE=2 SV=1 506 691 2.0E-16
sp|Q8YM92|POTA_NOSS1 Spermidine/putrescine import ATP-binding protein PotA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=potA PE=3 SV=1 506 699 2.0E-16
sp|Q8T674|ABCGK_DICDI ABC transporter G family member 20 OS=Dictyostelium discoideum GN=abcG20 PE=3 SV=1 506 700 2.0E-16
sp|P74548|CYSA_SYNY3 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cysA PE=3 SV=1 506 698 2.0E-16
sp|P9WQL6|FLQE1_MYCTO Fluoroquinolones export ATP-binding protein MT2762 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2762 PE=3 SV=1 495 697 2.0E-16
sp|P9WQL7|FLQE1_MYCTU Fluoroquinolones export ATP-binding protein Rv2688c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2688c PE=1 SV=1 495 697 2.0E-16
sp|Q81VM2|METN1_BACAN Methionine import ATP-binding protein MetN 1 OS=Bacillus anthracis GN=metN1 PE=3 SV=1 504 706 2.0E-16
sp|Q6D1C4|METN3_PECAS Methionine import ATP-binding protein MetN 3 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN3 PE=3 SV=1 474 687 2.0E-16
sp|Q21BU8|METN_RHOPB Methionine import ATP-binding protein MetN OS=Rhodopseudomonas palustris (strain BisB18) GN=metN PE=3 SV=1 1241 1452 2.0E-16
sp|Q9KD30|MNTB_BACHD Manganese transport system ATP-binding protein MntB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mntB PE=3 SV=1 1248 1463 2.0E-16
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 1258 1451 2.0E-16
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 1248 1452 2.0E-16
sp|Q9HPH7|Y1631_HALSA Putative ABC transporter ATP-binding protein VNG_1631G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1631G PE=3 SV=1 1248 1437 2.0E-16
sp|Q74L62|ECFA1_LACJO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ecfA1 PE=3 SV=1 504 698 2.0E-16
sp|Q24XJ2|POTA_DESHY Spermidine/putrescine import ATP-binding protein PotA OS=Desulfitobacterium hafniense (strain Y51) GN=potA PE=3 SV=2 1252 1440 2.0E-16
sp|Q3MAR5|POTA_ANAVT Spermidine/putrescine import ATP-binding protein PotA OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=potA PE=3 SV=1 506 699 3.0E-16
sp|Q88CL2|CYSA_PSEPK Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas putida (strain KT2440) GN=cysA PE=3 SV=1 506 699 3.0E-16
sp|Q0I5E9|METN_HAES1 Methionine import ATP-binding protein MetN OS=Haemophilus somnus (strain 129Pt) GN=metN PE=3 SV=1 1248 1463 3.0E-16
sp|P37624|RBBA_ECOLI Ribosome-associated ATPase OS=Escherichia coli (strain K12) GN=rbbA PE=1 SV=3 505 699 4.0E-16
sp|Q6D201|CYSA_PECAS Sulfate/thiosulfate import ATP-binding protein CysA OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cysA PE=3 SV=1 506 696 4.0E-16
sp|O32169|METN_BACSU Methionine import ATP-binding protein MetN OS=Bacillus subtilis (strain 168) GN=metN PE=1 SV=1 504 696 4.0E-16
sp|P44531|FBPC1_HAEIN Fe(3+) ions import ATP-binding protein FbpC 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fbpC1 PE=3 SV=1 499 738 5.0E-16
sp|Q87SV4|THIQ_VIBPA Thiamine import ATP-binding protein ThiQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=thiQ PE=3 SV=1 510 692 5.0E-16
sp|Q5PID0|METN1_SALPA Methionine import ATP-binding protein MetN 1 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN1 PE=3 SV=1 1248 1438 5.0E-16
sp|Q8Z990|METN1_SALTI Methionine import ATP-binding protein MetN 1 OS=Salmonella typhi GN=metN1 PE=3 SV=1 1248 1438 7.0E-16
sp|O34992|OPUCA_BACSU Glycine betaine/carnitine/choline transport ATP-binding protein OpuCA OS=Bacillus subtilis (strain 168) GN=opuCA PE=1 SV=1 1248 1463 7.0E-16
sp|Q0I2Z4|FBPC_HAES1 Fe(3+) ions import ATP-binding protein FbpC OS=Haemophilus somnus (strain 129Pt) GN=fbpC PE=3 SV=1 505 696 8.0E-16
sp|P54591|YHCG_BACSU Uncharacterized ABC transporter ATP-binding protein YhcG OS=Bacillus subtilis (strain 168) GN=yhcG PE=3 SV=1 506 701 8.0E-16
sp|P30750|METN_ECOLI Methionine import ATP-binding protein MetN OS=Escherichia coli (strain K12) GN=metN PE=1 SV=4 1248 1452 8.0E-16
sp|Q6LKD4|FBPC_PHOPR Fe(3+) ions import ATP-binding protein FbpC OS=Photobacterium profundum GN=fbpC PE=3 SV=2 497 696 9.0E-16
sp|Q32JQ8|METN_SHIDS Methionine import ATP-binding protein MetN OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=metN PE=3 SV=1 1248 1452 9.0E-16
sp|Q3Z5F8|METN_SHISS Methionine import ATP-binding protein MetN OS=Shigella sonnei (strain Ss046) GN=metN PE=3 SV=1 1248 1452 9.0E-16
sp|Q1RFY9|METN_ECOUT Methionine import ATP-binding protein MetN OS=Escherichia coli (strain UTI89 / UPEC) GN=metN PE=3 SV=1 1248 1452 9.0E-16
sp|P63355|METN_ECOL6 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=metN PE=3 SV=1 1248 1452 9.0E-16
sp|P63356|METN_ECO57 Methionine import ATP-binding protein MetN OS=Escherichia coli O157:H7 GN=metN PE=3 SV=1 1248 1452 9.0E-16
sp|Q325U1|METN_SHIBS Methionine import ATP-binding protein MetN OS=Shigella boydii serotype 4 (strain Sb227) GN=metN PE=3 SV=1 1248 1452 9.0E-16
sp|Q110U3|POTA_TRIEI Spermidine/putrescine import ATP-binding protein PotA OS=Trichodesmium erythraeum (strain IMS101) GN=potA PE=3 SV=1 506 698 1.0E-15
sp|Q5KVK2|METN_GEOKA Methionine import ATP-binding protein MetN OS=Geobacillus kaustophilus (strain HTA426) GN=metN PE=3 SV=1 504 692 1.0E-15
sp|Q14Q07|POTA_SPICI Spermidine/putrescine import ATP-binding protein PotA OS=Spiroplasma citri GN=potA PE=3 SV=1 505 696 1.0E-15
sp|Q0TLD2|METN_ECOL5 Methionine import ATP-binding protein MetN OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=metN PE=3 SV=1 1248 1452 1.0E-15
sp|Q8ZPK4|OSMV_SALTY Osmoprotectant import ATP-binding protein OsmV OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=osmV PE=1 SV=1 474 696 1.0E-15
sp|Q9I6L0|CYSA_PSEAE Sulfate/thiosulfate import ATP-binding protein CysA OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysA PE=3 SV=1 506 698 2.0E-15
sp|Q9CM80|FBPC_PASMU Fe(3+) ions import ATP-binding protein FbpC OS=Pasteurella multocida (strain Pm70) GN=fbpC PE=3 SV=1 499 696 2.0E-15
sp|Q65F80|METN2_BACLD Methionine import ATP-binding protein MetN 2 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=metN2 PE=3 SV=1 504 700 2.0E-15
sp|Q1GIE5|POTA_RUEST Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria sp. (strain TM1040) GN=potA PE=3 SV=1 470 700 2.0E-15
sp|Q2K4V4|UGPC2_RHIEC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=ugpC2 PE=3 SV=1 507 704 2.0E-15
sp|Q7N986|MALK_PHOLL Maltose/maltodextrin import ATP-binding protein MalK OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=malK PE=3 SV=1 501 696 2.0E-15
sp|Q0AU85|METN_SYNWW Methionine import ATP-binding protein MetN OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=metN PE=3 SV=1 474 691 2.0E-15
sp|Q92VJ2|CYSA2_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Rhizobium meliloti (strain 1021) GN=cysA2 PE=3 SV=1 506 696 3.0E-15
sp|P14788|CYSA_SYNE7 Sulfate/thiosulfate import ATP-binding protein CysA OS=Synechococcus elongatus (strain PCC 7942) GN=cysA PE=2 SV=1 506 696 3.0E-15
sp|Q65S66|FBPC_MANSM Fe(3+) ions import ATP-binding protein FbpC OS=Mannheimia succiniciproducens (strain MBEL55E) GN=fbpC PE=3 SV=2 505 699 3.0E-15
sp|Q6AE21|METN_LEIXX Methionine import ATP-binding protein MetN OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=metN PE=3 SV=1 506 696 3.0E-15
sp|Q83MC5|METN_SHIFL Methionine import ATP-binding protein MetN OS=Shigella flexneri GN=metN PE=3 SV=1 1248 1451 3.0E-15
sp|Q0T810|METN_SHIF8 Methionine import ATP-binding protein MetN OS=Shigella flexneri serotype 5b (strain 8401) GN=metN PE=3 SV=1 1248 1451 3.0E-15
sp|Q4FMG5|TAUB_PELUB Taurine import ATP-binding protein TauB OS=Pelagibacter ubique (strain HTCC1062) GN=tauB PE=3 SV=1 501 683 4.0E-15
sp|Q5L222|POTA_GEOKA Spermidine/putrescine import ATP-binding protein PotA OS=Geobacillus kaustophilus (strain HTA426) GN=potA PE=3 SV=1 494 692 4.0E-15
sp|Q8EBC3|CYSA1_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Shewanella oneidensis (strain MR-1) GN=cysA1 PE=3 SV=1 506 696 5.0E-15
sp|Q3A9G5|METN_CARHZ Methionine import ATP-binding protein MetN OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metN PE=3 SV=1 504 691 6.0E-15
sp|P42246|YCBN_BACSU Uncharacterized ABC transporter ATP-binding protein YcbN OS=Bacillus subtilis (strain 168) GN=ycbN PE=3 SV=4 474 687 6.0E-15
sp|Q9A502|METN_CAUCR Methionine import ATP-binding protein MetN OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metN PE=3 SV=1 506 685 6.0E-15
sp|O31427|SKFE_BACSU SkfA peptide export ATP-binding protein SkfE OS=Bacillus subtilis (strain 168) GN=skfE PE=1 SV=1 496 687 7.0E-15
sp|P54537|ARTM_BACSU Arginine transport ATP-binding protein ArtM OS=Bacillus subtilis (strain 168) GN=artM PE=1 SV=1 507 696 7.0E-15
sp|Q9YGA6|MALK_THELN Trehalose/maltose import ATP-binding protein MalK OS=Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) GN=malK PE=1 SV=1 504 699 8.0E-15
sp|Q57293|FBPC_ACTPL Fe(3+) ions import ATP-binding protein FbpC OS=Actinobacillus pleuropneumoniae GN=fbpC PE=3 SV=1 507 718 8.0E-15
sp|Q5WDP1|METN3_BACSK Methionine import ATP-binding protein MetN 3 OS=Bacillus clausii (strain KSM-K16) GN=metN3 PE=3 SV=1 504 696 9.0E-15
sp|P46903|NATA_BACSU ABC transporter ATP-binding protein NatA OS=Bacillus subtilis (strain 168) GN=natA PE=1 SV=1 504 699 9.0E-15
sp|Q81GU1|CYSA_BACCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cysA PE=3 SV=1 506 698 9.0E-15
sp|Q8E8K8|CYSA2_SHEON Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Shewanella oneidensis (strain MR-1) GN=cysA2 PE=3 SV=1 505 696 9.0E-15
sp|P31134|POTG_ECOLI Putrescine transport ATP-binding protein PotG OS=Escherichia coli (strain K12) GN=potG PE=3 SV=2 506 733 1.0E-14
sp|Q8XBJ8|CYSA_ECO57 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O157:H7 GN=cysA PE=3 SV=1 507 690 1.0E-14
sp|P33982|Y3926_AZOC5 Probable ABC transporter ATP-binding protein AZC_3926 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=AZC_3926 PE=3 SV=1 507 692 1.0E-14
sp|Q0TA26|MALK_ECOL5 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=malK PE=3 SV=1 504 704 1.0E-14
sp|Q576E0|Y3423_BRUAB Putative ATP-binding protein BruAb2_1123 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_1123 PE=3 SV=1 505 683 1.0E-14
sp|P25885|Y382_RHIME Uncharacterized ABC transporter ATP-binding protein R00382 OS=Rhizobium meliloti (strain 1021) GN=R00382 PE=3 SV=1 507 696 1.0E-14
sp|Q8DIA0|CYSA_THEEB Sulfate/thiosulfate import ATP-binding protein CysA OS=Thermosynechococcus elongatus (strain BP-1) GN=cysA PE=3 SV=1 506 696 2.0E-14
sp|Q82WT5|CYSA_NITEU Sulfate/thiosulfate import ATP-binding protein CysA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=cysA PE=3 SV=1 506 726 2.0E-14
sp|P54592|YHCH_BACSU Uncharacterized ABC transporter ATP-binding protein YhcH OS=Bacillus subtilis (strain 168) GN=yhcH PE=3 SV=1 507 687 2.0E-14
sp|Q28K97|TAUB_JANSC Taurine import ATP-binding protein TauB OS=Jannaschia sp. (strain CCS1) GN=tauB PE=3 SV=1 504 683 2.0E-14
sp|Q8Z0H0|CYSA_NOSS1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=cysA PE=3 SV=1 506 696 2.0E-14
sp|Q92XW1|CYSA1_RHIME Sulfate/thiosulfate import ATP-binding protein CysA 1 OS=Rhizobium meliloti (strain 1021) GN=cysA1 PE=3 SV=1 506 696 2.0E-14
sp|Q7UC29|CYSA_SHIFL Sulfate/thiosulfate import ATP-binding protein CysA OS=Shigella flexneri GN=cysA PE=3 SV=1 507 690 2.0E-14
sp|P16676|CYSA_ECOLI Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli (strain K12) GN=cysA PE=3 SV=2 507 690 2.0E-14
sp|Q8FFB3|CYSA_ECOL6 Sulfate/thiosulfate import ATP-binding protein CysA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cysA PE=3 SV=1 507 690 2.0E-14
sp|Q8Z4V6|CYSA_SALTI Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhi GN=cysA PE=3 SV=1 507 690 2.0E-14
sp|Q07756|NODI_AZOC5 Nod factor export ATP-binding protein I OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodI PE=3 SV=1 507 689 2.0E-14
sp|Q9K789|METN_BACHD Methionine import ATP-binding protein MetN OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=metN PE=3 SV=1 474 696 2.0E-14
sp|Q8XZP8|CYSA_RALSO Sulfate/thiosulfate import ATP-binding protein CysA OS=Ralstonia solanacearum (strain GMI1000) GN=cysA PE=3 SV=1 505 720 2.0E-14
sp|Q04G50|POTA_OENOB Spermidine/putrescine import ATP-binding protein PotA OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=potA PE=3 SV=2 510 696 2.0E-14
sp|Q0SXQ1|MALK_SHIF8 Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri serotype 5b (strain 8401) GN=malK PE=3 SV=1 504 704 2.0E-14
sp|Q8FUN3|Y4187_BRUSU Putative ATP-binding protein BRA1187/BS1330_II1178 OS=Brucella suis biovar 1 (strain 1330) GN=BRA1187 PE=3 SV=1 505 683 2.0E-14
sp|Q2YJB5|Y3647_BRUA2 Putative ATP-binding protein BAB2_1147 OS=Brucella abortus (strain 2308) GN=BAB2_1147 PE=3 SV=1 505 683 2.0E-14
sp|Q47T99|POTA_THEFY Spermidine/putrescine import ATP-binding protein PotA OS=Thermobifida fusca (strain YX) GN=potA PE=3 SV=1 485 704 2.0E-14
sp|Q668K6|CYSA_YERPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cysA PE=3 SV=1 507 696 3.0E-14
sp|Q72FW5|POTA_DESVH Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=potA PE=3 SV=1 469 707 3.0E-14
sp|Q9X196|POTA_THEMA Spermidine/putrescine import ATP-binding protein PotA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=potA PE=3 SV=1 507 698 3.0E-14
sp|P40860|CYSA_SALTY Sulfate/thiosulfate import ATP-binding protein CysA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cysA PE=3 SV=2 507 690 3.0E-14
sp|P9WQM1|CYSA_MYCTU Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cysA PE=1 SV=2 505 698 3.0E-14
sp|P9WQM0|CYSA_MYCTO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cysA PE=3 SV=2 505 698 3.0E-14
sp|P0A4W3|CYSA_MYCBO Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=cysA PE=3 SV=2 505 698 3.0E-14
sp|O65934|ABC1_MYCTU ABC transporter ATP-binding/permease protein Rv1747 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1747 PE=1 SV=1 507 685 3.0E-14
sp|Q5LVM5|TAUB_RUEPO Taurine import ATP-binding protein TauB OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tauB PE=3 SV=1 504 683 3.0E-14
sp|Q7UBD0|MALK_SHIFL Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella flexneri GN=malK PE=3 SV=1 504 704 3.0E-14
sp|Q3YUV0|MALK_SHISS Maltose/maltodextrin import ATP-binding protein MalK OS=Shigella sonnei (strain Ss046) GN=malK PE=3 SV=1 504 704 3.0E-14
sp|Q1R3Q1|MALK_ECOUT Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain UTI89 / UPEC) GN=malK PE=1 SV=2 504 704 3.0E-14
sp|P68187|MALK_ECOLI Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli (strain K12) GN=malK PE=1 SV=1 504 704 3.0E-14
sp|P68188|MALK_ECO57 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O157:H7 GN=malK PE=3 SV=1 504 704 3.0E-14
sp|Q8FB37|MALK_ECOL6 Maltose/maltodextrin import ATP-binding protein MalK OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=malK PE=3 SV=2 504 704 3.0E-14
sp|Q6F9A8|CYSA_ACIAD Sulfate/thiosulfate import ATP-binding protein CysA OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=cysA PE=3 SV=1 506 705 3.0E-14
sp|Q724C0|METN1_LISMF Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN1 PE=3 SV=1 504 696 3.0E-14
sp|Q8D0W8|CYSA_YERPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Yersinia pestis GN=cysA PE=3 SV=2 507 696 4.0E-14
sp|P63354|CYSA_BRUSU Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella suis biovar 1 (strain 1330) GN=cysA PE=3 SV=1 506 699 4.0E-14
sp|P63353|CYSA_BRUME Sulfate/thiosulfate import ATP-binding protein CysA OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=cysA PE=3 SV=1 506 699 4.0E-14
sp|Q97KS6|POTA_CLOAB Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=potA PE=3 SV=1 507 692 4.0E-14
sp|Q8YA75|METN1_LISMO Methionine import ATP-binding protein MetN 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN1 PE=3 SV=1 504 696 4.0E-14
sp|Q9MUN1|CYSA_MESVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Mesostigma viride GN=cysA PE=3 SV=1 506 699 6.0E-14
sp|Q88UV2|METN2_LACPL Methionine import ATP-binding protein MetN 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=metN2 PE=3 SV=1 1248 1511 6.0E-14
sp|O34977|YTHP_BACSU Uncharacterized ABC transporter ATP-binding protein YthP OS=Bacillus subtilis (strain 168) GN=ythP PE=3 SV=1 1240 1468 7.0E-14
sp|P22040|Y415_SYNY3 Uncharacterized ABC transporter ATP-binding protein sll0415 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0415 PE=3 SV=2 502 773 7.0E-14
sp|Q8NSN2|METN_CORGL Methionine import ATP-binding protein MetN OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metN PE=3 SV=1 472 696 8.0E-14
sp|Q9K876|CYSA_BACHD Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cysA PE=3 SV=1 506 699 1.0E-13
sp|Q0B6I6|METN2_BURCM Methionine import ATP-binding protein MetN 2 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metN2 PE=3 SV=1 506 691 1.0E-13
sp|P56344|CYSA_CHLVU Probable sulfate/thiosulfate import ATP-binding protein CysA OS=Chlorella vulgaris GN=cysA PE=3 SV=1 506 698 1.0E-13
sp|Q928L8|METN2_LISIN Methionine import ATP-binding protein MetN 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN2 PE=3 SV=1 504 696 1.0E-13
sp|Q48IB9|SSUB1_PSE14 Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=ssuB1 PE=3 SV=1 507 682 1.0E-13
sp|Q9KUI0|CYSA_VIBCH Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cysA PE=3 SV=1 510 696 1.0E-13
sp|Q6D734|FBPC1_PECAS Fe(3+) ions import ATP-binding protein FbpC 1 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=fbpC1 PE=3 SV=1 507 696 2.0E-13
sp|Q6MCV4|POTA_PARUW Spermidine/putrescine import ATP-binding protein PotA OS=Protochlamydia amoebophila (strain UWE25) GN=potA PE=3 SV=1 505 698 2.0E-13
sp|Q8EPK1|METN1_OCEIH Methionine import ATP-binding protein MetN 1 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN1 PE=3 SV=2 504 696 2.0E-13
sp|Q6F0V4|POTA_MESFL Spermidine/putrescine import ATP-binding protein PotA OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=potA PE=3 SV=1 505 692 2.0E-13
sp|Q8FV85|METN_BRUSU Methionine import ATP-binding protein MetN OS=Brucella suis biovar 1 (strain 1330) GN=metN PE=3 SV=2 506 691 2.0E-13
sp|Q8YD40|METN_BRUME Methionine import ATP-binding protein MetN OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=metN PE=3 SV=1 506 691 2.0E-13
sp|Q579H8|METN_BRUAB Methionine import ATP-binding protein MetN OS=Brucella abortus biovar 1 (strain 9-941) GN=metN PE=3 SV=2 506 691 2.0E-13
sp|Q2YIV5|METN_BRUA2 Methionine import ATP-binding protein MetN OS=Brucella abortus (strain 2308) GN=metN PE=3 SV=2 506 691 2.0E-13
sp|Q7N6Z2|CYSA_PHOLL Sulfate/thiosulfate import ATP-binding protein CysA OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cysA PE=3 SV=1 507 696 2.0E-13
sp|Q5LT05|POTA_RUEPO Spermidine/putrescine import ATP-binding protein PotA OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=potA PE=3 SV=1 503 692 2.0E-13
sp|Q667L9|METN2_YERPS Methionine import ATP-binding protein MetN 2 OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=metN2 PE=3 SV=1 1261 1463 2.0E-13
sp|Q92EZ6|METN1_LISIN Methionine import ATP-binding protein MetN 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=metN1 PE=3 SV=1 504 696 2.0E-13
sp|Q65UE1|POTA_MANSM Spermidine/putrescine import ATP-binding protein PotA OS=Mannheimia succiniciproducens (strain MBEL55E) GN=potA PE=3 SV=1 507 698 3.0E-13
sp|Q7NWX3|CYSA2_CHRVO Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=cysA2 PE=3 SV=1 506 696 3.0E-13
sp|P19844|NOSF_PSEST Copper transport ATP-binding protein NosF OS=Pseudomonas stutzeri GN=nosF PE=3 SV=1 504 717 3.0E-13
sp|Q1MCN6|UGPC1_RHIL3 sn-glycerol-3-phosphate import ATP-binding protein UgpC 1 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=ugpC1 PE=3 SV=1 507 704 3.0E-13
sp|Q87AL9|METN_XYLFT Methionine import ATP-binding protein MetN OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=metN PE=3 SV=1 493 691 3.0E-13
sp|Q9KLQ5|FBPC_VIBCH Fe(3+) ions import ATP-binding protein FbpC OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fbpC PE=3 SV=1 497 696 4.0E-13
sp|Q2YAD6|POTA_NITMU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=potA PE=3 SV=1 506 688 4.0E-13
sp|Q815Y7|METN3_BACCR Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=metN3 PE=3 SV=1 504 696 4.0E-13
sp|Q72Y96|METN3_BACC1 Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=metN3 PE=3 SV=1 504 696 4.0E-13
sp|Q6MU19|POTA_MYCMS Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=potA PE=3 SV=1 505 696 4.0E-13
sp|Q2YKZ7|Y2993_BRUA2 Putative ATP-binding protein BAB2_0493 OS=Brucella abortus (strain 2308) GN=BAB2_0493 PE=3 SV=1 510 699 4.0E-13
sp|Q578M5|Y2787_BRUAB Putative ATP-binding protein BruAb2_0487 OS=Brucella abortus biovar 1 (strain 9-941) GN=BruAb2_0487 PE=3 SV=1 510 699 4.0E-13
sp|Q98HF7|POTA_RHILO Spermidine/putrescine import ATP-binding protein PotA OS=Rhizobium loti (strain MAFF303099) GN=potA PE=3 SV=1 470 692 4.0E-13
sp|Q2T751|TAUB_BURTA Taurine import ATP-binding protein TauB OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tauB PE=3 SV=1 504 707 4.0E-13
sp|Q7AH43|FBPC_ECO57 Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli O157:H7 GN=fbpC PE=3 SV=2 507 696 5.0E-13
sp|Q8F6Z1|CYSA_LEPIN Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=cysA PE=3 SV=2 506 696 5.0E-13
sp|Q72PE5|CYSA_LEPIC Sulfate/thiosulfate import ATP-binding protein CysA OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=cysA PE=3 SV=1 506 696 5.0E-13
sp|Q16BJ3|TAUB_ROSDO Taurine import ATP-binding protein TauB OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=tauB PE=3 SV=1 504 683 5.0E-13
sp|Q13LD8|METN2_BURXL Methionine import ATP-binding protein MetN 2 OS=Burkholderia xenovorans (strain LB400) GN=metN2 PE=3 SV=1 460 691 5.0E-13
sp|Q2SSS4|POTA_MYCCT Spermidine/putrescine import ATP-binding protein PotA OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=potA PE=3 SV=1 505 696 5.0E-13
sp|Q8FVT0|Y3745_BRUSU Putative ATP-binding protein BRA0745/BS1330_II0738 OS=Brucella suis biovar 1 (strain 1330) GN=BRA0745 PE=3 SV=1 510 699 5.0E-13
sp|Q71X09|METN2_LISMF Methionine import ATP-binding protein MetN 2 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=metN2 PE=3 SV=1 504 696 5.0E-13
sp|P0A9V4|LPTB_SHIFL Lipopolysaccharide export system ATP-binding protein LptB OS=Shigella flexneri GN=lptB PE=3 SV=2 507 696 6.0E-13
sp|P0A9V1|LPTB_ECOLI Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli (strain K12) GN=lptB PE=1 SV=2 507 696 6.0E-13
sp|P0A9V2|LPTB_ECOL6 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lptB PE=3 SV=2 507 696 6.0E-13
sp|P0A9V3|LPTB_ECO57 Lipopolysaccharide export system ATP-binding protein LptB OS=Escherichia coli O157:H7 GN=lptB PE=3 SV=2 507 696 6.0E-13
sp|P45171|POTA_HAEIN Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potA PE=3 SV=2 507 698 6.0E-13
sp|Q4QK57|POTA_HAEI8 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus influenzae (strain 86-028NP) GN=potA PE=3 SV=2 507 698 6.0E-13
sp|Q5X627|POTA_LEGPA Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Paris) GN=potA PE=3 SV=1 507 692 6.0E-13
sp|Q631Y4|METN3_BACCZ Methionine import ATP-binding protein MetN 3 OS=Bacillus cereus (strain ZK / E33L) GN=metN3 PE=3 SV=1 504 696 6.0E-13
sp|Q81XL3|METN3_BACAN Methionine import ATP-binding protein MetN 3 OS=Bacillus anthracis GN=metN3 PE=3 SV=1 504 696 6.0E-13
sp|Q6HBS0|METN2_BACHK Methionine import ATP-binding protein MetN 2 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=metN2 PE=3 SV=1 504 696 6.0E-13
sp|Q5PKZ8|MALK_SALPA Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=malK PE=3 SV=1 504 704 6.0E-13
sp|Q8Y4L8|METN2_LISMO Methionine import ATP-binding protein MetN 2 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=metN2 PE=3 SV=1 504 696 6.0E-13
sp|Q49W48|METN_STAS1 Methionine import ATP-binding protein MetN OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=metN PE=3 SV=1 1262 1437 6.0E-13
sp|Q8D653|CYSA_VIBVU Sulfate/thiosulfate import ATP-binding protein CysA OS=Vibrio vulnificus (strain CMCP6) GN=cysA PE=3 SV=1 506 696 7.0E-13
sp|O31339|CYSA_BACC1 Sulfate/thiosulfate import ATP-binding protein CysA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cysA PE=3 SV=2 506 698 7.0E-13
sp|P24693|LPTB_ACIFR Lipopolysaccharide export system ATP-binding protein LptB OS=Acidithiobacillus ferrooxidans GN=lptB PE=3 SV=1 517 696 7.0E-13
sp|Q5WJP0|METN2_BACSK Methionine import ATP-binding protein MetN 2 OS=Bacillus clausii (strain KSM-K16) GN=metN2 PE=3 SV=1 504 691 7.0E-13
sp|Q39AT4|METN2_BURL3 Methionine import ATP-binding protein MetN 2 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metN2 PE=3 SV=1 506 691 8.0E-13
sp|Q8Z1U0|MALK_SALTI Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhi GN=malK PE=3 SV=1 504 704 8.0E-13
sp|Q5ZWE4|POTA_LEGPH Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=potA PE=3 SV=2 507 692 9.0E-13
sp|P19566|MALK_SALTY Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=malK PE=1 SV=3 504 704 9.0E-13
sp|Q57GZ7|MALK_SALCH Maltose/maltodextrin import ATP-binding protein MalK OS=Salmonella choleraesuis (strain SC-B67) GN=malK PE=3 SV=1 504 704 9.0E-13
sp|Q98K23|CYSA_RHILO Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhizobium loti (strain MAFF303099) GN=cysA PE=3 SV=1 506 696 1.0E-12
sp|A0B344|METN2_BURCH Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain HI2424) GN=metN2 PE=3 SV=1 473 691 1.0E-12
sp|Q1BR30|METN2_BURCA Methionine import ATP-binding protein MetN 2 OS=Burkholderia cenocepacia (strain AU 1054) GN=metN2 PE=3 SV=1 473 691 1.0E-12
sp|Q57855|Y412_METJA Uncharacterized ABC transporter ATP-binding protein MJ0412 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0412 PE=3 SV=1 504 683 1.0E-12
sp|Q6GIH9|METN2_STAAR Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MRSA252) GN=metN2 PE=3 SV=1 1262 1437 1.0E-12
sp|Q8ENU2|METN2_OCEIH Methionine import ATP-binding protein MetN 2 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=metN2 PE=3 SV=1 504 696 1.0E-12
sp|Q9KP42|THIQ_VIBCH Thiamine import ATP-binding protein ThiQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=thiQ PE=3 SV=2 1268 1459 1.0E-12
sp|Q93DX8|CYSA_BURCE Sulfate/thiosulfate import ATP-binding protein CysA (Fragment) OS=Burkholderia cepacia GN=cysA PE=3 SV=1 506 692 2.0E-12
sp|Q9PDN2|CYSA_XYLFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain 9a5c) GN=cysA PE=3 SV=1 502 699 2.0E-12
sp|Q3JKX3|TAUB_BURP1 Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain 1710b) GN=tauB PE=3 SV=1 504 707 2.0E-12
sp|Q62AW4|TAUB_BURMA Taurine import ATP-binding protein TauB OS=Burkholderia mallei (strain ATCC 23344) GN=tauB PE=3 SV=1 504 707 2.0E-12
sp|Q5WXF0|POTA_LEGPL Spermidine/putrescine import ATP-binding protein PotA OS=Legionella pneumophila (strain Lens) GN=potA PE=3 SV=1 507 692 2.0E-12
sp|Q0I3Y9|POTA_HAES1 Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus somnus (strain 129Pt) GN=potA PE=3 SV=1 507 698 2.0E-12
sp|Q2K8C8|FBPC_RHIEC Fe(3+) ions import ATP-binding protein FbpC OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=fbpC PE=3 SV=1 506 698 2.0E-12
sp|Q73XU8|CYSA_MYCPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=cysA PE=3 SV=1 493 698 2.0E-12
sp|Q65QT6|MALK_MANSM Maltose/maltodextrin import ATP-binding protein MalK OS=Mannheimia succiniciproducens (strain MBEL55E) GN=malK PE=3 SV=1 510 704 2.0E-12
sp|Q7VV72|METN_BORPE Methionine import ATP-binding protein MetN OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=metN PE=3 SV=1 506 696 2.0E-12
sp|Q7W4E1|METN_BORPA Methionine import ATP-binding protein MetN OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=metN PE=3 SV=1 506 696 2.0E-12
sp|Q7WFU9|METN_BORBR Methionine import ATP-binding protein MetN OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=metN PE=3 SV=1 506 696 2.0E-12
sp|Q8NXH5|METN2_STAAW Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MW2) GN=metN2 PE=3 SV=1 1262 1437 2.0E-12
sp|Q6GB18|METN2_STAAS Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain MSSA476) GN=metN2 PE=3 SV=1 1262 1437 2.0E-12
sp|Q5HHK4|METN2_STAAC Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain COL) GN=metN2 PE=3 SV=1 1262 1437 2.0E-12
sp|Q2FZZ2|METN2_STAA8 Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain NCTC 8325) GN=metN2 PE=3 SV=1 1262 1437 2.0E-12
sp|Q2FII2|METN2_STAA3 Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain USA300) GN=metN2 PE=3 SV=1 1262 1437 2.0E-12
sp|Q2YWP2|METN2_STAAB Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=metN2 PE=3 SV=1 1262 1437 2.0E-12
sp|Q831K6|METN2_ENTFA Methionine import ATP-binding protein MetN 2 OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=metN2 PE=1 SV=1 498 696 2.0E-12
sp|Q0SFW6|METN2_RHOJR Methionine import ATP-binding protein MetN 2 OS=Rhodococcus jostii (strain RHA1) GN=metN2 PE=3 SV=1 506 692 2.0E-12
sp|P42332|BCRA_BACLI Bacitracin transport ATP-binding protein BcrA OS=Bacillus licheniformis GN=bcrA PE=3 SV=1 506 699 3.0E-12
sp|Q1RGL1|ZNUC_RICBR Zinc import ATP-binding protein ZnuC OS=Rickettsia bellii (strain RML369-C) GN=znuC PE=3 SV=1 507 675 3.0E-12
sp|Q9I6T2|POTA1_PSEAE Spermidine/putrescine import ATP-binding protein PotA 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA1 PE=3 SV=1 505 704 3.0E-12
sp|Q7A6M2|METN2_STAAN Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain N315) GN=metN2 PE=1 SV=1 1262 1437 3.0E-12
sp|Q99VG8|METN2_STAAM Methionine import ATP-binding protein MetN 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=metN2 PE=1 SV=1 1262 1437 3.0E-12
sp|Q4L4R9|METN_STAHJ Methionine import ATP-binding protein MetN OS=Staphylococcus haemolyticus (strain JCSC1435) GN=metN PE=3 SV=1 1262 1471 3.0E-12
sp|Q6G2E2|METN_BARHE Methionine import ATP-binding protein MetN OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=metN PE=3 SV=1 485 691 3.0E-12
sp|Q8PNN4|CYSA_XANAC Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas axonopodis pv. citri (strain 306) GN=cysA PE=3 SV=2 496 687 4.0E-12
sp|Q63JZ3|TAUB_BURPS Taurine import ATP-binding protein TauB OS=Burkholderia pseudomallei (strain K96243) GN=tauB PE=3 SV=1 504 707 4.0E-12
sp|Q62B84|METN2_BURMA Methionine import ATP-binding protein MetN 2 OS=Burkholderia mallei (strain ATCC 23344) GN=metN2 PE=3 SV=2 503 691 4.0E-12
sp|Q3JHC9|METN2_BURP1 Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain 1710b) GN=metN2 PE=3 SV=2 503 691 4.0E-12
sp|Q160M2|POTA_ROSDO Spermidine/putrescine import ATP-binding protein PotA OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=potA PE=3 SV=1 506 699 4.0E-12
sp|Q87DT9|CYSA_XYLFT Sulfate/thiosulfate import ATP-binding protein CysA OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=cysA PE=3 SV=1 502 699 5.0E-12
sp|Q4K681|POTA_PSEF5 Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=potA PE=3 SV=1 505 699 5.0E-12
sp|Q63NI4|METN2_BURPS Methionine import ATP-binding protein MetN 2 OS=Burkholderia pseudomallei (strain K96243) GN=metN2 PE=3 SV=2 503 691 5.0E-12
sp|Q57SD6|PHNT_SALCH Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella choleraesuis (strain SC-B67) GN=phnT PE=3 SV=1 505 699 5.0E-12
sp|P10346|GLNQ_ECOLI Glutamine transport ATP-binding protein GlnQ OS=Escherichia coli (strain K12) GN=glnQ PE=1 SV=1 503 692 5.0E-12
sp|A1TAI4|POTA_MYCVP Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=potA PE=3 SV=1 505 699 6.0E-12
sp|Q6ME20|METN_PARUW Methionine import ATP-binding protein MetN OS=Protochlamydia amoebophila (strain UWE25) GN=metN PE=3 SV=1 506 683 6.0E-12
sp|Q9JZW0|CYSA_NEIMB Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysA PE=3 SV=1 506 693 6.0E-12
sp|P96063|PHNT_SALTY Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=phnT PE=2 SV=1 505 699 6.0E-12
sp|Q8Z8W8|PHNT_SALTI Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella typhi GN=phnT PE=3 SV=1 505 693 6.0E-12
sp|Q5PFQ7|PHNT_SALPA Putative 2-aminoethylphosphonate import ATP-binding protein PhnT OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=phnT PE=3 SV=1 505 693 6.0E-12
sp|Q5YZY9|CYSA_NOCFA Sulfate/thiosulfate import ATP-binding protein CysA OS=Nocardia farcinica (strain IFM 10152) GN=cysA PE=3 SV=1 506 699 7.0E-12
sp|Q0SRL2|POTA_CLOPS Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain SM101 / Type A) GN=potA PE=3 SV=2 469 692 7.0E-12
sp|Q8U6M1|FBPC_AGRFC Fe(3+) ions import ATP-binding protein FbpC OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=fbpC PE=3 SV=1 506 698 8.0E-12
sp|Q7NIW1|CYSA_GLOVI Sulfate/thiosulfate import ATP-binding protein CysA OS=Gloeobacter violaceus (strain PCC 7421) GN=cysA PE=3 SV=1 506 696 9.0E-12
sp|Q8XIZ5|POTA_CLOPE Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain 13 / Type A) GN=potA PE=3 SV=1 469 692 9.0E-12
sp|Q0TNZ3|POTA_CLOP1 Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=potA PE=3 SV=1 469 692 9.0E-12
sp|Q9JUX4|CYSA_NEIMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysA PE=3 SV=1 506 693 9.0E-12
sp|Q7N8B9|FBPC_PHOLL Fe(3+) ions import ATP-binding protein FbpC OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=fbpC PE=3 SV=1 507 692 1.0E-11
sp|O85818|POTA_AGGAC Spermidine/putrescine import ATP-binding protein PotA OS=Aggregatibacter actinomycetemcomitans GN=potA PE=3 SV=1 507 698 1.0E-11
sp|Q30V33|POTA_DESAG Spermidine/putrescine import ATP-binding protein PotA OS=Desulfovibrio alaskensis (strain G20) GN=potA PE=3 SV=1 506 699 1.0E-11
sp|Q9G4F5|CYSA_CUCSA Sulfate/thiosulfate import ATP-binding protein cysA OS=Cucumis sativus GN=CYSA PE=3 SV=1 506 698 1.0E-11
sp|Q6NBT1|CYSA_RHOPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=cysA PE=3 SV=1 506 699 1.0E-11
sp|Q92G36|ZNUC_RICCN Zinc import ATP-binding protein ZnuC OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=znuC PE=3 SV=1 507 669 1.0E-11
sp|Q7VNG4|POTA_HAEDU Spermidine/putrescine import ATP-binding protein PotA OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=potA PE=3 SV=1 510 698 1.0E-11
sp|Q8UB29|UGPC3_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 3 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC3 PE=3 SV=1 504 699 1.0E-11
sp|Q9RR46|GBUA_LISM4 Glycine betaine/carnitine transport ATP-binding protein GbuA OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=gbuA PE=1 SV=1 1247 1440 1.0E-11
sp|P37009|FBPC_ECOLI Fe(3+) ions import ATP-binding protein FbpC OS=Escherichia coli (strain K12) GN=fbpC PE=3 SV=3 507 696 2.0E-11
sp|Q92WJ0|FBPC1_RHIME Fe(3+) ions import ATP-binding protein FbpC 1 OS=Rhizobium meliloti (strain 1021) GN=fbpC1 PE=3 SV=1 506 698 2.0E-11
sp|O83658|POTA_TREPA Spermidine/putrescine import ATP-binding protein PotA OS=Treponema pallidum (strain Nichols) GN=potA PE=3 SV=1 496 699 2.0E-11
sp|Q6KHL1|ECFA1_MYCMO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=ecfA1 PE=3 SV=1 1256 1458 2.0E-11
sp|Q7W9U5|CYSA_BORPA Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=cysA PE=3 SV=1 506 699 2.0E-11
sp|Q1QE80|POTA_PSYCK Spermidine/putrescine import ATP-binding protein PotA OS=Psychrobacter cryohalolentis (strain K5) GN=potA PE=3 SV=1 467 698 2.0E-11
sp|Q7WGW1|CYSA_BORBR Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=cysA PE=3 SV=1 506 699 2.0E-11
sp|A1JIE0|UGPC_YERE8 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ugpC PE=3 SV=1 507 699 2.0E-11
sp|Q18C09|METN_PEPD6 Methionine import ATP-binding protein MetN OS=Peptoclostridium difficile (strain 630) GN=metN PE=3 SV=1 510 696 2.0E-11
sp|Q9TKX3|CYSA_NEPOL Sulfate/thiosulfate import ATP-binding protein CysA OS=Nephroselmis olivacea GN=cysA PE=3 SV=1 506 698 3.0E-11
sp|Q9CP06|POTA_PASMU Spermidine/putrescine import ATP-binding protein PotA OS=Pasteurella multocida (strain Pm70) GN=potA PE=3 SV=2 507 698 3.0E-11
sp|O34641|YTRB_BACSU ABC transporter ATP-binding protein YtrB OS=Bacillus subtilis (strain 168) GN=ytrB PE=2 SV=1 510 700 3.0E-11
sp|P0C0E2|SRTF_STRPY Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes GN=srtF PE=3 SV=1 507 687 4.0E-11
sp|P0C0E3|SRTF_STRP1 Lantibiotic transport ATP-binding protein SrtF OS=Streptococcus pyogenes serotype M1 GN=srtF PE=3 SV=1 507 687 4.0E-11
sp|Q8YCG3|FBPC_BRUME Fe(3+) ions import ATP-binding protein FbpC OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=fbpC PE=3 SV=1 506 698 4.0E-11
sp|Q5WKG4|SSUB1_BACSK Aliphatic sulfonates import ATP-binding protein SsuB 1 OS=Bacillus clausii (strain KSM-K16) GN=ssuB1 PE=3 SV=1 507 687 4.0E-11
sp|Q55281|MNTA_SYNY3 Manganese transport system ATP-binding protein MntA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=mntA PE=3 SV=1 517 702 4.0E-11
sp|Q1CNC6|UGPC_YERPN sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ugpC PE=3 SV=1 507 730 4.0E-11
sp|Q74R28|UGPC_YERPE sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis GN=ugpC PE=3 SV=1 507 730 4.0E-11
sp|Q1CBH2|UGPC_YERPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ugpC PE=3 SV=1 507 730 4.0E-11
sp|Q8G5P8|METN_BIFLO Methionine import ATP-binding protein MetN OS=Bifidobacterium longum (strain NCC 2705) GN=metN PE=3 SV=1 498 691 4.0E-11
sp|Q830W6|POTA_ENTFA Spermidine/putrescine import ATP-binding protein PotA OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=potA PE=3 SV=1 502 696 4.0E-11
sp|Q578K3|FBPC_BRUAB Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus biovar 1 (strain 9-941) GN=fbpC PE=3 SV=1 506 698 5.0E-11
sp|Q2YKX3|FBPC_BRUA2 Fe(3+) ions import ATP-binding protein FbpC OS=Brucella abortus (strain 2308) GN=fbpC PE=3 SV=1 506 698 5.0E-11
sp|Q81GC1|POTA_BACCR Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=potA PE=3 SV=1 505 699 5.0E-11
sp|Q8ELR4|POTA_OCEIH Spermidine/putrescine import ATP-binding protein PotA OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=potA PE=3 SV=1 502 692 5.0E-11
sp|Q7NQN5|POTA_CHRVO Spermidine/putrescine import ATP-binding protein PotA OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=potA PE=3 SV=1 506 700 6.0E-11
sp|Q7VZE5|CYSA_BORPE Sulfate/thiosulfate import ATP-binding protein CysA OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=cysA PE=3 SV=1 506 699 6.0E-11
sp|Q8A883|POTA_BACTN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=potA PE=3 SV=1 506 696 6.0E-11
sp|A3CVD3|ECFA_METMJ Energy-coupling factor transporter ATP-binding protein EcfA OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=ecfA PE=3 SV=1 504 699 6.0E-11
sp|Q07LQ4|SSUB_RHOP5 Aliphatic sulfonates import ATP-binding protein SsuB OS=Rhodopseudomonas palustris (strain BisA53) GN=ssuB PE=3 SV=1 507 687 7.0E-11
sp|Q8PC11|CYSA_XANCP Sulfate/thiosulfate import ATP-binding protein CysA OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=cysA PE=3 SV=1 493 687 8.0E-11
sp|Q9A7X1|CYSA_CAUCR Sulfate/thiosulfate import ATP-binding protein CysA OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cysA PE=3 SV=2 506 692 8.0E-11
sp|Q03PF2|POTA_LACBA Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=potA PE=3 SV=1 499 699 8.0E-11
sp|Q4UJW5|ZNUC_RICFE Zinc import ATP-binding protein ZnuC OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=znuC PE=3 SV=1 507 669 9.0E-11
sp|Q4A5A5|ECFA1_MYCS5 Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma synoviae (strain 53) GN=ecfA1 PE=3 SV=1 1260 1459 9.0E-11
sp|Q87PH3|POTA_VIBPA Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=potA PE=3 SV=1 499 698 9.0E-11
sp|Q5FKL2|METN_LACAC Methionine import ATP-binding protein MetN OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=metN PE=3 SV=1 1262 1463 9.0E-11
sp|P9WQK1|Y986_MYCTU Uncharacterized ABC transporter ATP-binding protein Rv0986 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0986 PE=1 SV=1 488 667 9.0E-11
sp|P9WQK0|Y986_MYCTO Uncharacterized ABC transporter ATP-binding protein MT1014 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT1014 PE=3 SV=1 488 667 9.0E-11
sp|P70970|ECFA2_BACSU Energy-coupling factor transporter ATP-binding protein EcfA2 OS=Bacillus subtilis (strain 168) GN=ecfAB PE=3 SV=1 1262 1444 9.0E-11
sp|Q1AS06|POTA_RUBXD Spermidine/putrescine import ATP-binding protein PotA OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=potA PE=3 SV=1 506 698 1.0E-10
sp|Q62K82|CYSA_BURMA Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia mallei (strain ATCC 23344) GN=cysA PE=3 SV=1 506 692 1.0E-10
sp|Q63TY1|CYSA_BURPS Sulfate/thiosulfate import ATP-binding protein CysA OS=Burkholderia pseudomallei (strain K96243) GN=cysA PE=3 SV=1 506 692 1.0E-10
sp|Q8UA73|CYSA2_AGRFC Sulfate/thiosulfate import ATP-binding protein CysA 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=cysA2 PE=3 SV=1 506 740 1.0E-10
sp|Q8FVV5|FBPC_BRUSU Fe(3+) ions import ATP-binding protein FbpC OS=Brucella suis biovar 1 (strain 1330) GN=fbpC PE=3 SV=1 506 698 1.0E-10
sp|Q1B677|METN_MYCSS Methionine import ATP-binding protein MetN OS=Mycobacterium sp. (strain MCS) GN=metN PE=3 SV=2 507 696 1.0E-10
sp|Q6HLQ9|POTA_BACHK Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=potA PE=3 SV=2 505 699 1.0E-10
sp|Q63E84|POTA_BACCZ Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ZK / E33L) GN=potA PE=3 SV=2 505 699 1.0E-10
sp|Q73BM0|POTA_BACC1 Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=potA PE=3 SV=1 505 699 1.0E-10
sp|A0RBB0|POTA_BACAH Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus thuringiensis (strain Al Hakam) GN=potA PE=3 SV=1 505 699 1.0E-10
sp|P40790|POTA_SALTY Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=potA PE=3 SV=2 499 698 1.0E-10
sp|Q8Z7H7|POTA_SALTI Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella typhi GN=potA PE=3 SV=1 499 698 1.0E-10
sp|Q57QC8|POTA_SALCH Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella choleraesuis (strain SC-B67) GN=potA PE=3 SV=1 499 698 1.0E-10
sp|Q5PMK1|POTA_SALPA Spermidine/putrescine import ATP-binding protein PotA OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=potA PE=3 SV=1 499 698 1.0E-10
sp|Q9HPH7|Y1631_HALSA Putative ABC transporter ATP-binding protein VNG_1631G OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=VNG_1631G PE=3 SV=1 507 707 1.0E-10
sp|Q609Q1|CYSA_METCA Sulfate/thiosulfate import ATP-binding protein CysA OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=cysA PE=3 SV=1 506 696 2.0E-10
sp|Q0AGF4|POTA_NITEC Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas eutropha (strain C91) GN=potA PE=3 SV=1 506 692 2.0E-10
sp|Q13KX9|TAUB2_BURXL Taurine import ATP-binding protein TauB 2 OS=Burkholderia xenovorans (strain LB400) GN=tauB2 PE=3 SV=1 501 683 2.0E-10
sp|Q8UBB7|UGPC2_AGRFC sn-glycerol-3-phosphate import ATP-binding protein UgpC 2 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ugpC2 PE=3 SV=2 507 699 2.0E-10
sp|Q98G42|UGPC_RHILO sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Rhizobium loti (strain MAFF303099) GN=ugpC PE=3 SV=1 507 699 2.0E-10
sp|Q66FU4|UGPC_YERPS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ugpC PE=3 SV=1 507 730 2.0E-10
sp|Q64SQ6|POTA_BACFR Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain YCH46) GN=potA PE=3 SV=2 506 696 2.0E-10
sp|Q5LBT4|POTA_BACFN Spermidine/putrescine import ATP-binding protein PotA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=potA PE=3 SV=1 506 696 2.0E-10
sp|Q24XJ2|POTA_DESHY Spermidine/putrescine import ATP-binding protein PotA OS=Desulfitobacterium hafniense (strain Y51) GN=potA PE=3 SV=2 504 696 2.0E-10
sp|Q1MQ44|POTA_LAWIP Spermidine/putrescine import ATP-binding protein PotA OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=potA PE=3 SV=1 502 692 3.0E-10
sp|Q7MKU3|POTA_VIBVY Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain YJ016) GN=potA PE=3 SV=2 500 698 3.0E-10
sp|Q8D9J4|POTA_VIBVU Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio vulnificus (strain CMCP6) GN=potA PE=3 SV=1 500 698 3.0E-10
sp|Q3KCC5|FBPC_PSEPF Fe(3+) ions import ATP-binding protein FbpC OS=Pseudomonas fluorescens (strain Pf0-1) GN=fbpC PE=3 SV=1 505 696 3.0E-10
sp|Q6CZ34|UGPC_PECAS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ugpC PE=3 SV=1 507 699 3.0E-10
sp|Q9HX79|TAUB_PSEAE Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=tauB PE=3 SV=1 510 707 3.0E-10
sp|Q8U4K3|WTPC_PYRFU Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=wtpC PE=3 SV=1 510 700 4.0E-10
sp|Q8Y8T6|POTA_LISMO Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=potA PE=3 SV=2 507 696 4.0E-10
sp|P55604|Y4OS_RHISN Uncharacterized ABC transporter ATP-binding protein y4oS OS=Rhizobium sp. (strain NGR234) GN=NGR_a02170 PE=3 SV=1 510 699 4.0E-10
sp|Q81TH8|POTA_BACAN Spermidine/putrescine import ATP-binding protein PotA OS=Bacillus anthracis GN=potA PE=3 SV=2 505 699 4.0E-10
sp|Q722B1|POTA_LISMF Spermidine/putrescine import ATP-binding protein PotA OS=Listeria monocytogenes serotype 4b (strain F2365) GN=potA PE=3 SV=2 507 696 5.0E-10
sp|A0AGP9|POTA_LISW6 Spermidine/putrescine import ATP-binding protein PotA OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=potA PE=3 SV=1 507 696 5.0E-10
sp|Q63S19|METN1_BURPS Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain K96243) GN=metN1 PE=3 SV=1 504 696 5.0E-10
sp|Q3JPZ4|METN1_BURP1 Methionine import ATP-binding protein MetN 1 OS=Burkholderia pseudomallei (strain 1710b) GN=metN1 PE=3 SV=1 504 696 5.0E-10
sp|Q62M41|METN1_BURMA Methionine import ATP-binding protein MetN 1 OS=Burkholderia mallei (strain ATCC 23344) GN=metN1 PE=3 SV=1 504 696 5.0E-10
sp|Q89UD2|CYSA_BRADU Sulfate/thiosulfate import ATP-binding protein CysA OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=cysA PE=3 SV=1 506 698 6.0E-10
sp|Q92DL6|POTA_LISIN Spermidine/putrescine import ATP-binding protein PotA OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=potA PE=3 SV=2 507 696 6.0E-10
sp|Q5PJL1|UGPC_SALPA sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ugpC PE=3 SV=1 507 699 6.0E-10
sp|Q02SA6|TAUB_PSEAB Taurine import ATP-binding protein TauB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=tauB PE=3 SV=1 510 707 6.0E-10
sp|Q6LR20|POTA_PHOPR Spermidine/putrescine import ATP-binding protein PotA OS=Photobacterium profundum GN=potA PE=3 SV=1 507 698 7.0E-10
sp|Q82TL6|POTA_NITEU Spermidine/putrescine import ATP-binding protein PotA OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=potA PE=3 SV=1 506 692 8.0E-10
sp|Q8FKF5|TAUB_ECOL6 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tauB PE=3 SV=1 493 685 9.0E-10
sp|Q3KBH4|POTA_PSEPF Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas fluorescens (strain Pf0-1) GN=potA PE=3 SV=1 506 699 1.0E-09
sp|Q5JEB0|WTPC_THEKO Molybdate/tungstate import ATP-binding protein WtpC OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=wtpC PE=3 SV=1 510 699 1.0E-09
sp|Q8ZLF4|UGPC_SALTY sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ugpC PE=1 SV=1 507 699 1.0E-09
sp|Q57IS3|UGPC_SALCH sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella choleraesuis (strain SC-B67) GN=ugpC PE=3 SV=1 507 699 1.0E-09
sp|Q8RI39|POTA_FUSNN Spermidine/putrescine import ATP-binding protein PotA OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=potA PE=3 SV=1 510 698 1.0E-09
sp|Q70GD4|HMUV_PHODP Hemin import ATP-binding protein HmuV OS=Photobacterium damsela subsp. piscicida GN=hmuV PE=3 SV=1 507 692 1.0E-09
sp|Q1B8V9|POTA_MYCSS Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium sp. (strain MCS) GN=potA PE=3 SV=1 474 699 1.0E-09
sp|A1UG51|POTA_MYCSK Spermidine/putrescine import ATP-binding protein PotA OS=Mycobacterium sp. (strain KMS) GN=potA PE=3 SV=1 474 699 1.0E-09
sp|P44662|Y361_HAEIN Probable iron transport system ATP-binding protein HI_0361 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0361 PE=3 SV=1 506 693 1.0E-09
sp|Q9KD30|MNTB_BACHD Manganese transport system ATP-binding protein MntB OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=mntB PE=3 SV=1 506 684 1.0E-09
sp|Q9V2C0|WTPC_PYRAB Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=wtpC PE=3 SV=1 510 721 2.0E-09
sp|O57896|WTPC_PYRHO Molybdate/tungstate import ATP-binding protein WtpC OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=wtpC PE=3 SV=1 510 691 2.0E-09
sp|Q8Z245|UGPC_SALTI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Salmonella typhi GN=ugpC PE=3 SV=1 507 699 2.0E-09
sp|Q98QH5|ECFA1_MYCPU Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=ecfA1 PE=3 SV=1 1248 1440 2.0E-09
sp|Q55DW4|ABCG1_DICDI ABC transporter G family member 1 OS=Dictyostelium discoideum GN=abcG1 PE=3 SV=1 517 705 2.0E-09
sp|Q8X6U5|UGPC_ECO57 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O157:H7 GN=ugpC PE=3 SV=2 510 699 2.0E-09
sp|Q5E586|POTA_VIBF1 Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=potA PE=3 SV=1 507 698 2.0E-09
sp|Q8T685|ABCGC_DICDI ABC transporter G family member 12 OS=Dictyostelium discoideum GN=abcG12 PE=3 SV=1 507 701 2.0E-09
sp|Q1RFH8|TAUB_ECOUT Taurine import ATP-binding protein TauB OS=Escherichia coli (strain UTI89 / UPEC) GN=tauB PE=3 SV=1 493 685 2.0E-09
sp|Q0TKS1|TAUB_ECOL5 Taurine import ATP-binding protein TauB OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tauB PE=3 SV=1 493 685 2.0E-09
sp|Q9KS33|POTA_VIBCH Spermidine/putrescine import ATP-binding protein PotA OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=potA PE=3 SV=1 507 698 3.0E-09
sp|Q68Y13|ZNUC_RICTY Zinc import ATP-binding protein ZnuC OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=znuC PE=3 SV=1 507 675 3.0E-09
sp|Q659V4|HMUV_PHODD Hemin import ATP-binding protein HmuV OS=Photobacterium damselae subsp. damselae GN=hmuV PE=3 SV=1 507 692 3.0E-09
sp|A1TXH7|POTA_MARHV Spermidine/putrescine import ATP-binding protein PotA OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=potA PE=3 SV=1 507 699 4.0E-09
sp|A3DDF6|POTA_CLOTH Spermidine/putrescine import ATP-binding protein PotA OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=potA PE=3 SV=1 505 692 4.0E-09
sp|Q86HQ2|ABCG8_DICDI ABC transporter G family member 8 OS=Dictyostelium discoideum GN=abcG8 PE=3 SV=1 515 701 4.0E-09
sp|Q02R79|POTA_PSEAB Spermidine/putrescine import ATP-binding protein PotA OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=potA PE=3 SV=1 506 685 5.0E-09
sp|Q9HY19|POTA2_PSEAE Spermidine/putrescine import ATP-binding protein PotA 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=potA2 PE=3 SV=1 506 685 5.0E-09
sp|Q8RGC8|FBPC_FUSNN Fe(3+) ions import ATP-binding protein FbpC OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=fbpC PE=3 SV=1 505 699 5.0E-09
sp|Q31VH5|UGPC_SHIBS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella boydii serotype 4 (strain Sb227) GN=ugpC PE=3 SV=2 510 699 5.0E-09
sp|Q3YW77|UGPC_SHISS sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Shigella sonnei (strain Ss046) GN=ugpC PE=3 SV=2 510 699 5.0E-09
sp|Q3Z542|TAUB_SHISS Taurine import ATP-binding protein TauB OS=Shigella sonnei (strain Ss046) GN=tauB PE=3 SV=1 493 685 5.0E-09
sp|Q47538|TAUB_ECOLI Taurine import ATP-binding protein TauB OS=Escherichia coli (strain K12) GN=tauB PE=2 SV=1 493 685 5.0E-09
sp|Q32IZ6|TAUB_SHIDS Taurine import ATP-binding protein TauB OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tauB PE=3 SV=1 493 688 5.0E-09
sp|Q88ZJ6|POTA_LACPL Spermidine/putrescine import ATP-binding protein PotA OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=potA PE=3 SV=1 507 696 5.0E-09
sp|P10907|UGPC_ECOLI sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain K12) GN=ugpC PE=1 SV=3 510 699 6.0E-09
sp|Q7N3S7|HMUV_PHOLL Hemin import ATP-binding protein HmuV OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=hmuV PE=3 SV=1 507 696 6.0E-09
sp|Q1R5H8|UGPC_ECOUT sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli (strain UTI89 / UPEC) GN=ugpC PE=3 SV=2 510 699 6.0E-09
sp|A1AGY1|UGPC_ECOK1 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O1:K1 / APEC GN=ugpC PE=3 SV=1 510 699 6.0E-09
sp|P77795|YDCT_ECOLI Uncharacterized ABC transporter ATP-binding protein YdcT OS=Escherichia coli (strain K12) GN=ydcT PE=3 SV=1 504 699 6.0E-09
sp|Q8FCQ2|UGPC_ECOL6 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ugpC PE=3 SV=2 510 699 6.0E-09
sp|Q0TC10|UGPC_ECOL5 sn-glycerol-3-phosphate import ATP-binding protein UgpC OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ugpC PE=3 SV=1 510 699 6.0E-09
sp|Q3IM36|PSTB3_NATPD Phosphate import ATP-binding protein PstB 3 OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pstB3 PE=3 SV=1 506 685 6.0E-09
sp|Q325N3|TAUB_SHIBS Taurine import ATP-binding protein TauB OS=Shigella boydii serotype 4 (strain Sb227) GN=tauB PE=3 SV=1 493 685 7.0E-09
sp|Q8X5I6|TAUB_ECO57 Taurine import ATP-binding protein TauB OS=Escherichia coli O157:H7 GN=tauB PE=3 SV=1 493 685 7.0E-09
sp|Q9ZCC4|ZNUC_RICPR Zinc import ATP-binding protein ZnuC OS=Rickettsia prowazekii (strain Madrid E) GN=znuC PE=3 SV=1 507 675 8.0E-09
sp|Q6D3Q6|METN2_PECAS Methionine import ATP-binding protein MetN 2 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=metN2 PE=3 SV=1 505 691 1.0E-08
sp|Q9MAH4|AB10G_ARATH ABC transporter G family member 10 OS=Arabidopsis thaliana GN=ABCG10 PE=3 SV=1 497 702 1.0E-08
sp|Q74L62|ECFA1_LACJO Energy-coupling factor transporter ATP-binding protein EcfA1 OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=ecfA1 PE=3 SV=1 1248 1463 1.0E-08
sp|O68106|CBIO_RHOCB Cobalt import ATP-binding protein CbiO OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=cbiO PE=1 SV=1 504 693 2.0E-08
sp|Q2KVK2|METN_BORA1 Methionine import ATP-binding protein MetN OS=Bordetella avium (strain 197N) GN=metN PE=3 SV=1 506 687 2.0E-08
sp|Q18AM3|POTA_PEPD6 Spermidine/putrescine import ATP-binding protein PotA OS=Peptoclostridium difficile (strain 630) GN=potA PE=3 SV=1 502 696 2.0E-08
sp|P45022|Y1078_HAEIN Probable amino-acid ABC transporter ATP-binding protein HI_1078 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_1078 PE=3 SV=1 507 685 2.0E-08
sp|Q18KE1|PHNC1_HALWD Phosphonates import ATP-binding protein PhnC 1 OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=phnC1 PE=3 SV=1 501 696 4.0E-08
sp|Q83MA0|TAUB_SHIFL Taurine import ATP-binding protein TauB OS=Shigella flexneri GN=tauB PE=3 SV=1 493 685 5.0E-08
sp|P77509|YPHE_ECOLI Uncharacterized ABC transporter ATP-binding protein YphE OS=Escherichia coli (strain K12) GN=yphE PE=3 SV=1 1240 1463 2.0E-07
sp|Q8Z8R5|METN2_SALTI Methionine import ATP-binding protein MetN 2 OS=Salmonella typhi GN=metN2 PE=3 SV=1 503 692 2.0E-07
sp|Q5PCG9|METN2_SALPA Methionine import ATP-binding protein MetN 2 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=metN2 PE=3 SV=1 503 692 3.0E-07
sp|Q8ZR89|METN2_SALTY Methionine import ATP-binding protein MetN 2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=metN2 PE=3 SV=1 503 692 4.0E-07
sp|Q57S53|METN2_SALCH Methionine import ATP-binding protein MetN 2 OS=Salmonella choleraesuis (strain SC-B67) GN=metN2 PE=3 SV=1 506 692 5.0E-07
sp|P9WQL5|MKL_MYCTU Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mkl PE=1 SV=1 510 687 7.0E-07
sp|P9WQL4|MKL_MYCTO Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mkl PE=3 SV=1 510 687 7.0E-07
sp|P63358|MKL_MYCBO Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mkl PE=3 SV=1 510 687 7.0E-07
sp|Q6AM16|PSTB_DESPS Phosphate import ATP-binding protein PstB OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=pstB PE=3 SV=1 506 696 1.0E-06
sp|P30769|MKL_MYCLE Probable ribonucleotide transport ATP-binding protein mkl OS=Mycobacterium leprae (strain TN) GN=mkl PE=3 SV=2 510 687 1.0E-06
sp|Q87J32|HMUV_VIBPA Hemin import ATP-binding protein HmuV OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=hmuV PE=3 SV=2 505 687 2.0E-06
sp|Q890D1|Y100_LACPL Putative ABC transporter ATP-binding protein lp_0100 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=lp_0100 PE=3 SV=2 510 667 5.0E-06
sp|O05779|FTSE_MYCTU Cell division ATP-binding protein FtsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ftsE PE=1 SV=2 474 687 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 30 52 22
2 240 262 22
3 291 313 22
4 323 345 22
5 379 401 22
6 421 443 22
7 822 844 22
8 1000 1022 22
9 1042 1064 22
10 1079 1101 22
11 1108 1130 22
12 1145 1167 22
13 1188 1210 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|3927
MGAKQPAKCLLLRQIWTLMKKDLRCLIRRHGILMVFVAFVMPILLAGFFTFAKSLFLPPAQYGIGSARPIMTLRE
AAETAHNSGHDRLILVDGPTDQKGQYNMSRVLDVIEEETRSYGSLLQTIRVSHERELGSHCRSSLRGVTRCLGAV
VMRGAPPSGNWNYTIRTDAFVASGPRSIQVDHDKNLEQVFVLPLQRAVDSVIATIEGHGPLPSADQWPFTSQTQA
EHGEKARMKYLDNIISFMGVAFVTTIVGVTYHLAGAVATDRESGMARLMDAMMPGGRPGAAQATRIVAHHLAYTA
LYAPAWIVAAFIIRYGIFIHTSIVMVVVLQLLAGLALVSMAILIASFFSRAQLSSSSATLATLILAILAQSLTSP
RTTTVSVLSALFAPCNYVYFVTLMARFERDNRPTSLLDEAPRNSPWSVPGLALWLLLGMQIICYPLLAAWVERWR
FGTPADGRRYGRPKPEADEDETAVQLDGLTKVYYPALLPRLASYLRCGRAAEPVVAVNGLSLSCRRGQIVTLLGA
NGSGKSTTLDAIAGLHQPTGGSIVVDGGLGIAPQKNVLWDDVTVQDHLEIFGRLKSPAQPPTAQETADLVRAIDL
WPKRDALAKTLSGGQKRKLQLGMMLAGGSSVCCVDEVSSGLDPISRRKIWDILLAERGRRTLIVTTHFLDEADLL
ADHMAVLSRGTLRAAGSSVELKERFGGGYHVRVPAGSGPEVDGVGRKEAPDGTTYAAPTSDLAARVIRKLEDAGI
GDYHFSSPTIEDVFLRLAEEVAVDETTTNTTTAITDKALPARPLELMDGTPIGNGRQMMVLLRKRATVFKRNWLL
YLVAFLLPIAAAAMTTMYARGRGAPVCGPPDGKTVQDALGQMRKSDYRPMLAVGPASRLNESDLAQVLMPMLAEV
RQRHGPEGGGTDVSRSQLLWAHTYDDFGSMVRDRFRNLTAGVWLGADDETRPTVAWLANKAVTVPLLAQQLLDSL
QNRPPTTVLASWLPFDVPFDPGVGAVLNLVVYMGLALIFFPAFFGLYPSGERVSGVRALQYSNGVRPLPLWAAYA
MFDMSVVLPASALATALWAALAAGSWYHVGYVFVVLALYGLASTELAYLISLWAPSQLASFAWMTSLQAVFFLGY
LMAYVCVLTYVSVDRVDNTLLIAHFVLAAVAPICSVVRSLFIVTNLFSTACDGRQPSPNPGGLLLYGGPILYLVI
QIVVFFGLLLWFDSSGPRGLVSPHRRVRRGSLASNVDQDEAVVSPAGLSVRNLTKSFGRNTAVDNVSFDVARGEV
FALLGPNGAGKSTTMALIRGDERPSRGGGDVMVGPVSVTRRRAAARALLGVCPQADALDSCMTVREHLDFYARVR
GVPDAHHNVEEVIRAVGLQALSQRMATALSGGNKRKLNLAIALMGNPAVVLLDEPSSGLDAAAKRVLWPVLASTA
AGRSILLTTHSMEEADALAARAGILSRRMLAVGSLDELRQRAGHRLHVHLVASSAPRTTAEEMAAMTEWVRIAMP
DAEMEAATYHGQLRFAVRAQDVSSASANLARHSRHVSHQQQEQQQPDATKPECKPSLPVVIREKDAPDSDLDSDS
SDAMTPVLAPTTKHASHALQRQSHHA*
Coding >Ophun1|3927
ATGGGTGCCAAGCAGCCGGCCAAGTGCCTGCTGCTCCGCCAGATATGGACGCTCATGAAAAAGGATCTCCGATGC
CTGATCCGGCGGCACGGGATCCTCATGGTCTTCGTGGCCTTTGTCATGCCGATCCTCCTGGCGGGCTTCTTTACC
TTTGCTAAGAGCCTATTCCTGCCACCGGCCCAGTACGGCATCGGCAGCGCCCGACCCATCATGACGCTGCGGGAA
GCGGCCGAAACGGCGCATAACAGCGGCCACGACCGGCTGATCTTGGTCGACGGCCCGACCGACCAGAAAGGCCAG
TACAACATGTCACGCGTGCTCGACGTCATCGAGGAGGAGACGCGATCTTACGGGTCGCTGCTGCAGACGATTCGC
GTCTCCCACGAGAGGGAGCTCGGGTCGCACTGCCGCAGCTCACTGAGAGGCGTGACACGGTGCCTGGGGGCCGTC
GTGATGCGTGGAGCGCCGCCATCCGGGAATTGGAATTATACCATTCGGACCGACGCCTTCGTAGCCTCGGGCCCG
CGGTCCATTCAGGTGGACCACGATAAGAACCTGGAGCAGGTGTTTGTTCTGCCGCTGCAACGGGCCGTTGACTCT
GTCATCGCCACCATCGAAGGCCACGGGCCCCTGCCATCGGCCGACCAGTGGCCCTTTACCAGCCAGACGCAGGCC
GAGCACGGCGAAAAAGCCCGGATGAAATATCTTGACAACATCATCAGCTTCATGGGCGTCGCCTTTGTGACCACC
ATCGTCGGCGTCACCTATCATCTGGCCGGCGCCGTGGCCACCGACCGCGAGTCCGGCATGGCTCGTCTGATGGAC
GCCATGATGCCAGGGGGCCGTCCCGGGGCGGCTCAGGCGACGCGCATCGTGGCCCATCACCTCGCCTACACGGCC
TTGTACGCTCCGGCATGGATCGTGGCTGCCTTCATCATCCGGTACGGCATCTTCATCCATACGTCCATCGTCATG
GTCGTGGTGCTACAGCTTCTCGCCGGACTTGCACTCGTCTCCATGGCCATCTTGATCGCCAGCTTCTTCAGCCGG
GCCCAGCTCAGCAGCTCGAGCGCGACGCTGGCGACGCTGATATTGGCCATCCTGGCCCAGTCGCTGACATCGCCG
AGAACGACGACGGTATCCGTGCTCTCGGCCCTGTTCGCGCCCTGTAACTACGTCTACTTCGTGACGCTCATGGCA
CGCTTCGAGCGGGACAACCGGCCGACGAGTCTCCTGGACGAGGCTCCCCGCAACAGCCCCTGGTCGGTGCCGGGT
CTGGCCCTGTGGCTGCTGCTCGGGATGCAGATCATCTGCTATCCGCTGCTGGCGGCCTGGGTGGAGCGATGGCGC
TTCGGCACGCCGGCCGACGGGCGACGCTACGGCCGGCCGAAGCCGGAGGCGGACGAGGACGAGACGGCGGTGCAG
CTCGACGGGCTCACCAAGGTCTACTATCCGGCCCTGTTACCGCGGCTGGCCTCGTACCTCCGGTGCGGCCGAGCG
GCAGAGCCGGTGGTGGCGGTCAACGGGCTGAGCCTCAGCTGCCGGCGCGGCCAGATCGTGACGCTTCTCGGGGCC
AACGGCAGCGGCAAGAGCACGACTCTCGACGCCATCGCCGGTCTTCACCAGCCTACGGGCGGCTCCATCGTCGTC
GACGGCGGGCTCGGTATCGCGCCGCAGAAGAACGTGCTGTGGGACGACGTGACGGTACAGGACCATCTGGAAATC
TTTGGCAGGCTCAAGTCGCCAGCCCAGCCGCCGACGGCCCAAGAGACGGCCGACCTCGTCCGGGCCATCGACCTG
TGGCCCAAGCGGGACGCGCTGGCCAAGACGCTCTCGGGCGGACAGAAGCGCAAGCTCCAGCTGGGCATGATGCTG
GCCGGCGGCAGCTCCGTCTGCTGCGTCGACGAGGTCAGCAGCGGGCTGGATCCCATCTCGAGGCGCAAGATATGG
GACATTCTGCTGGCGGAGCGCGGCCGGAGAACGCTGATTGTGACGACGCACTTTCTCGACGAGGCCGACCTGCTG
GCTGATCACATGGCCGTCTTGTCTCGAGGCACGCTCCGGGCCGCTGGCTCGTCGGTAGAGCTCAAGGAGAGGTTC
GGCGGCGGCTATCACGTGCGCGTTCCGGCCGGGTCCGGGCCCGAGGTGGACGGAGTGGGGCGCAAGGAGGCTCCG
GACGGGACGACGTACGCGGCGCCGACTTCGGACCTGGCGGCTCGCGTCATCCGGAAGCTCGAAGACGCTGGCATC
GGCGATTACCATTTCTCCAGTCCGACTATCGAGGATGTCTTTTTGCGGCTGGCCGAAGAGGTGGCCGTGGATGAG
ACGACGACTAACACCACCACCGCCATCACCGACAAGGCTCTTCCGGCCCGGCCGCTTGAACTCATGGACGGCACT
CCGATCGGGAACGGACGGCAGATGATGGTGCTACTGCGGAAGCGGGCCACCGTCTTCAAGCGCAACTGGTTGCTG
TACCTGGTGGCCTTTTTGCTGCCCATCGCGGCGGCGGCCATGACGACGATGTATGCACGAGGCAGGGGAGCGCCA
GTCTGCGGGCCTCCAGATGGGAAAACGGTTCAGGATGCTCTGGGCCAGATGCGAAAGAGCGACTACCGTCCGATG
CTGGCTGTCGGGCCGGCATCACGGCTGAACGAGTCGGACCTGGCCCAGGTCCTGATGCCGATGCTGGCAGAGGTG
CGGCAGAGGCACGGTCCCGAGGGCGGAGGGACCGATGTGAGCCGGAGCCAGCTCTTGTGGGCACACACGTACGAC
GATTTCGGCAGCATGGTCAGGGACAGATTCCGGAACCTGACGGCCGGCGTCTGGCTCGGAGCCGACGACGAGACG
CGGCCGACGGTGGCCTGGCTGGCCAATAAGGCGGTCACGGTGCCGCTGCTGGCGCAACAGCTGCTCGACTCGCTG
CAGAACAGGCCGCCGACGACGGTGCTGGCCTCGTGGCTACCCTTTGACGTGCCCTTTGACCCAGGCGTCGGGGCG
GTGCTCAACCTGGTCGTCTACATGGGACTGGCCCTGATCTTCTTCCCTGCCTTCTTCGGCCTCTACCCCAGCGGA
GAGCGTGTCAGCGGCGTCCGGGCCCTTCAGTACTCCAACGGCGTCCGACCGCTGCCTCTCTGGGCCGCCTACGCC
ATGTTCGACATGTCCGTCGTCCTTCCGGCCTCGGCGCTGGCTACGGCTCTCTGGGCGGCGCTGGCGGCCGGATCG
TGGTATCACGTCGGCTACGTCTTCGTCGTCCTGGCTCTGTACGGTCTGGCCTCGACGGAGCTGGCCTACCTGATC
TCCCTGTGGGCGCCGTCGCAGCTGGCGAGCTTTGCCTGGATGACGTCGCTGCAGGCCGTCTTTTTCCTCGGCTAC
CTCATGGCCTACGTCTGTGTACTGACGTATGTGAGCGTTGACCGGGTCGACAACACGCTCCTCATCGCTCACTTT
GTTCTGGCCGCTGTGGCGCCCATCTGCTCCGTCGTCCGCTCGCTCTTCATCGTCACTAACCTCTTCTCAACCGCC
TGTGACGGTCGTCAGCCCTCGCCGAATCCCGGTGGCTTGCTGCTGTACGGCGGACCGATTCTATACCTGGTCATC
CAGATCGTCGTCTTCTTCGGCCTGCTCCTCTGGTTCGACTCGTCCGGTCCGCGCGGTCTCGTATCACCTCATCGA
AGGGTCCGTCGCGGATCATTGGCCAGCAACGTCGATCAAGATGAGGCCGTCGTCTCTCCCGCGGGCCTCAGCGTC
AGGAACCTCACCAAGTCCTTCGGCCGCAACACAGCCGTCGACAACGTCTCCTTCGACGTCGCTCGCGGAGAAGTC
TTTGCCCTGCTCGGTCCCAACGGCGCCGGAAAGTCGACGACCATGGCCCTGATCCGCGGAGACGAGCGGCCCAGT
CGCGGCGGAGGCGACGTCATGGTCGGGCCCGTCTCCGTGACGCGTCGTCGAGCAGCCGCCAGGGCTCTCCTCGGA
GTCTGTCCGCAGGCCGACGCTCTCGACTCGTGTATGACTGTCCGCGAGCATCTCGATTTCTACGCCCGCGTCCGG
GGCGTGCCGGACGCTCATCACAACGTCGAGGAAGTCATCCGTGCCGTCGGACTGCAGGCCCTCTCCCAGCGGATG
GCCACGGCGCTCTCGGGAGGCAACAAGCGGAAACTCAACCTGGCCATTGCCCTGATGGGCAACCCGGCCGTCGTC
CTACTCGACGAGCCTTCCTCGGGCCTCGACGCCGCCGCCAAGCGCGTCCTCTGGCCCGTCCTCGCCTCTACGGCA
GCCGGACGGTCCATCCTCCTGACGACGCACAGCATGGAAGAGGCCGACGCCTTGGCCGCCCGCGCCGGCATCCTC
TCTCGCCGAATGCTGGCCGTGGGTTCCCTCGACGAGCTCCGTCAAAGAGCCGGCCACCGGCTTCACGTCCACCTC
GTAGCATCGTCAGCTCCGCGAACGACGGCGGAGGAGATGGCCGCCATGACGGAATGGGTCCGCATCGCCATGCCA
GACGCCGAGATGGAAGCCGCAACGTACCACGGCCAACTCCGCTTCGCCGTCCGAGCCCAAGACGTATCCTCGGCC
TCGGCGAACCTCGCCCGTCACAGCCGCCACGTCTCACACCAGCAACAGGAACAGCAACAGCCAGACGCCACCAAG
CCCGAATGCAAACCCTCCCTCCCCGTCGTCATCCGCGAAAAGGACGCGCCGGACTCGGACCTCGACTCCGACTCT
TCGGACGCGATGACTCCTGTCCTCGCCCCGACGACCAAGCACGCTTCCCACGCACTACAGCGTCAGTCCCACCAC
GCTTGA
Transcript >Ophun1|3927
ATGGGTGCCAAGCAGCCGGCCAAGTGCCTGCTGCTCCGCCAGATATGGACGCTCATGAAAAAGGATCTCCGATGC
CTGATCCGGCGGCACGGGATCCTCATGGTCTTCGTGGCCTTTGTCATGCCGATCCTCCTGGCGGGCTTCTTTACC
TTTGCTAAGAGCCTATTCCTGCCACCGGCCCAGTACGGCATCGGCAGCGCCCGACCCATCATGACGCTGCGGGAA
GCGGCCGAAACGGCGCATAACAGCGGCCACGACCGGCTGATCTTGGTCGACGGCCCGACCGACCAGAAAGGCCAG
TACAACATGTCACGCGTGCTCGACGTCATCGAGGAGGAGACGCGATCTTACGGGTCGCTGCTGCAGACGATTCGC
GTCTCCCACGAGAGGGAGCTCGGGTCGCACTGCCGCAGCTCACTGAGAGGCGTGACACGGTGCCTGGGGGCCGTC
GTGATGCGTGGAGCGCCGCCATCCGGGAATTGGAATTATACCATTCGGACCGACGCCTTCGTAGCCTCGGGCCCG
CGGTCCATTCAGGTGGACCACGATAAGAACCTGGAGCAGGTGTTTGTTCTGCCGCTGCAACGGGCCGTTGACTCT
GTCATCGCCACCATCGAAGGCCACGGGCCCCTGCCATCGGCCGACCAGTGGCCCTTTACCAGCCAGACGCAGGCC
GAGCACGGCGAAAAAGCCCGGATGAAATATCTTGACAACATCATCAGCTTCATGGGCGTCGCCTTTGTGACCACC
ATCGTCGGCGTCACCTATCATCTGGCCGGCGCCGTGGCCACCGACCGCGAGTCCGGCATGGCTCGTCTGATGGAC
GCCATGATGCCAGGGGGCCGTCCCGGGGCGGCTCAGGCGACGCGCATCGTGGCCCATCACCTCGCCTACACGGCC
TTGTACGCTCCGGCATGGATCGTGGCTGCCTTCATCATCCGGTACGGCATCTTCATCCATACGTCCATCGTCATG
GTCGTGGTGCTACAGCTTCTCGCCGGACTTGCACTCGTCTCCATGGCCATCTTGATCGCCAGCTTCTTCAGCCGG
GCCCAGCTCAGCAGCTCGAGCGCGACGCTGGCGACGCTGATATTGGCCATCCTGGCCCAGTCGCTGACATCGCCG
AGAACGACGACGGTATCCGTGCTCTCGGCCCTGTTCGCGCCCTGTAACTACGTCTACTTCGTGACGCTCATGGCA
CGCTTCGAGCGGGACAACCGGCCGACGAGTCTCCTGGACGAGGCTCCCCGCAACAGCCCCTGGTCGGTGCCGGGT
CTGGCCCTGTGGCTGCTGCTCGGGATGCAGATCATCTGCTATCCGCTGCTGGCGGCCTGGGTGGAGCGATGGCGC
TTCGGCACGCCGGCCGACGGGCGACGCTACGGCCGGCCGAAGCCGGAGGCGGACGAGGACGAGACGGCGGTGCAG
CTCGACGGGCTCACCAAGGTCTACTATCCGGCCCTGTTACCGCGGCTGGCCTCGTACCTCCGGTGCGGCCGAGCG
GCAGAGCCGGTGGTGGCGGTCAACGGGCTGAGCCTCAGCTGCCGGCGCGGCCAGATCGTGACGCTTCTCGGGGCC
AACGGCAGCGGCAAGAGCACGACTCTCGACGCCATCGCCGGTCTTCACCAGCCTACGGGCGGCTCCATCGTCGTC
GACGGCGGGCTCGGTATCGCGCCGCAGAAGAACGTGCTGTGGGACGACGTGACGGTACAGGACCATCTGGAAATC
TTTGGCAGGCTCAAGTCGCCAGCCCAGCCGCCGACGGCCCAAGAGACGGCCGACCTCGTCCGGGCCATCGACCTG
TGGCCCAAGCGGGACGCGCTGGCCAAGACGCTCTCGGGCGGACAGAAGCGCAAGCTCCAGCTGGGCATGATGCTG
GCCGGCGGCAGCTCCGTCTGCTGCGTCGACGAGGTCAGCAGCGGGCTGGATCCCATCTCGAGGCGCAAGATATGG
GACATTCTGCTGGCGGAGCGCGGCCGGAGAACGCTGATTGTGACGACGCACTTTCTCGACGAGGCCGACCTGCTG
GCTGATCACATGGCCGTCTTGTCTCGAGGCACGCTCCGGGCCGCTGGCTCGTCGGTAGAGCTCAAGGAGAGGTTC
GGCGGCGGCTATCACGTGCGCGTTCCGGCCGGGTCCGGGCCCGAGGTGGACGGAGTGGGGCGCAAGGAGGCTCCG
GACGGGACGACGTACGCGGCGCCGACTTCGGACCTGGCGGCTCGCGTCATCCGGAAGCTCGAAGACGCTGGCATC
GGCGATTACCATTTCTCCAGTCCGACTATCGAGGATGTCTTTTTGCGGCTGGCCGAAGAGGTGGCCGTGGATGAG
ACGACGACTAACACCACCACCGCCATCACCGACAAGGCTCTTCCGGCCCGGCCGCTTGAACTCATGGACGGCACT
CCGATCGGGAACGGACGGCAGATGATGGTGCTACTGCGGAAGCGGGCCACCGTCTTCAAGCGCAACTGGTTGCTG
TACCTGGTGGCCTTTTTGCTGCCCATCGCGGCGGCGGCCATGACGACGATGTATGCACGAGGCAGGGGAGCGCCA
GTCTGCGGGCCTCCAGATGGGAAAACGGTTCAGGATGCTCTGGGCCAGATGCGAAAGAGCGACTACCGTCCGATG
CTGGCTGTCGGGCCGGCATCACGGCTGAACGAGTCGGACCTGGCCCAGGTCCTGATGCCGATGCTGGCAGAGGTG
CGGCAGAGGCACGGTCCCGAGGGCGGAGGGACCGATGTGAGCCGGAGCCAGCTCTTGTGGGCACACACGTACGAC
GATTTCGGCAGCATGGTCAGGGACAGATTCCGGAACCTGACGGCCGGCGTCTGGCTCGGAGCCGACGACGAGACG
CGGCCGACGGTGGCCTGGCTGGCCAATAAGGCGGTCACGGTGCCGCTGCTGGCGCAACAGCTGCTCGACTCGCTG
CAGAACAGGCCGCCGACGACGGTGCTGGCCTCGTGGCTACCCTTTGACGTGCCCTTTGACCCAGGCGTCGGGGCG
GTGCTCAACCTGGTCGTCTACATGGGACTGGCCCTGATCTTCTTCCCTGCCTTCTTCGGCCTCTACCCCAGCGGA
GAGCGTGTCAGCGGCGTCCGGGCCCTTCAGTACTCCAACGGCGTCCGACCGCTGCCTCTCTGGGCCGCCTACGCC
ATGTTCGACATGTCCGTCGTCCTTCCGGCCTCGGCGCTGGCTACGGCTCTCTGGGCGGCGCTGGCGGCCGGATCG
TGGTATCACGTCGGCTACGTCTTCGTCGTCCTGGCTCTGTACGGTCTGGCCTCGACGGAGCTGGCCTACCTGATC
TCCCTGTGGGCGCCGTCGCAGCTGGCGAGCTTTGCCTGGATGACGTCGCTGCAGGCCGTCTTTTTCCTCGGCTAC
CTCATGGCCTACGTCTGTGTACTGACGTATGTGAGCGTTGACCGGGTCGACAACACGCTCCTCATCGCTCACTTT
GTTCTGGCCGCTGTGGCGCCCATCTGCTCCGTCGTCCGCTCGCTCTTCATCGTCACTAACCTCTTCTCAACCGCC
TGTGACGGTCGTCAGCCCTCGCCGAATCCCGGTGGCTTGCTGCTGTACGGCGGACCGATTCTATACCTGGTCATC
CAGATCGTCGTCTTCTTCGGCCTGCTCCTCTGGTTCGACTCGTCCGGTCCGCGCGGTCTCGTATCACCTCATCGA
AGGGTCCGTCGCGGATCATTGGCCAGCAACGTCGATCAAGATGAGGCCGTCGTCTCTCCCGCGGGCCTCAGCGTC
AGGAACCTCACCAAGTCCTTCGGCCGCAACACAGCCGTCGACAACGTCTCCTTCGACGTCGCTCGCGGAGAAGTC
TTTGCCCTGCTCGGTCCCAACGGCGCCGGAAAGTCGACGACCATGGCCCTGATCCGCGGAGACGAGCGGCCCAGT
CGCGGCGGAGGCGACGTCATGGTCGGGCCCGTCTCCGTGACGCGTCGTCGAGCAGCCGCCAGGGCTCTCCTCGGA
GTCTGTCCGCAGGCCGACGCTCTCGACTCGTGTATGACTGTCCGCGAGCATCTCGATTTCTACGCCCGCGTCCGG
GGCGTGCCGGACGCTCATCACAACGTCGAGGAAGTCATCCGTGCCGTCGGACTGCAGGCCCTCTCCCAGCGGATG
GCCACGGCGCTCTCGGGAGGCAACAAGCGGAAACTCAACCTGGCCATTGCCCTGATGGGCAACCCGGCCGTCGTC
CTACTCGACGAGCCTTCCTCGGGCCTCGACGCCGCCGCCAAGCGCGTCCTCTGGCCCGTCCTCGCCTCTACGGCA
GCCGGACGGTCCATCCTCCTGACGACGCACAGCATGGAAGAGGCCGACGCCTTGGCCGCCCGCGCCGGCATCCTC
TCTCGCCGAATGCTGGCCGTGGGTTCCCTCGACGAGCTCCGTCAAAGAGCCGGCCACCGGCTTCACGTCCACCTC
GTAGCATCGTCAGCTCCGCGAACGACGGCGGAGGAGATGGCCGCCATGACGGAATGGGTCCGCATCGCCATGCCA
GACGCCGAGATGGAAGCCGCAACGTACCACGGCCAACTCCGCTTCGCCGTCCGAGCCCAAGACGTATCCTCGGCC
TCGGCGAACCTCGCCCGTCACAGCCGCCACGTCTCACACCAGCAACAGGAACAGCAACAGCCAGACGCCACCAAG
CCCGAATGCAAACCCTCCCTCCCCGTCGTCATCCGCGAAAAGGACGCGCCGGACTCGGACCTCGACTCCGACTCT
TCGGACGCGATGACTCCTGTCCTCGCCCCGACGACCAAGCACGCTTCCCACGCACTACAGCGTCAGTCCCACCAC
GCTTGA
Gene >Ophun1|3927
ATGGGTGCCAAGCAGCCGGCCAAGTGCCTGCTGCTCCGCCAGATATGGACGCTCATGAAAAAGGATCTCCGATGC
CTGATCCGGCGGCACGGGATCCTCATGGTCTTCGTGGCCTTTGTCATGCCGATCCTCCTGGCGGGCTTCTTTACC
TTTGCTAAGAGCCTATTCCTGCCACCGGCCCAGTACGGCATCGGCAGCGCCCGACCCATCATGACGCTGCGGGAA
GCGGCCGAAACGGCGCATAACAGCGGCCACGACCGGCTGATCTTGGTCGACGGCCCGACCGACCAGAAAGGCCAG
TACAACATGTCACGCGTGCTCGACGTCATCGAGGAGGAGACGCGATCTTACGGGTCGCTGCTGCAGACGATTCGC
GTCTCCCACGAGAGGGAGCTCGGGTCGCACTGCCGCAGCTCACTGAGAGGCGTGACACGGTGCCTGGGGGCCGTC
GTGATGCGTGGAGCGCCGCCATCCGGGAATTGGAATTATACCATTCGGACCGACGCCTTCGTAGCCTCGGGCCCG
CGGTCCATTCAGGTGGACCACGATAAGAACCTGGAGCAGGTGTTTGTTCTGCCGCTGCAACGGGCCGTTGACTCT
GTCATCGCCACCATCGAAGGCCACGGGCCCCTGCCATCGGCCGACCAGTGGCCCTTTACCAGCCAGACGCAGGCC
GAGCACGGCGAAAAAGCCCGGATGAAATATCTTGACAACATCATCAGCTTCATGGGCGTCGCCTTTGTGACCACC
ATCGTCGGCGTCACCTATCATCTGGCCGGCGCCGTGGCCACCGACCGCGAGTCCGGCATGGCTCGTCTGATGGAC
GCCATGATGCCAGGGGGCCGTCCCGGGGCGGCTCAGGCGACGCGCATCGTGGCCCATCACCTCGCCTACACGGCC
TTGTACGCTCCGGCATGGATCGTGGCTGCCTTCATCATCCGGTACGGCATCTTCATCCATACGTCCATCGTCATG
GTCGTGGTGCTACAGCTTCTCGCCGGACTTGCACTCGTCTCCATGGCCATCTTGATCGCCAGCTTCTTCAGCCGG
GCCCAGCTCAGCAGCTCGAGCGCGACGCTGGCGACGCTGATATTGGCCATCCTGGCCCAGTCGCTGACATCGCCG
AGAACGACGACGGTATCCGTGCTCTCGGCCCTGTTCGCGCCCTGTAACTACGTCTACTTCGTGACGCTCATGGCA
CGCTTCGAGCGGGACAACCGGCCGACGAGTCTCCTGGACGAGGCTCCCCGCAACAGCCCCTGGTCGGTGCCGGGT
CTGGCCCTGTGGCTGCTGCTCGGGATGCAGATCATCTGCTATCCGCTGCTGGCGGCCTGGGTGGAGCGATGGCGC
TTCGGCACGCCGGCCGACGGGCGACGCTACGGCCGGCCGAAGCCGGAGGCGGACGAGGACGAGACGGCGGTGCAG
CTCGACGGGCTCACCAAGGTCTACTATCCGGCCCTGTTACCGCGGCTGGCCTCGTACCTCCGGTGCGGCCGAGCG
GCAGAGCCGGTGGTGGCGGTCAACGGGCTGAGCCTCAGCTGCCGGCGCGGCCAGATCGTGACGCTTCTCGGGGCC
AACGGCAGCGGCAAGAGCACGACTCTCGACGCCATCGCCGGTCTTCACCAGCCTACGGGCGGCTCCATCGTCGTC
GACGGCGGGCTCGGTATCGCGCCGCAGAAGAACGTGCTGTGGGACGACGTGACGGTACAGGACCATCTGGAAATC
TTTGGCAGGCTCAAGTCGCCAGCCCAGCCGCCGACGGCCCAAGAGACGGCCGACCTCGTCCGGGCCATCGACCTG
TGGCCCAAGCGGGACGCGCTGGCCAAGACGCTCTCGGGCGGACAGAAGCGCAAGCTCCAGCTGGGCATGATGCTG
GCCGGCGGCAGCTCCGTCTGCTGCGTCGACGAGGTCAGCAGCGGGCTGGATCCCATCTCGAGGCGCAAGATATGG
GACATTCTGCTGGCGGAGCGCGGCCGGAGAACGCTGATTGTGACGACGCACTTTCTCGACGAGGCCGACCTGCTG
GCTGATCACATGGCCGTCTTGTCTCGAGGCACGCTCCGGGCCGCTGGCTCGTCGGTAGAGCTCAAGGAGAGGTTC
GGCGGCGGCTATCACGTGCGCGTTCCGGCCGGGTCCGGGCCCGAGGTGGACGGAGTGGGGCGCAAGGAGGCTCCG
GACGGGACGACGTACGCGGCGCCGACTTCGGACCTGGCGGCTCGCGTCATCCGGAAGCTCGAAGACGCTGGCATC
GGCGATTACCATTTCTCCAGTCCGACTATCGAGGATGTCTTTTTGCGGCTGGCCGAAGAGGTGGCCGTGGATGAG
ACGACGACTAACACCACCACCGCCATCACCGACAAGGCTCTTCCGGCCCGGCCGCTTGAACTCATGGACGGCACT
CCGATCGGGAACGGACGGCAGATGATGGTGCTACTGCGGAAGCGGGCCACCGTCTTCAAGCGCAACTGGTTGCTG
TACCTGGTGGCCTTTTTGCTGCCCATCGCGGCGGCGGCCATGACGACGATGTATGCACGAGGCAGGGGAGCGCCA
GTCTGCGGGCCTCCAGATGGGAAAACGGTTCAGGATGCTCTGGGCCAGATGCGAAAGAGCGACTACCGTCCGATG
CTGGCTGTCGGGCCGGCATCACGGCTGAACGAGTCGGACCTGGCCCAGGTCCTGATGCCGATGCTGGCAGAGGTG
CGGCAGAGGCACGGTCCCGAGGGCGGAGGGACCGATGTGAGCCGGAGCCAGCTCTTGTGGGCACACACGTACGAC
GATTTCGGCAGCATGGTCAGGGACAGATTCCGGAACCTGACGGCCGGCGTCTGGCTCGGAGCCGACGACGAGACG
CGGCCGACGGTGGCCTGGCTGGCCAATAAGGCGGTCACGGTGCCGCTGCTGGCGCAACAGCTGCTCGACTCGCTG
CAGAACAGGCCGCCGACGACGGTGCTGGCCTCGTGGCTACCCTTTGACGTGCCCTTTGACCCAGGCGTCGGGGCG
GTGCTCAACCTGGTCGTCTACATGGGACTGGCCCTGATCTTCTTCCCTGCCTTCTTCGGCCTCTACCCCAGCGGA
GAGCGTGTCAGCGGCGTCCGGGCCCTTCAGTACTCCAACGGCGTCCGACCGCTGCCTCTCTGGGCCGCCTACGCC
ATGTTCGACATGTCCGTCGTCCTTCCGGCCTCGGCGCTGGCTACGGCTCTCTGGGCGGCGCTGGCGGCCGGATCG
TGGTATCACGTCGGCTACGTCTTCGTCGTCCTGGCTCTGTACGGTCTGGCCTCGACGGAGCTGGCCTACCTGATC
TCCCTGTGGGCGCCGTCGCAGCTGGCGAGCTTTGCCTGGATGACGTCGCTGCAGGCCGTCTTTTTCCTCGGCTAC
CTCATGGCCTACGTCTGTGTACTGACGTATGTGAGCGTTGACCGGGTCGACAACACGCTCCTCATCGCTCACTTT
GTTCTGGCCGCTGTGGCGCCCATCTGCTCCGTCGTCCGCTCGCTCTTCATCGTCACTAACCTCTTCTCAACCGCC
TGTGACGGTCGTCAGCCCTCGCCGAATCCCGGTGGCTTGCTGCTGTACGGCGGACCGATTCTATACCTGGTCATC
CAGATCGTCGTCTTCTTCGGCCTGCTCCTCTGGTTCGACTCGTCCGGTCCGCGCGGTCTCGTATCACCTCATCGA
AGGGTCCGTCGCGGATCATTGGCCAGCAACGTCGATCAAGATGAGGCCGTCGTCTCTCCCGCGGGCCTCAGCGTC
AGGAACCTCACCAAGTCCTTCGGCCGCAACACAGCCGTCGACAACGTCTCCTTCGACGTCGCTCGCGGAGAAGTC
TTTGCCCTGCTCGGTCCCAACGGCGCCGGAAAGTCGACGACCATGGCCCTGATCCGCGGAGACGAGCGGCCCAGT
CGCGGCGGAGGCGACGTCATGGTCGGGCCCGTCTCCGTGACGCGTCGTCGAGCAGCCGCCAGGGCTCTCCTCGGA
GTCTGTCCGCAGGCCGACGCTCTCGACTCGTGTATGACTGTCCGCGAGCATCTCGATTTCTACGCCCGCGTCCGG
GGCGTGCCGGACGCTCATCACAACGTCGAGGAAGTCATCCGTGCCGTCGGACTGCAGGCCCTCTCCCAGCGGATG
GCCACGGCGCTCTCGGGAGGCAACAAGCGGAAACTCAACCTGGCCATTGCCCTGATGGGCAACCCGGCCGTCGTC
CTACTCGACGAGCCTTCCTCGGGCCTCGACGCCGCCGCCAAGCGCGTCCTCTGGCCCGTCCTCGCCTCTACGGCA
GCCGGACGGTCCATCCTCCTGACGACGCACAGCATGGAAGAGGCCGACGCCTTGGCCGCCCGCGCCGGCATCCTC
TCTCGCCGAATGCTGGCCGTGGGTTCCCTCGACGAGCTCCGTCAAAGAGCCGGCCACCGGCTTCACGTCCACCTC
GTAGCATCGTCAGCTCCGCGAACGACGGCGGAGGAGATGGCCGCCATGACGGAATGGGTCCGCATCGCCATGCCA
GACGCCGAGATGGAAGCCGCAACGTACCACGGCCAACTCCGCTTCGCCGTCCGAGCCCAAGACGTATCCTCGGCC
TCGGCGAACCTCGCCCGTCACAGCCGCCACGTCTCACACCAGCAACAGGAACAGCAACAGCCAGACGCCACCAAG
CCCGAATGCAAACCCTCCCTCCCCGTCGTCATCCGCGAAAAGGACGCGCCGGACTCGGACCTCGACTCCGACTCT
TCGGACGCGATGACTCCTGTCCTCGCCCCGACGACCAAGCACGCTTCCCACGGTTCGCTCGGCCGGCTCGTCGTC
TTGCTCGAGAGGCACAAGGCCAGTCTGGGCGTCGAGCACTACAGCGTCAGTCCCACCACGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail